Μέγεθος: px
Εμφάνιση ξεκινά από τη σελίδα:




2 2

3 3

4 4


6 6

7 Στην σύζυγο μου Ευγενία, το γιο μου Γεώργιο και τους γονείς μου 7

8 8

9 ΤΡΙΜΕΛΗΣ ΕΠΙΤΡΟΠΗ: 1. ΔΗΜΗΤΡΙΟΣ ΣΙΑΜΠΛΗΣ, Καθηγητής Ακτινολογίας, Τμήμα Ιατρικής, Πανεπιστήμιο Πατρών, Επιβλέπων Καθηγητής 2. ΝΙΚΟΛΑΟΣ ΤΣΟΠΑΝΟΓΛΟΥ, Αναπληρωτής Καθηγητής Φαρμακολογίας, Τμήμα Ιατρικής, Πανεπιστήμιο Πατρών 3. ΔΗΜΗΤΡΙΟΣ ΚΑΡΝΑΜΠΑΤΙΔΗΣ, Επίκουρος Καθηγητής Επεμβατικής Ακτινολογίας, Τμήμα Ιατρικής, Πανεπιστήμιο Πατρών ΕΠΤΑΜΕΛΗΣ ΕΠΙΤΡΟΠΗ: 1. ΔΗΜΗΤΡΙΟΣ ΣΙΑΜΠΛΗΣ, Καθηγητής Ακτινολογίας, Τμήμα Ιατρικής, Πανεπιστήμιο Πατρών, Επιβλέπων Καθηγητής 2. ΝΙΚΟΛΑΟΣ ΤΣΟΠΑΝΟΓΛΟΥ, Αναπληρωτής Καθηγητής Φαρμακολογίας, Τμήμα Ιατρικής, Πανεπιστήμιο Πατρών 3. ΔΗΜΗΤΡΙΟΣ ΚΑΡΝΑΜΠΑΤΙΔΗΣ, Επίκουρος Καθηγητής Επεμβατικής Ακτινολογίας, Τμήμα Ιατρικής, Πανεπιστήμιο Πατρών 4. ΘΕΟΔΩΡΟΣ ΠΕΤΣΑΣ, Καθηγητής Ακτινολογίας, Τμήμα Ιατρικής, Πανεπιστήμιο Πατρών 5. ΔΗΜΗΤΡΙΟΣ ΓΟΥΜΕΝΟΣ, Καθηγητής Παθολογίας-Νεφρολογίας, Τμήμα Ιατρικής, Πανεπιστήμιο Πατρών 6. ΕΛΕΝΗ ΠΕΤΡΟΥ-ΠΑΠΑΔΑΚΗ, Καθηγήτρια Ανατομικής-Ιστολογίας- Εμβρυολογίας, Τμήμα Ιατρικής, Πανεπιστήμιο Πατρών 7. ΕΥΑΓΓΕΛΟΣ ΛΙΑΤΣΙΚΟΣ, Αναπληρωτής Καθηγητής Ουρολογίας, Τμήμα Ιατρικής, Πανεπιστήμιο Πατρών 9

10 Πίνακας Περιεχομένων Κατάλογος πινάκων-εικόνων-γραφημάτων Συντομογραφίες 15 Ευχαριστίες Περίληψη Ελληνική Περίληψη Αγγλική (Abstract) Γενικό μέρος Εισαγωγή - Σκιαγραφικά μέσα αντίθεσης-ορισμός-κατηγορίες Ιωδιούχα σκιαγραφικά μέσα αντίθεσης-ορισμός-τύποι Γενεές Ιωδιούχων Σκιαγραφικών Μέσων Παρενέργειες / ανεπιθύμητες αντιδράσεις από τη χορήγηση 37 ιωδιούχων σκιαγραφικών μέσων Μη νεφρικές και διάφορες άλλες ανεπιθύμητες αντιδράσεις από τη χορήγηση ιωδιούχων σκιαγραφικών μέσων Νεφρικές ανεπιθύμητες αντιδράσεις από τη χορήγηση ιωδιούχων σκιαγραφικών μέσων Παθοφυσιολογία ΝΣΜ Νοσηρότητα και Θνητότητα ΝΣΜ Πρόληψη ΝΣΜ Παρστατίνη

11 Ειδικό μέρος Επιστημονικός σκοπός 65 Υλικά και Μέθοδοι Παρστατίνη και Πειραματόζωα Μέρος Ι: Πειραματικό Μοντέλο Νεφροτοξικότητας σε Κόνικλους Μέρος ΙΙ: Συστηματική δοκιμή Παρστατίνη Εργαστηριακές μετρήσεις - Ιστοπαθολογική εξέταση Στατιστική Ανάλυση Αποτελέσματα Μέρος Ι: Ανάπτυξη Πειραματικού Μοντέλου Νεφροτοξικότητας σε κονίκλους Μέρος ΙΙ: Συστηματική δοκιμή Παρστατίνης Ιστολογικά αποτελέσματα/ευρήματα Συζήτηση Βιβλιογραφία

12 ΚΑΤΑΛΟΓΟΣ ΠΙΝΑΚΩΝ Πίνακας 1: Ταξινόμηση των άμεσων ανεπιθύμητων αντιδράσεων στα ΣΜ Πίνακας 2: Παράγοντες κινδύνου για ανάπτυξη ΝΣΜ Πίνακας 3: Πειραματικές συνθήκες Πίνακας 4: Σύγκριση ομάδας Sham με ομάδα control Πίνακας 5: Aναλυτική παρουσίαση των τιμών της κρεατινίνης ορού (scr) Πίνακας 6: Ποσοστά εμφάνισης κλινικά σημαντικής ΝΣΜ Πίνακας 7: Ιστοπαθολογικές βαθμολογίες (Βαθμοί νέκρωσης) 12

13 ΚΑΤΑΛΟΓΟΣ ΕΙΚΟΝΩΝ Εικόνα 1.: Υποκατάσταση των Η+ στα ιωδιούχα σκιαγραφικά μέσα Εικόνα 2.: Κατηγοριοποίηση των σκιαγραφικών μέσων Εικόνα 3 & 4.: Σχηματική απεικόνιση του τρόπου με τον οποίο συνδέεται η θρομβίνη με τον υποδοχέα PAR1 Εικόνα 5.: Διαχωρισμός Παρστατίνης σε υδρόφοβο και υδρόφιλο τμήμα Εικόνα 6.: Iopromide Εικόνα 7.: Ενδοφλέβια διωτιαία πρόσβαση. Εικόνα 8 & 9.: Ιστολογικές τομές μετά από χρώση με αιματοξυλίνη και ιωσίνη. Τομές με μεγέθυνση Χ10 και Χ20 13

14 ΚΑΤΑΛΟΓΟΣ ΓΡΑΦΗΜΑΤΩΝ Γράφημα 1: Γραφική αναπαράσταση της διαφοράς της τιμής της κρεατινίνης ορού μεταξύ των δύο ομάδων του 1 ου μέρους των πειραμάτων Γράφημα 2: Αναλυτική απεικόνιση του σχεδιασμού του 2 ου μέρους της ερευνητικής εργασίας Γράφημα 3: Κατανομή των τιμών της κρεατινίνης ορού (scr) μεταξύ των διάφορων υπό-ομάδων που χρησιμοποιήθηκαν στα πειράματα Γράφημα 4: Γραφική αναπαράσταση της κατανομής των τιμών κρεατινίνης ορού του συνόλου των πειραματόζωων που μελετήθηκαν Γράφημα 5: Γραφική απεικόνιση της κατανομής των βαθμολογιών σωληναριακής νέκρωσης Γράφημα 6: Συσχέτιση μεταξύ των βαθμολογιών σωληναριακής νέκρωσης και των τιμών της κρεατινίνης ορού στα ελεγχθέντα δείγματα 14

15 ΣΥΝΤΟΜΟΓΡΑΦΙΕΣ ΣΜ: σκιαγραφικά μέσα αντίθεσης ΙΣΜ: Ιωδιούχα Σκιαγραφικά Μέσα ΝΣΜ: Νεφροτοξικότητα οφειλόμενη στα σκιαγραφικά μέσα CIN: Contrast Induced Nephropathy CM: contrast medium scr: serum Creatinine ESUR: European Society of Urogenetical Radiology - Ευρωπαϊκή Εταιρεία Ουροποιογεννητικής Ακτινολογίας ROS: Reactive Oxygen Species egfr: Glomerular Filtration Rate BUN: Blood Urea Nitrogen NSAIDs: Nonsteroid Anti-inflammatory Drugs PAR1: Protease-activated receptor 1 PARs: Protease-activated receptors 15

16 ΕΥΧΑΡΙΣΤΙΕΣ Η μελέτη αυτή διεξήχθη στο πλαίσιο του Μεταπτυχιακού Προγράμματος Σπουδών στις Κλινικές-Κλινικοεργαστηριακές Ιατρικές Ειδικότητες του Τμήματος Ιατρικής του Πανεπιστημίου Πατρών υπό την επίβλεψη του Καθηγητή κύριου Δημήτριου Σιαμπλή. Η εκπόνηση μίας Διδακτορικής Διατριβής είναι αποτέλεσμα συνεργασίας μίας σειράς ανθρώπων. Απαιτείται η συνεισφορά αρκετών δασκάλων, φίλων και συνεργατών. Πρωτίστως θα ήθελα να ευχαριστήσω τα μέλη της τριμελούς συμβουλευτικής επιτροπής για την συμβολή τους στην ολοκλήρωση αυτής της διδακτορικής διατριβής. Ξεκινώντας, θα ήθελα να ευχαριστήσω τον Καθηγητή Ακτινολογίας, Δημήτριο Σιαμπλή, γιατί εκτός του ότι με ενέπνευσε να ολοκληρώσω την διατριβή μου, υπήρξε για μένα δάσκαλος μυώντας με και μαθαίνοντας μου όλα τα μυστικά της Επεμβατικής Ακτινολογίας καθ όλη την διάρκεια της ειδικότητας. Συμβουλεύοντάς με στις πρώτες, δύσκολες επιλογές μου αλλά και εμπνέοντας με να ασχοληθώ με την εξειδίκευση της Επεμβατικής Ακτινολογίας. Κοντά του είχα την ευκαιρία να γίνω καλύτερος γιατρός αλλά και άνθρωπος. Η ακεραιότητα, η εργατικότητα και το πάθος για την ιατρική που τον διακρίνουν θα αποτελούν για μένα οδηγό στην μετέπειτα πορεία μου. Οφείλω να τον ευχαριστήσω για την στήριξη και συμπαράστασή του, τόσο επιστημονικά όσο και ανθρώπινα, σε κάθε βήμα αυτής της δύσκολης πορείας. Ελπίζω να αισθάνεται δικαιωμένος μιας και επαγγελματικά ακολουθώ την κατεύθυνση που μου έδειξε και μου δίδαξε. Τον Επίκουρο Καθηγητή Ακτινολογίας κύριο Δημήτριο Καρναμπατίδη η αμέριστη βοήθεια του οποίου, σε κάθε φάση αυτής της πορείας υπήρξε πολύτιμη και 16

17 καθοριστική. Πιο σημαντική όμως για μένα υπήρξε η πίστη που όλα αυτά τα χρόνια έδειξε στις δυνατότητες μου καθώς και η στήριξη που προσέφερε. Θα ήθελα επίσης να τον ευχαριστήσω γιατί και αυτός με τη σειρά του με δίδαξε την τέχνη της Επεμβατικής Ακτινολογίας αλλά και για το ότι η εργατικότητα του και ακεραιότητα του αποτέλεσαν παράδειγμα προς μίμηση. Τον Αναπληρωτή Καθηγητή Φαρμακολογίας, κύριο Νικόλαο Τσοπάνογλου για την στήριξη του και συμβολή του καθ όλη την πορεία αυτής της ερευνητικής εργασίας. Η πίστη του στην βασική ιδέα, τον πυρήνα αυτής της εργασίας, η βαθειά γνώση του θέματος και η αμέριστη βοήθειά του, σε κάθε φάση της πραγμάτωσης της ερευνητικής αυτής μελέτης υπήρξε πολύτιμη και καθοριστική. Η εφαρμογή των Βασικών Επιστημών στην Κλινική Ιατρική είναι ένα δύσκολο μονοπάτι που μόνο άνθρωποι με επιστημονική κατάρτιση του επιπέδου του κυρίου Τσοπάνογλου μπορούν να επιτύχουν. Οι πολύωρες συζητήσεις επί των παρατηρήσεων καθώς και η συνεισφορά του κατά την διενέργεια των πειραμάτων αποτέλεσαν καταλύτη στην τελική επιτυχή ολοκλήρωση της διατριβής αυτής. Θα ήταν φυσικά παράλειψη να μην αναφερθώ στον καλό μου φίλο και συνεργάτη κύριο Κωνσταντίνο Κατσάνο, ο οποίος συνέλαβε την ιδέα της συγκεκριμένης ερευνητικής μελέτης, αλλά και βοήθησε σημαντικά στο σχεδιασμό των πειραμάτων και ανάλυση των αποτελεσμάτων. Η βοήθειά του και οι συμβουλές του υπήρξαν καταλύτης στην ολοκλήρωση της διατριβής αυτής. Το ιατρικό και νοσηλευτικό προσωπικό του Κλινικού Εργαστηρίου Ακτινολογίας για την άψογη συνεργασία και την συμπαράσταση τα τελευταία χρόνια. Τέλος, θα ήθελα να ευχαριστήσω τους γονείς μου για όλη τους τη βοήθεια σε κάθε στιγμή της ζωής μου αλλά κυρίως τη σύζυγό μου για την υπομονή που έδειξε 17

18 και δείχνει όλα αυτά τα χρόνια, χωρίς τη στήριξη της οποίας τίποτα από αυτά δεν θα ήταν εφικτό. Παρόλο ότι τα αποτελέσματα και συμπεράσματα αυτής της μελέτης ανοίγουν νέους δρόμους στην αντιμετώπιση μίας πολύ σοβαρής κλινικής κατάστασης όπως είναι η νεφροτοξικότητα των ιωδιούχων σκιαγραφικών μέσων, θεωρώ ως το μεγαλύτερο κέρδος για μένα την ευκαιρία να συνεργαστώ αλλά και να καθοδηγηθώ από ανθρώπους και επιστήμονες που δεν υπήρξαν μόνο σύμβουλοι αλλά και δάσκαλοι δίνοντας μου όλα εκείνα τα εφόδια που χρειάζεται ο καθένας για να ασχοληθεί ενεργά με την επιστημονική έρευνα. 18

19 ΠΕΡΙΛΗΨΗ Εισαγωγή Τα ιωδιούχα σκιαγραφικά μέσα (ΣΜ) σήμερα χρησιμοποιούνται ευρέως τόσο για διαγνωστικούς λόγους όσο και κατά τη διάρκεια επεμβατικών πράξεων στην Επεμβατική Ακτινολογία ή/και την καρδιολογία. Δυστυχώς, η χρήση τους δεν στερείται επιπλοκών με την νεφροτοξικότητα (Νεφροτοξικότητα οφειλόμενη στα ΣΜ - ΝΣΜ) να είναι μία από τις πιο σοβαρές συνέπειες. Παρά το γεγονός ότι πολλές στρατηγικές με σκοπό τόσο την πρόληψη όσο και την θεραπεία έχουν προταθεί και δοκιμαστεί ευρέως τα τελευταία χρόνια στη μάχη κατά της ΝΣΜ, καμία δεν έχει καταφέρει να δείξει ισχυρά αξιόπιστα αποτελέσματα. Η Παρστατίνη είναι το αμινο τελικό 41-αμινοξέων πεπτίδιο που διασπάται και αποσπάται από τον υποδοχέα PAR1 όταν αυτός ενεργοποιείται από τη θρομβίνη. Οι χαμηλές δόσεις Παρστατίνης είναι γνωστό ότι εμφανίζουν προστατευτική δράση στο μυοκάρδιο αρουραίου μετά από βλάβη του τύπου της ισχαιμίας / επαναιμάτωσης. Η κύρια υπόθεση της μελέτης μας ήταν ότι η συγκεκριμένη ουσία μπορεί να ασκήσει προστατευτική δράση στους νεφρούς έναντι της ΝΣΜ. Για να ελεγχθεί αυτή η υπόθεση, χρησιμοποιήσαμε ένα πειραματικό μοντέλο ΝΣΜ σε θηλαστικά (Κόνικλους Νέας Ζηλανδίας). Υλικά και Μέθοδοι: Το πρώτο στάδιο της μελέτης αφορούσε στην ανάπτυξη ενός αξιόπιστου πειραματικού μοντέλου νεφροτοξικότητας μετά τη χορήγηση ιωδιούχων σκιαγραφικών μέσων. Το μοντέλο αναπτύχθηκε και αξιολογήθηκε εκτενώς σε μία σειρά από λευκούς κονίκλους Νέας Ζηλανδίας. Εν συνεχεία ακολούθησε η συστηματική δοκιμή της προστατευτικής δράσης της Παρστατίνης. Στο μέρος αυτό 19

20 τα πειραματόζωα χωρίστηκαν σε τρεις υπό-ομάδες. Μια υπό-ομάδα έλαβε την υπό δοκιμή ουσία (Παρστατίνη) σε δόση 10μg/kg ακριβώς 15 λεπτά πριν από την έναρξη της ενδοφλέβιας έγχυσης του ΙΣΜ αντίθεσης. Σε αυτή τη φάση όλα τα πειραματόζωα της ομάδας ελέγχου προήλθαν από τα προκαταρκτικά πειράματα τα οποία είχαν λάβει ίσο όγκο φυσιολογικού ορού (NaCl 0,9%). Στις λοιπές δύο υπό-ομάδες χορηγήθηκε Παρστατίνη σε δόση είτε υποδεκαπλάσια (1μg/kg) είτε δεκαπλάσια (100μg/kg) της αρχικής. Ως κατώφλι για την αναγνώριση ανάπτυξης ΝΣΜ τέθηκε η τιμή της κρεατινίνης του ορού ίση ή άνω του 1,5mg/dl 48 ώρες μετά την έγχυση του ΣΜ. Ένα αντιπροσωπευτικό δείγμα πειραματόζωων υποβλήθηκε σε ευθανασία 48 ώρες μετά τη λήψη του ΣΜ με σκοπό την ιστολογική εξέταση/ανάλυση. Αποτελέσματα: Το πρώτο μέρος της μελέτης συμπεριέλαβε συνολικά 32 πειραματόζωα. Σε 7 εξ αυτών πραγματοποιήθηκε μόνο πείραμα προσομοίωσης (ομάδα sham) έτσι ώστε να οριστούν οι τιμές βάσης. Η μέση τιμή της κρεατινίνης ορού σε αυτή την ομάδα ήταν 0,90 mg/dl (Cl:0,80-1,10). Τα υπόλοιπα πειράματα έδειξαν ότι η μεγαλύτερη αναπαραγωγιμότητα του μοντέλου επιτυγχάνεται με ρυθμό έγχυσης του σκιαγραφικού μέσου αντίθεσης μεταξύ 2,5 έως 3,0 ml/min. Έτσι το σύνολο της σκιαγραφικής ουσίας χορηγείτο μεταξύ λεπτών. Σε συνολικά 15 πειραματόζωα τα οποία αποτέλεσαν και την ομάδα ελέγχου και για τα λοιπά πειράματα (control group) η μέση τιμή της κρεατινίνης ορού ήταν 3,09 mg/dl (CI:2,40-4,00), ενώ το 86,7% αυτών ανέπτυξε κλινικά σημαντική ΝΣΜ. Όσον αφορά τα αποτελέσματα του δεύτερου μέρους αναγνωρίστηκε η θεραπευτική δράση της Παρστατίνης σε δόση ίση με 10μg/Kg. Ποίο συγκεκριμένα 20

21 στην ομάδα πειραματόζωων (n=18) που έλαβε την ανωτέρο δόση η μέση τιμή της κρεατινίνης 48 ώρες μετά τη χορήγηση του ΙΣM ήταν 1,01mg/dl (CI:0,93-2,34) (Στατιστικά σημαντική διαφορά συγκριτικά με την ομάδα ελέγχου, p=0,012). Το αποτέλεσμα αυτό εξαλείφεται με τον δεκαπλασιασμό και με τον υπό-δεκαπλασιασμό της ανωτέρο δόσης. Στατιστικά σημαντικά μικρότερος ήταν και ο αριθμός των πειραματόζωων που ανέπτυξαν ΝΣΜ στην ομάδα της Παρστατίνης συγκριτικά με την ομάδα ελέγχου (27,8% έναντι 86,7%, p<0,001). Τα ιστολογικά αποτελέσματα έδειξαν σημαντικά μικρότερη σωληναριακή νέκρωση στην ομάδα των πειραματόζωων που έλαβαν θεραπεία με Παρστατίνη συγκριτικά με την ομάδα ελέγχου (13,13 Vs στην ομάδα ελέγχου, ρ = ). Συμπέρασμα: Η υπό δοκιμή ουσία Παρστατίνη (Parstatin) αναστέλλει επιτυχώς την ανάπτυξη νεφροτοξικότητας μετά την χορήγηση σκιαγραφικών μέσων σε ένα πειραματικό in-vivo μοντέλο. Το παραπάνω αποτέλεσμα αποδείχτηκε τόσο με εργαστηριακές μετρήσεις της κρεατινίνης ορού όσο και μετά από ιστολογική μελέτη νεφρών. Το παραπάνω αποτελεί ένα πολύ αισιόδοξο μήνυμα. Παρόλα αυτά περαιτέρω μελέτες είναι αναγκαίες για την επικύρωση του προστατευτικού αυτού ρόλου. 21

22 ABSTRACT Introduction Iodinated Contrast Media (CM) are today widely used in routine non-invasive or percutaneous invasive imaging examinations and therapeutic interventions. Unfortunately, use of CM is not free of complications with nephrotoxicity (Contrast- Induced nephropathy CIN) being one of the most severe. Although numerous preventing and/or therapeutic strategies have been proposed and widely tested during recent years in the battle against CIN, none of them manage to show strong reliable evidence that can prevent CIN development. Parstatin is the N-terminal-41-amino-acid peptide cleaved by thrombin from the protease-activated receptor-1. Low doses of Parstatin are known to have a protective effect in the rat myocardium after ischemia/reperfusion injury. The primary hypothesis of our study was that Parstatin may exert a nephroprotective role against the development of CIN. To test this hypothesis we used a mammalian experimental CIN model. Materials and Methods: The first stage of the study involved the development of a reliable experimental model of nephrotoxicity after administration of iodinated contrast media. The model was developed and extensively evaluated in a series of New Zealand white rabbits. The next stage involved the systematic testing of the protective effect of Parstatin. In this part the animals were divided into three sub-groups. A sub-group received the test substance (Parstatin) at a dose of 10mg/kg just 15 minutes before intravenous infusion of iodinated contrast medium. In the other two sub-groups Parstatin was administered at a dose of either subdivided by ten times (1mg/kg) or multiplied by 22

23 ten times (100mg/kg) of the original. In this phase the control group was derived from the preliminary experiments of the first stage. As a threshold for the recognition of CIN development was the value of serum Creatinine equal to or more than 1,5 mg/dl 48 hours after injection of the CM. A representative sample of experimental animals was euthanized 48 hours after receiving the CM in order to perform histological examination and analysis. Results: The first part of the study included a total of 32 animals. In 7 of them only a simulation experiment was performed (group sham) to define baseline values of scr. The mean serum Creatinine in this group was 0,90mg/dl (Cl:0,80-1,10). Following experiments showed that greater reproducibility of the model is achieved with injection rate of the contrast medium contrast between 2.5 έως 3,0 ml/min. Based on that the total contrast agent was administered between minutes. In a total of 15 rabbits which were and the control group for the following experiments (control group) the mean scr was 3,09 mg/dl (CI:2,40-4,00), while 86.7% of them developed clinically significant CIN. Regarding the results of the second part recognized that the maximum therapeutic effect of Parstatin is accomplished with a dose of 10mg/Kg. More specifically in the group of animals (Group P 10, n=18) who received the abovementioned dose the mean scr values 48 hours after administration of the CM was 1,01 mg/dl (CI:0,93-2,34) (Statistically significant difference compared with the control group, p=0,012). This therapeutic effect was eliminated when the dose was either multiplied or divided by 10. A significantly lower number of animals developed 23

24 the CIN in the treatment group (Group P 10 ) compared with the control group (27.8% vs. 86.7%, p<0.001). The histological results showed significantly less tubular necrosis in the group of animals treated with Parstatin compared to controls (13,13 Vs in the control group, p = ). Conclusion: The test substance Parstatin successfully inhibits the development of contrast-induced nephrotoxicity in an in-vivo experimental model. The above result was verified both by laboratory measurements of serum Creatinine and after histological examination of kidney specimens. The above is a very optimistic message. Nevertheless, further studies are necessary to validate the protective role of Parstatin against contrast nephrotoxicity in both experimental and clinical settings. 24


26 26

27 ΕΙΣΑΓΩΓΗ Σκιαγραφικά μέσα αντίθεσης-ορισμός-κατηγορίες Η παραγωγή μίας ακτινολογικής εικόνας είναι αποτέλεσμα μεταφοράς πληροφοριών στοιχείων που αφορούν τόσο την ανατομία όσο και την λειτουργία του ανθρωπίνου σώματος με τη χρήση κυρίως των ακτινών Χ ή ακτινών Ρέντγκεν (Röntgen) και αποτύπωση αυτών των πληροφοριών στο ακτινολογικό φιλμ (Film) ή οθόνη (monitor). Η διαδικασία αυτή υπόκειται σε διάφορες επιδράσεις οι οποίες ουσιαστικά καθορίζουν και την τελική ποιότητα της παραγόμενης εικόνας, μία εκ των οποίων είναι η σκιαγραφική αντίθεση. Η σκιαγραφική αντίθεση ουσιαστικά αποτυπώνεται στην ακτινολογική εικόνα ως διαφορά πυκνοτήτων [1, 2]. Η σκιαγραφική αντίθεση σχετίζεται με τον συντελεστή απορρόφησης των ακτινών-χ που εμφανίζουν οι διάφορες ανατομικές περιοχές. Είναι γνωστό ότι η απορρόφηση των ακτινών Χ από τους μαλακούς ιστούς είναι περίπου ίδια ανεξάρτητα αν πρόκειται για παρεγχυματικό όργανο, αγγεία, μυς κύστεις κ.α., λόγω του παρόμοιου συντελεστή απορρόφησης. Η καλύτερη ανάδειξη στις ακτινολογικές εξετάσεις μαλακών ιστών πραγματοποιείται μόνο εφόσον επέλθει τροποποίηση του συντελεστή απορρόφησης και κατά συνέπεια και της σκιαγραφικής αντίθεσης. Η τροποποίηση αυτή μπορεί να είναι αποτέλεσμα μίας παθολογικής διαδικασίας (π.χ. ανάπτυξη επασβεστωμένων πλακών στο τοίχωμα αγγείων) ή να προκληθεί τεχνικά με την χρήση ουσιών με διαφορετικό συντελεστή απορρόφησης έτσι ώστε να αναδειχθούν καλύτερα δομές με παρόμοιους συντελεστές απορρόφησης [1-3]. Με σκοπό την επίτευξη του παραπάνω στόχου, στην Ακτινοδιαγνωστική σήμερα χρησιμοποιούνται ευρέως ουσίες με ιδιότητα να τροποποιούν τη 27

28 σκιαγραφική αντίθεση, οι οποίες ονομάζονται σκιαγραφικά μέσα αντίθεσης (contrast medium or contrast agent-σμ). Τα ΣΜ είναι συνεπώς ουσίες που προκαλούν τεχνητή αύξηση της αντίθεσης. Διοχετεύονται με κατάλληλο τρόπο (πχ. ενδοφλέβια έγχυση, κατάποση κλπ.) σε όργανα τα οποία με τις συνήθεις τεχνικές δεν διαφοροποιούνται επαρκώς από τις γειτονικές τους δομές και ταξινομούνται σε δύο μεγάλες κατηγορίες: Τα θετικά ή ακτινοσκιερά ΣΜ (ουσίες υψηλού ατομικού αριθμού) και τα αρνητικά ή ακτινοδιαυγαστικά ΣΜ (ουσίες χαμηλής πυκνότητας) [1-3]. Τα θετικά ΣΜ, πχ. Βάριο (Ζ=56), Ιώδιο (Ζ=53), εμφανίζουν συντελεστές απορρόφησης υψηλότερους από τα μαλακά μόρια και δημιουργούν σκιαγραφική αντίθεση μέσω του φωτοηλεκτρικού φαινομένου. Συγκεκριμένα, απορροφώντας τα φωτόνια τα εμποδίζουν να φθάσουν στον ανιχνευτή εικόνας, με συνέπεια να παράγουν «σκίαση». Τα αρνητικά ΣΜ, πχ. αέρας δωματίου, οξυγόνο, διοξείδιο του άνθρακα, εμφανίζουν συντελεστές απορρόφησης χαμηλότερους από τα μαλακά μόρια προκαλώντας «διαύγαση» στην περιοχή που συγκεντρώνονται. Και στις δύο περιπτώσεις το σκιαγραφικό θα προκαλέσει αύξηση της σκιαγραφικής αντίθεσης [1]. Τα θετικά ΣΜ με βάση το Ιώδιο (Ζ=53), ιωδιούχα ΣΜ, είναι τα πλέον χρησιμοποιούμενα ΣΜ σήμερα με πολυάριθμες εφαρμογές. Αποτελούν ένα από τα πιο συχνά συνταγογραφούμενα φαρμακευτικά σκευάσματα παγκοσμίως [4]. Υπολογίζεται ότι το 2003 χορηγήθηκαν περίπου 80 εκατομμύρια δόσεις, ποσότητα που αντιστοιχεί σε σχεδόν λίτρα [4]. Η κύρια ένδειξη τους είναι, όπως προαναφέρθηκε, η δημιουργία σκιαγραφικής αντίθεσης με σκοπό την καλύτερη διαφοροποίηση γειτονικών δομών με παρόμοιους συντελεστές απορρόφησης και κυρίως η αναγνώριση παθολογικών διεργασιών [5]. Μερικές από τις εφαρμογές των διάφορων διαλυμάτων ιωδίου που χρησιμοποιούνται σήμερα είναι η ενδοφλέβια ή παλίνδρομη σκιαγράφηση του 28

29 ουροποιητικού συστήματος (ανιούσα κυστεογραφία ή πυελογραφία), η σκιαγράφηση των χοληφόρων οδών, η σκιαγράφηση διαφόρων κοιλοτήτων και σηραγγωδών πόρων, των αγγείων (π.χ. αγγειογραφία) και του λεμφικού συστήματος (π.χ. λεμφαγγειογραφία). Χρησιμοποιούνται επίσης για τη σκιαγράφηση του γαστρεντερικού σωλήνα αντί του εναιωρήματος θειικού βαρίου, αν και δεν παρέχουν εξίσου καλή σκιαγράφηση, σε υπόνοια διάτρησης ή απόφραξης του γαστρεντερικού σωλήνα ή αμέσως μετά από χειρουργική επέμβαση για τον έλεγχο της ακεραιότητας της χειρουργικής αναστόμωσης. Ιδιαίτερα σήμερα με την εφαρμογή της Αξονικής Τομογραφίας (CT) για τον έλεγχο της αγγείωσης μιας παθολογικής εξεργασίας σε διάφορα όργανα, όπως στον εγκέφαλο, στα συμπαγή όργανα της κοιλίας, στο μεσοθωράκιο, στο τράχηλο κ.α., γίνεται ευρεία χρήση των ιωδιούχων σκιαγραφικών. Τέλος, χρησιμοποιούνται για την απεικόνιση των αγγείων με την Aξονική Αγγειογραφία. 29

30 Ιωδιούχα σκιαγραφικά μέσα αντίθεσης-ορισμός-τύποι Tα ιωδιούχα ΣΜ (ΙΣΜ), όπως έχει ήδη αναφερθεί είναι θετικά σκιαγραφικά τα οποία εμφανίζουν συντελεστές απορρόφησης υψηλότερους από τα μαλακά μόρια και δημιουργούν σκιαγραφική αντίθεση μέσω του φωτοηλεκτρικού φαινομένου. Αποτελούν σημαντικό μέρος της σύγχρονης απεικόνισης έχοντας διευρύνει τις εφαρμογές της ακτινοδιαγνωστικής παγκοσμίως. Αποτελούνται από διάφορα άλατα του ιωδίου, ενώ η δομή τους βασίζεται στο δακτύλιο του βενζολίου (κυκλική ένωση με 6 άτομα άνθρακα) [3]. Όλα τα χρησιμοποιούμενα σήμερα ΙΣΜ είναι βασικά χημικές τροποποιήσεις ενός 2,4,6-τρι-ιωδιωμένου δακτυλίου του βενζολίου [3]. Ταξινομούνται βάσει των φυσικών και χημικών χαρακτηριστικών τους, συμπεριλαμβανομένης της χημικής δομής, της ωσμωτικότητάς τους, το περιεχόμενο ιώδιο καθώς και τον τύπου ιονισμού τους όταν βρίσκονται σε κατάσταση διαλύματος. Έτσι, ανάλογα με τον αριθμό δακτυλίων βενζολίου ανά μόριο ΣΜ κατηγοριοποιούνται σε μονομερή ή διμερή, σε σχέση με την ωσμωτικότητα σε υψηλής και χαμηλής ωσμωτικότητας,ενώ τέλος ανάλογα με την ιονικότητά τους σε ιονικά και μη ιονικά. Η πιο ευρέως διαδεδομένη κατηγοριοποίηση στην κλινική καθ ημέρα πράξη είναι αυτή βάση της ωσμωτικότητας. Η κατηγοριοποίηση των ΣΜ ανάλογα με την ωσμωτικότητα τους σε υψηλής και χαμηλής ωσμωτικότητας καθορίζεται από τη συγκέντρωση των μορίων σκιαγραφικής ουσίας στο διάλυμά τους. Η ωσμωτικότητα σχετίζεται με τον αριθμό των ωσμωτικά ενεργών σωματιδίων στο διαλύτη (σωματίδια ανά Kg διαλύτη). Διάλυμα με μικρό αριθμό σωματιδίων εμφανίζει χαμηλή ωσμωτικότητα, ενώ αντίθετα υψηλές συγκεντρώσεις σωματιδίων καθορίζουν τα διαλύματα με υψηλή ωσμωτικότητα. Η ωσμωτικότητα είναι σημαντική διότι σχετίζεται με τη μετακίνηση ύδατος μέσα από μεμβράνες, συνεπώς σκιαγραφικά με χαμηλή ωσμωτικότητα είναι 30

31 γενικά καλύτερα ανεκτά από τον οργανισμό στον οποίο χορηγούνται και αυτό διότι η ωσμωτικότητα τους πλησιάζει αυτή του πλάσματος. Σχετικά με τη δομή τους, τρία από τα συνολικά έξι υδρογόνα του μορίου αντικαθίστανται από άτομα ιωδίου ενώ δύο από μη διασπώμενα σύμπλοκα (ρίζες). Στη θέση του εναπομείναντος υδρογόνου στα ιονικά ΣΜ υπάρχει μία καρβοξυλική ρίζα (COO-1, σθένος= -1), ενώ το κατιόν (σθένος=+1) είναι συνήθως είτε νάτριο είτε μεγλουμίνη. Στα μη ιονικά ΣΜ και τα χαμηλής ωσμωτικότητας διμερή ΣΜ στη θέση αυτή τοποθετούνται οργανικά μη διασπώμενα σύμπλοκα (αμίδια=) τα οποία προέρχονται από την αμμωνία ΝΗ3 με αντικατάσταση μέρους των Η + από άνθρακα και οξυγόνο, με απλούστερη μορφή το αμίδιο με υποκατάσταση ενός μόνο υδρογόνου της αμμωνίας -CONH2), Εικόνα 1. Μια άλλη ταξινόμηση των ΣΜ γίνεται ανάλογα με την ιονικότητα που εμφανίζουν. Είναι γνωστό ότι όταν βρίσκονται διαλυμένα στο νερό τα ιονικά ΣΜ διαχωρίζονται σε ιόντα. Έτσι τα ιονικά ΣΜ παρουσιάζουν φορτίο, ενώ τα μη ιονικά ΣΜ όχι και είναι ηλεκτρικά ουδέτερα, όπως ακριβώς και τα μόρια νερού. Γενικά, προτιμώνται τα μη ιονικά ΣΜ λόγω του ότι η παρουσία ηλεκτρικού φορτίου είναι γνωστό ότι επηρεάζει τις φυσιολογικές διεργασίες του οργανισμού στον οποίο χορηγούνται με διάφορους μηχανισμούς. 31

32 Εικόνα 1.: Υποκατάσταση των Η + στα ιωδιούχα σκιαγραφικά μέσα. R=ρίζα που αντιστοιχεί σε ομάδα ατόμων με ελεύθερη θέση δέσμευσης Βάση των ανωτέρω, σήμερα, αναγνωρίζονται τέσσερις βασικές ομάδες ΙΣΜ: α) ιονικά μονομερή υψηλής ωσμωτικότητας, β) ιονικά διμερή χαμηλής ωσμωτικότητας, γ) μη-ιονικά μονομερή χαμηλής ωσμωτικότητας και δ) μη-ιονικά ισοωσμωτικά διμερή [6]. Όλα τα ΙΣΜ έχουν παρόμοια φαρμακοκινητική. Εμφανίζουν χαμηλή λιποφιλία καθώς και χαμηλή δραστικότητα με τα υγρά του σώματος και σχετικά μικρό μοριακό βάρος. Ο χρόνο ημιζωής σε ασθενείς με φυσιολογική νεφρική λειτουργία είναι περίπου δύο ώρες. Τα σκιαγραφικά μέσα είναι ουσίες που συγκεντρώνονται κυρίως στον εξωκυττάριο χώρο μετά την χορήγηση τους. Ανάλογα με τα προηγούμενα περιγραφέντα (δηλ., τη χημική δομή, την ωσμωτικότητα, το περιεχόμενο ιώδιο και τον τύπου ιονισμού τους σε διάλυμα) τα σκιαγραφικά μέσα μπορούν να διαχωριστούν βασικά σε τρείς γενεές οι οποίες αναλύονται παρακάτω. 32

33 Γενεές Ιωδιούχων Σκιαγραφικών Μέσων 1 η γενεά (ιονικά μονομερή - υψηλής ωσμωτικότητας) Αποτελούνται από ιονικές μονομερείς ενώσεις οι οποίες περιέχουν μια καρβοξυλική ρίζα συνδεδεμένη στον πρώτο άνθρακα του βενζολικού δακτυλίου. Είναι μόρια τα οποία εμφανίζουν υψηλή ωσμωτικότητα. Συγκεκριμένα, σε κάθε τρία άτομα ιωδίου αντιστοιχούν δύο σωματίδια (δηλαδή, μια αναλογία 3:2). Η ωσμωτικότητά τους είναι μεταξύ mosm/kg ενώ για λόγους σύγκρισης η ωσμωτικότητα του πλάσματος είναι 290 mosm/kg. Αντιπροσωπευτικά εμπορικά σκευάσματα αποτελούν τα εξής: - Renografin (diatrizoate anion; Bracco Diagnostics Inc, Princeton, NJ ), - Hypaque (diatrizoate anion; GE Healthcare, Inc, Princeton, NJ) και το - Conray (iothalamate anion; tyco Healthcare and Mallinckrodt Inc, St. Louis, Mo). 2 η γενεά [μη ιονικά μονομερή (α) και ιονικά διμερή (β)- χαμηλής ωσμωτικότητας] Στα μη-ιονικά μονομερή (α), το τρι-ιωδιωμένο δακτύλιο του βενζολίου γίνεται διαλυτό στο νερό με την προσθήκη υδρόφιλων ομάδων υδροξυλίου. Λόγω απουσίας μιας καρβοξυλομάδας τα μη-ιονικά μονομερή δεν ιονίζονται όταν βρεθούν σε διάλυμα. Έτσι, για κάθε 3 άτομο ιωδίου, μόνο 1 σωματίδιο είναι παρόν στο διάλυμα (δηλαδή, μια αναλογία 3:1). Συνεπώς, σε μια δεδομένη συγκέντρωση ιωδίου, μηιονικά μονομερή έχουν περίπου το μισό της ωσμωτικότητας των ιοντικών μονομερών 33

34 σε διάλυμα. Η περιεκτικότητα τους λοιπόν σε ιώδιο φθάνει τα mgι/ml και η ωσμωτικότητα τους, στις συνήθως χρησιμοποιούμενες συγκεντρώσεις (25-76%) τα mosm/kg. Τα μη-ιονικά μονομερή υποταξινομούνται σύμφωνα με τον αριθμό των mg ιωδίου σε 1 ml διαλύματος (π.χ., 240, 300, ή 370 mg Ι/ml). Αξίζει να σημειωθεί ότι οι μεγαλύτερες πλευρικές αλυσίδες που φέρουν αυξάνουν το ιξώδες τους σε σύγκριση με τα ιονικά μονομερή καθιστώντας δυσκολότερη την έγχυσή τους. Αντιπροσωπευτικά εμπορικά σκευάσματα αποτελούν τα εξής: - Omnipaque (GE Healthcare, Inc) - Ιopamidol (Isovue; Bracco Diagnostics Inc), - Ioversol (Optiray; tyco Healthcare and Mallinckrodt Inc), και η - Iopromide (Ultravist; Bayer HealthCare Pharmaceuticals Inc, Wayne, NJ). Όσον αφορά τα ιονικά διμερή (β) σχηματίζονται μετά από σύνδεση 2 ιονικών μονομερών ΣΜ εξαλείφοντας κατά αυτόν τον τρόπο μία καρβοξυλομάδα. Έχουν ελαφρώς χαμηλότερη ωσμωτικότητα. Διίστανται στο νερό αντιστοιχώντας 6 άτομα ιωδίου για κάθε 2 σωματίδια στο διάλυμα (δηλαδή αναλογία 6:2). Το μόνο εμπορικά διαθέσιμο σκεύασμα αυτής της κατηγορίας είναι το ioxaglate (Hexabrix; tyco Healthcare and Mallinckrodt Inc), το οποίο σε μία συγκέντρωση 59%, ή 320 mg I/mL, έχει ωσμωτικότητα 600 mosm/kg. Εξαιτίας του υψηλού ιξώδους του, δεν παρασκευάζεται σε υψηλότερες συγκεντρώσεις. 3 η γενεά (ισο-ωσμωτικά διμερή ή μη ιονικά διμερή) Αποτελούνται από δύο μόρια ΣΜ συνδεδεμένα μέσω πλαγίας αλύσου και τα οποία εμφανίζουν υψηλότερο ιξώδες από τα ΣΜ της 2ης γενεάς. Τα μη ιονικά διμερή 34

35 ΣΜ σχηματίζονται από την ένωση 2 μη ιονικών μονομερών. Αυτές οι ουσίες περιέχουν 6 άτομα ιωδίου για κάθε σωματίδιο στο διάλυμα (δηλαδή, μια αναλογία 6:1). Συνεπώς για μια δεδομένη συγκέντρωση ιωδίου, τα μη-ιονικά διμερή έχουν τη χαμηλότερη ωσμωτικότητα μεταξύ όλων των ΣΜ που περιγράφηκαν έως τώρα. Ετσι, σε συγκέντρωση περίπου 60%, κατά βάρος, οι παράγοντες αυτοί είναι ισοωσμωτικοί με το πλάσμα. Επίσης, έχουν εξαιρετικά αυξημένο ιξώδες με αποτέλεσμα να έχουν περιορισμένη κλινική χρησιμότητα. Παραδείγματα μη ιονικών διμερών είναι τα εξής: - Iotrol και το - iodixanol (Visipaque; Amersham Health Inc, Princeton, NJ). Στην κάθ ημέρα κλινική πράξη, το υψηλό ιξώδες και το μεγάλο μόριο προκαλούν μειωμένη ταχύτητα ροής στα μικρά αγγεία. Το ιξώδες δύναται να μειωθεί με θέρμανση προ της χορήγησης. [6]. Οι χημικές συστάσεις των παραπάνω τύπων απεικονίζονται στην Εικόνα 2 35

36 Εικόνα 2.: Κατηγοριοποίηση των σκιαγραφικών μέσων: a, ιονικό μονομερές υψηλής ωσμωτικότητας, b, ιονικό διμερές χαμηλής ωσμωτικότητας, c, μη-ιονικό μονομερές χαμηλής ωσμωτικότητας και d, μη-ιονικό ισο-ωσμωτικό διμερές [6]. 36

37 Παρενέργειες / ανεπιθύμητες αντιδράσεις από τη χορήγηση ιωδιούχων σκιαγραφικών μέσων Οι ανεπιθύμητες αντιδράσεις συνέπεια ενδαγγειακής χορήγησης των ΣΜ χωρίζονται γενικά σε ιδιοσυγκρασιακές και χημειοτοξικές αντιδράσεις [6-8]. Οι ιδιοσυγκρασιακές τύπου αντιδράσεις, στις οποίες συμπεριλαμβάνονται αυτές του τύπου της αναφυλαξίας καθώς και οι αναφυλακτοειδείς, είναι αντιδράσεις υπερευαισθησίας. Εμφανίζονται απρόβλεπτα και η εμφάνισή τους είναι ανεξάρτητη τόσο της δόσης όσο και της χορηγούμενης συγκέντρωσης του σκευάσματος. Οι χημειοτοξικού τύπου αντιδράσεις αντιθέτως, σχετίζονται άμεσα με τη συνολική δόση, την τοξικότητα καθώς και τα επιμέρους φυσιολογικά χαρακτηριστικά (π.χ. ωσμωτικότητα, υδατοδιαλυτότητα, ιξώδες, περιεκτικότητα σε νάτριο κ.α.) του κάθε σκευάσματος. Τέλος, ορισμένες αντιδράσεις εμφανιζόμενες μετά τη χορήγηση ΣΜ (πχ. κάρδιο-αναπνευστική ανακοπή) δεν δύναται να καταταχθούν σαφώς σε μια από τις δύο ανωτέρω ομάδες [6, 8]. Σήμερα οι παρενέργειες των ιωδιούχων ΣΜ χωρίζονται γενικά σε τρεις κατηγορίες. Σύμφωνα λοιπόν και με την επιτροπή ασφαλείας σκιαγραφικών μέσων της Ευρωπαϊκής Εταιρείας Ουροποιογεννητικής Ακτινολογίας (ESUR) αυτές ταξινομούνται σε μη νεφρικές, νεφρικές και διάφορες άλλες [8, 9]. Παρακάτω θα γίνει πολύ σύντομη αναφορά των μη νεφρικών και διαφόρων άλλων παρενεργειών, ενώ οι νεφρικές και πιο συγκεκριμένα η νεφροτοξικότητα που σχετίζεται με την χορήγηση ΣΜ θα αναλυθούν εκτενέστερα. 37

38 Μη νεφρικές και διάφορες άλλες ανεπιθύμητες αντιδράσεις από τη χορήγηση ιωδιούχων σκιαγραφικών μέσων Οι μη νεφρικές ανεπιθύμητες αντιδράσεις από τη χορήγηση ΙΣΜ διακρίνονται σε άμεσες, όψιμες και πολύ όψιμες. Με τη σειρά τους οι άμεσες ταξινομούνται σε ήπιες, μετρίως σοβαρές και πολύ σοβαρές Πίνακας 1. Πίνακας 1. Ταξινόμηση των άμεσων ανεπιθύμητων αντιδράσεων στα ΣΜ Κατηγορία Τύπος αντίδρασης Ποσοστό εμφάνισης* Ήπιες Ναυτία, ήπιοι έμετοι, κνίδωση, κνησμός 5-15% Μετρίως σοβαρές Έντονοι έμετοι, κνίδωση με παρουσία στιγμάτων, βρογχόσπασμος, οίδημα του 1-2% προσώπου, οίδημα του λάρυγγα, κρίση του παρασυμπαθητικού Πολύ σοβαρές Εμφάνιση κρίσης υπότασης, καρδιακή ανακοπή, αναπνευστική ανακοπή, σπασμοί % Πίνακας 1: Ταξινόμηση ανεπιθύμητων αντιδράσεων στη χορήγηση ΣΜ * Αφορά το ποσοστό εμφάνισης μετά τη χορήγηση ΣΜ υψηλής ωσμωτικότητας. Τα αντίστοιχα ποσοστά μετά τη χορήγηση ΣΜ χαμηλής ωσμωτικότητας είναι έως πέντε φορές λιγότερο συχνά [6, 10]. 38

39 Οι παράγοντες κινδύνου που σχετίζονται με την εμφάνιση των άμεσων παρενεργειών έχουν να κάνουν είτε με τον ίδιο τον ασθενή (ιστορικό προηγούμενης μέτριας ή σοβαρής άμεσης αντίδρασης π.χ. άσθμα, αλλεργία χρήζουσα θεραπευτικής αγωγής κ.α.) είτε με το τύπο του χορηγούμενου σκιαγραφικού μέσου (π.χ. ΣΜ υψηλής ωσμωτικότητας) [8, 9]. Ως όψιμες παρενέργειες ορίζονται εκείνες που παρουσιάζονται σε χρονικό διάστημα από μία ώρα έως μία εβδομάδα μετά τη χορήγηση του ΣΜ [8, 9]. Η δε συχνότητα εμφάνισής τους υπολογίζεται σήμερα υψηλότερη από ότι εκτιμούταν στο παρελθόν [11]. Έχει καταγραφεί μια σειρά όψιμων συμπτωμάτων ως επακόλουθα στη χορήγηση ΣΜ, πολλά από τα οποία δε θεωρείται ότι σχετίζονται άμεσα με το ΣΜ αυτό καθ αυτό. Αυτά περιλαμβάνουν γενικά συμπτώματα όπως π.χ. ναυτία, εμέτους, κεφαλαλγία, μυο-σκελετικούς πόνους και πυρετό. Έχουν παρατηρηθεί επίσης και μια σειρά ήπιες και αυτοπεριοριζόμενες δερματικές παρενέργειες παρόμοιες με αυτές που προκαλούνται από άλλα φάρμακα. Όσον αφορά τους παράγοντες κινδύνου για την εμφάνιση των όψιμων παρενεργειών και πιο συγκεκριμένα αυτών που αφορούν στις δερματικές εκδηλώσεις, αυτοί περιλαμβάνουν το ιστορικό προηγούμενης αντίδρασης σε ΣΜ καθώς και όσους ασθενείς λαμβάνουν αγωγή με ιντερλευκίνη 2 [8, 9]. Η παθοφυσιολογία γύρω από αυτού του τύπου της αντιδράσεις παραμένει άγνωστη [6, 8]. Οι πολύ όψιμες παρενέργειες αφορούν αυτές που εμφανίζονται σε χρόνο περισσότερο από μια εβδομάδα μετά την χορήγηση του ΣΜ. Όσον αφορά τα ΙΣM αυτή η παρενέργεια είναι η θυρεοτοξίκωση και εμφανίζεται σε ασθενείς με νόσο του Grave που δεν λαμβάνουν κάποια θεραπεία, καθώς και σε ασθενείς με πολυοζώδη βρογχοκήλη. Οι συνέπειες δε είναι ιδιαίτερα εμφανής σε υπερήλικα άτομα και κυρίως σε πληθυσμούς περιοχών με διατροφική ένδεια ιωδίου [3, 8, 9]. 39

40 Τέλος, στις μη νεφρικές παρενέργειες περιλαμβάνεται και μία σειρά από διάφορες άλλες αντιδράσεις όπως η εξαγγείωση του ΣΜ, οι διάφορες επιδράσεις των ΣΜ στους πνεύμονες (π.χ. πνευμονικό οίδημα, βρογχόσπασμος, αυξημένη αρτηριακή αντίσταση), επιδράσεις των ΣΜ στο αίμα και στο ενδοθήλιο (π.χ. πρόκληση θρόμβωσης), ενώ προσοχή θα πρέπει να δίνεται σε περιπτώσεις ασθενών με παρουσία όγκων που παράγουν κατεχολαμίνες (π.χ. φαιοχρωμοκύττωμα, παραγαγγλίωμα), στις εγκύους καθώς και στις θηλάζουσες μητέρες. Γενικά συνιστάται η μη συγχορήγηση και η μη ανάμιξη του ΣΜ με άλλα φάρμακα σε καθετήρες και σωλήνες. 40

41 Νεφρικές ανεπιθύμητες αντιδράσεις από τη χορήγηση ιωδιούχων σκιαγραφικών μέσων Tο πρώτο επεισόδιο οξείας νεφρικής βλάβης (νεφροπάθειας) ως αποτέλεσμα χορήγησης ΙΣΜ (Νεφροτοξικότητα προκαλούμενη από χορήγηση Σκιαγραφικών Μέσων - ΝΣΜ) αναφέρθηκε από τον Bartels και τους συνεργάτες του πριν περίπου μισό αιώνα [12]. Από τότε, έχουν υπάρξει στην διεθνή βιβλιογραφία αναφορές αρκετών χιλιάδων περιστατικών, ο ρυθμός των οποίων αυξήθηκε σημαντικά στα μέσα της δεκαετίας του εβδομήντα ως αποτέλεσμα της μεγάλης αύξησης των απεικονιστικών εξετάσεων που απαιτούσαν την ενδοφλέβια χορήγηση τέτοιων σκευασμάτων [13]. Η μεγαλύτερη αύξηση παρατηρήθηκε με την ανακάλυψη και την έναρξη της κλινικής εφαρμογής της απεικόνισης με τη χρήση CT. Με την συνεχώς αυξανόμενη λοιπόν χρήση των ΙΣΜ τόσο για τη διενέργεια διαγνωστικών όσο και επεμβατικών ακτινολογικών αλλά και καρδιολογικών εξετάσεων τα τελευταία 30 χρόνια, η ΝΣΜ αποτελεί σήμερα την τρίτη σε σειρά αιτία πρόκλησης νοσοκομειακής οξείας νεφρικής ανεπάρκειας με το ποσοστό της να υπολογίζεται σε 11% [14, 15]. Η νεφροτοξικότητα των ΙΣΜ μεταφράζεται σε οξεία νεφρική βλάβη, η οποία εκδηλώνεται ως οξεία νεφρική ανεπάρκεια. Ως νεφροτοξικότητα που προκαλείται από τη χορήγηση ΙΣΜ ορίζεται λοιπόν η οξεία επιδείνωση της νεφρικής λειτουργίας, εκφραζόμενη ως αύξηση της κρεατινίνης ορού άνω του 25% ή 44,2 μmol/dl (0,5mg/dl) σε σχέση με την προ χορήγησης τιμή, και η οποία εμφανίζεται σε διάστημα έως και 3 ημέρες μετά από την ενδαγγειακή χορήγηση ΣΜ, απουσία άλλης εμφανής αιτιολογίας επιδείνωσης της νεφρικής 41

42 λειτουργίας [8, 9, 16]. Αν και βιβλιογραφικά υπάρχει διχογνωμία όσον αφορά τα κριτήρια για τη διάγνωση της ΝΣΜ, αυτό που συχνότερα χρησιμοποιείται σήμερα ως κριτήριο είναι η αύξηση της απόλυτης τιμής της κρεατινίνης κατά 0,5mg/dl συγκριτικά με την τιμή προ της χορηγήσεως [3]. Η επίπτωση της ΝΣΜ στο γενικό πληθυσμό υπολογίζεται μεταξύ 0,6% και 2,3% [16, 17], ενώ το ανωτέρω ποσοστό φαίνεται να είναι σαφώς υψηλότερο σε κάποιες ειδικές υποκατηγορίες ασθενών συμπεριλαμβανομένων των ασθενών με προϋπάρχουσα νεφρική βλάβη, στους διαβητικούς, σε ασθενείς που λαμβάνουν νεφροτοξικά φάρμακα όπως διουρητικά, μη στεροειδή αντιφλεγμονώδη (π.χ. NSAIDs) και ορισμένα αντιδιαβητικά δισκία (π.χ. μετφορμίνη), σε ασθενείς με αναιμία και άλλα [16]. Σπανίως, η ΝΣΜ μπορεί να εμφανιστεί και στον παιδιατρικό πληθυσμό [3]. Οι παράγοντες κινδύνου για ανάπτυξη ΝΣΜ όπως αυτοί έχουν καθοριστεί από την επιτροπή ασφαλείας σκιαγραφικών μέσων της ESUR αναγράφονται στον Πίνακα 2 και διακρίνονται σε αυτούς που σχετίζονται με τον ασθενή και σε αυτούς που σχετίζονται με τον τύπο της χορήγησης και τον τύπο/είδος του χρησιμοποιούμενου ΣΜ. 42

43 Πίνακας 2. Παράγοντες κινδύνου για ανάπτυξη ΝΣΜ Σχετιζόμε να με Ασθενή egfr < 60ml/min/1.73m2 πριν από ενδαρτηριακή χορήγηση egfr < 45ml/min/1.73m2 πριν από ενδοφλέβια χορήγηση Ιδιαίτερα εάν σχετίζεται ή συνδυάζεται με: - Διαβητική νεφροπάθεια - Αφυδάτωση - Συμφορητική καρδιακή ανεπάρκεια - Πρόσφατο έμφραγμα του μυοκαρδίου - Περί-επεμβατική υπόταση - Παρουσία αορτικής αντλίας - Ουρική αρθρίτιδα - Χαμηλό αιματοκρίτη - Ηλικία >70 ετών - Ταυτόχρονη χρήση νεφροτοξικών φαρμάκων (π.χ. NSAIDs) Γνωστή ή υψηλή υποψία για οξεία νεφρική ανεπάρκεια Σχετιζόμε να με τύπο χορήγησης και ΣΜ Ενδαρτηριακή χορήγηση ΣΜ Υψηλή ωσμωτικότητα ΣΜ Μεγάλη δόση ΣΜ Πολλαπλές χορηγήσεις ΣΜ σε διάστημα λίγων ημερών Πίνακας 2: Παράγοντες κινδύνου για την ανάπτυξη οξείας νεφρικής βλάβης μετά από χορήγηση σκιαγραφικών μέσων. 43

44 Παθοφυσιολογία ΝΣΜ Οι ακριβής παθοφυσιολογικοί μηχανισμοί οι οποίοι εμπλέκονται στην πρόκληση-ανάπτυξη της ΝΣΜ δεν είναι σήμερα απόλυτα κατανοητοί. Είναι γενικά αποδεκτό ότι όχι ένας,αλλά συνδυασμός των διαφόρων προτεινόμενων παθοφυσιολογικών μηχανισμών συνεισφέρουν στην πρόκληση ΝΣΜ [3, 6, 8, 9, 18-22]. Αυξημένη αγγειοσυστολή σχετιζόμενη με την αδενοσίνη, την ενδοθηλίνη, και την παραγωγή ελεύθερων ριζών οξυγόνου έχει παρατηρηθεί. Επίσης έχει παρατηρηθεί μειωμένη αγγειοδιαστολή επαγόμενη από το νιτρικό οξείδιο και την προσταγλανδίνη. Οι μηχανισμοί αυτοί προκαλούν ισχαιμία στο βαθύτερο τμήμα του εξωτερικού νεφρικού μυελού, μια περιοχή με υψηλές απαιτήσεις σε οξυγόνο και απομακρυσμένο από το vasa recta τα οποία εφοδιάζουν τον νεφρικό μυελό με αίμα [21]. Επιπλέον, τα σκιαγραφικά μέσα σχετίζονται με την απευθείας πρόκληση άμεσων τοξικών επιδράσεων στα κύτταρα των νεφρικών σωληναρίων προκαλώντας τον σχηματισμό κενοτοπίων, μεταβολή στη μιτοχονδριακή λειτουργία, και απόπτωση [18, 21]. Η ατοπία δεν φαίνεται να παίζει σημαντικό ρόλο στην παθογένεση της ΝΣΜ [3, 21]. Θεωρητικά, η έγχυση των ΣΜ έχει ως συνέπεια την αύξηση του οσμωτικού φορτίου και το ιξώδους την πρόκληση υποξαιμίας του νεφρικού μυελού μέσω αγγειοσύσπασης και τέλος την παραγωγή ελεύθερων ριζών μέσω μετά-ισχαιμικού οξειδωτικού στρες [18, 19, 21, 22]. Μεταξύ αυτών των μηχανισμών, ίσως οι δύο πιο σημαντικοί να είναι πρώτον η μείωση της νεφρικής αιμάτωσης η οποία προκαλείται ως άμεσο αποτέλεσμα των μέσων αντίθεσης (ΣΜ) στο νεφρό [23], με αποτέλεσμα την πρόκληση αγγειοσυστολής [3, 23], και δεύτερον, η απευθείας τοξική επίδραση των ΣΜ στα 44

45 νεφρικά σωληνάρια παρόλο που η παθοφυσιολογική σημασία των άμεσων επιπτώσεων των ΣΜ στα κύτταρα των νεφρικών σωληναρίων αμφισβητείται [8, 9]. Έχουν προταθεί διάφορες θεωρίες οι οποίες εμπλέκουν τόσο ωσμωτικούς όσο και χημειοτακτικούς μηχανισμούς, ενώ ορισμένοι ερευνητές αναφέρουν ακόμα και χημειοτακτικούς μηχανισμούς ειδικούς με το είδος του ΣΜ που χρησιμοποιείται [3]. Τέλος, υπάρχουν δεδομένα τα οποία εμφανίζουν μια αναλογική δοσοεξαρτώμενη σχέση όσον αφορά την τοξικότητα μετά από καρδιολογικές ενδαρτηριακές εξετάσεις κάτι που δεν έχει αποδειχθεί στην μετά από ενδοφλέβια χορήγηση [3]. Μεταξύ των επικρατέστερων παθοφυσιολογικών μηχανισμών είναι η παραγωγή δραστικών μορφών οξυγόνου (Reactive Oxygen Species, ROS). Ο πιθανός αιτιοπαθολογικός ρόλος των ROS έχει συζητηθεί ευρέως. Όλες οι ROS, κυρίως όμως το υπεροξείδιο, έχουν ενοχοποιηθεί ως σημαντικοί παράγοντες στην πρόκληση ΝΣΜ. Είναι γνωστό ότι τα επίπεδα των ενδογενώς παραγόμενων ριζών οξυγόνου αυξάνεται σημαντικά κατά το οξειδωτικό στρες. Οι πιο κοινές ρίζες οξυγόνου που παράγονται κατά αυτές τις διεργασίες είναι αυτές του υπεροξειδίου (Ο 2 -), του υπεροξείδιο του υδρογόνου (H 2 O 2 ) και η ρίζα υδροξυλίου (ΟΗ-) [21, 24]. Εξ αυτών, το υπεροξείδιο (Ο 2 -) και η ρίζα υδροξυλίου είναι πιο δραστικές από το υπεροξείδιο του υδρογόνου (H 2 O 2 ). Το υπεροξείδιο (Ο 2 -) γρήγορα δεσμεύει και απορροφά το μονοξείδιο του αζώτου (NO) και ως εκ τούτου θα μπορούσε να αμβλύνει την δραστηριότητά / ενεργότητά του στην νεφρική μικροκυκλοφορία [21]. Δεδομένου ότι το μονοξείδιο του αζώτου (NO) αναστέλλει την κατανάλωση οξυγόνου, θα μπορούσαμε να υποθέσουμε ότι η μείωση (λόγω αυξημένης δέσμευσης) του NO στο διαβήτη αυξάνει την κατανάλωση οξυγόνου, με αποτέλεσμα να μειώνει την μερική πίεση του οξυγόνου [21]. Συνέπεια αυτού, παρουσιάζονται μεταβολές στην δομή και λειτουργία του ενδοθηλίου και του επιθηλίου [21, 24]. 45

46 Οι ROS μπορεί συνεπώς να παίζουν ένα ρόλο στις επιδράσεις/αποτελέσματα των διαφόρων αγγειοσυσταλτικών, τα οποία έχουν θεωρηθεί σημαντικά για την ανάπτυξη ΝΣΜ. Δεδομένου ότι δραστικές μορφές οξυγόνου είναι εξωκυττάρια μόρια σηματοδότησης, μπορούν να είναι σημαντικές στην διαμεσολάβηση των δράσεων των αγγειοσυσταλτικών μορίων, όπως για παράδειγμα της αγγειοτενσίνης II, της θρομβοξάνης Α2, της ενδοθηλίνης (ΕΤ-1), της αδενοσίνης, και της νορεπινεφρίνης. Οι ανεπιθύμητες δράσεις των ΣΜ στην νεφρική λειτουργία μπορεί να περιλαμβάνουν συνεπώς την παραγωγή ROS, για παράδειγμα, μέσω σχηματισμού αδενοσίνης [21]. Αυτή η θεωρία υποστηρίζεται σήμερα από πειραματικά δεδομένα όπου η παραγωγή ROS αναστέλλεται από την αλλοπουρινόλη (ουσία η οποία αναστέλλει την ξανθινοξειδάση, το ένζυμο που καταλύει την μετατροπή της υποξανθίνης σε ξανθίνη και τελικά σε ουρικό οξύ), ή ότι η ποσότητα των ROS μειώθηκε από το ένζυμο δισμουτάση του υπεροξειδίου. Σε αυτά τα μοντέλα, η εκ των ΣΜ μειώσεις στον ρυθμό σπειραματικής διήθησης εμφανίζονται εξασθενημένοι [21, 25]. Μεταγενέστερες μελέτες σε ανθρώπους ανέδειξαν περαιτέρω τον πιθανό ρόλο των ROS στην παθοφυσιολογία της ΝΣΜ [26]. Σε αυτά τα μοντέλα, οι επαγόμενες από τα ΣΜ μειώσεις του ρυθμού σπειραματικής διήθησης είναι εξασθενημένες [25]. Λαμβάνοντας υπόψη τις υπάρχουσες ενδείξεις για τον ρόλο των ROS στην ΝΣΜ, δεν αποτελεί έκπληξη το γεγονός ότι πολλές από τις μέχρι σήμερα κλινικές μελέτες έχουν στόχο την μείωση της εμφάνισης της ΝΣΜ χρησιμοποιώντας μεθόδους που στοχεύουν στην παγίδευση των ROS [3, 27-35]. Επιπλέον, το ότι οι ROS είναι όπως προαναφέρθηκε εξωκυττάρια μόρια σηματοδότησης, υποδηλώνει έναν επίσης σημαντικό ρόλο αυτών στην επίδραση και τον ρόλο της ενδοθηλίνης (ΕΤ)-1 [21]Η επίδραση της ενδοθηλίνης στο αγγειακό υπόστρωμα εξαρτάται σε σημαντικό βαθμό από την ενεργοποίηση διαφόρων 46

47 υποτύπων του υποδοχέα της. Δύο υποδοχείς έχουν εντοπιστεί: ο ΕΤ-Α υποδοχέας ο οποίος προκαλεί έντονη αγγειοσύσπαση, ενώ ο ΕΤ-Β υποδοχέας έχει ακριβώς το αντίθετο αποτέλεσμα. Το τελευταίο πιθανόν να σχετίζεται με ΕΤ-εξαρτώμενη απελευθέρωση μονοξειδίου του αζώτου (NO). Η αγγειοδραστική απόκριση στην ενδοθηλίνη πιστεύεται ότι ποικίλει σημαντικά ανάλογα με το αγγειακό υπόστρωμα. Μία πιθανή ευεργετική επίδραση της ενδοθηλίνης στην πρόληψη ΝΣΜ μπορεί να διαμεσολαβείτε μέσω δράσεων που σχετίζονται με την επίδραση στους ΕΤ-Β υποδοχείς όπως για παράδειγμα αγγειοχαλάρωση. Έτσι, ένας εκλεκτικός αποκλεισμός του υποδοχέα ΕΤ-Α θα μπορούσε θεωρητικά να αποδειχθεί ότι είναι αποτελεσματικός στην πρόληψη της ΝΣΜ [21]. Πράγματι, είναι γνωστή, από πειραματικά δεδομένα σε φυσιολογικούς αρουραίους, μια θετική επίδραση από τον επιλεκτικό αποκλεισμό του ΕΤ-Α υποδοχέα, στην εμφανιζόμενη υπό την επίδραση των ΣΜ υποξική απόκριση στην εξωτερική μυελώδη μοίρα του νεφρού [36]. Όταν και οι δύο υποδοχείς (ΕΤ-Α και ΕΤ- Β) μπλοκαριστούν σε ανθρώπους που έλαβαν ΣΜ, παρατηρείται αύξηση της συγκέντρωσης της κρεατινίνης σε βαθμό μεγαλύτερο από ό, τι σε ασθενείς στην ομάδα ελέγχου που χορηγήθηκε εικονικό φάρμακο (placebo group). Επίσης, η συχνότητα εμφάνισης ΝΣΜ αυξάνει σημαντικά σε όσους λαμβάνουν συνδυασμό αποκλειστών και των δύο υποδοχέων [37]. Ένας δεύτερος πιθανολογούμενος μηχανισμός πρόκλησης της ΝΣΜ είναι μέσω άμεσης κυτταροτοξικής επίδρασης των σκιαγραφικών μέσων στα κύτταρα των νεφρικών σωληνάριων. Από δεδομένα που έχουν αντληθεί από ex νίνο πειράματα σε κυτταρικές σειρές από το εγγύς σωληνάριο, έχει αναγνωριστεί μια διαταραχή της μιτοχονδριακής ενζυμικής δραστικότητας καθώς και του δυναμικού της μιτοχονδριακής μεμβράνης σχετιζόμενη με τα ΣΜ [21, 38]. Αξιοσημείωτο είναι το 47

48 γεγονός ότι χαμηλής ωσμωτικότητας μονομερικά ΣΜ προκαλούν λιγότερη ζημιά από ότι διμερικά ισο-ωσμωτικά [38]. Από δεδομένα που έχουν προκύψει από ένα άλλο μοντέλο κυτταρικής σειράς είναι γνωστό ότι στα πιο απομακρυσμένα τμήματα του νεφρού, τα ΣΜ μπορούν να προκαλέσουν απόπτωση [39]. Η απόπτωση μπορεί να προκληθεί μέσω δύο μηχανισμών: είτε από υποξική βλάβη [40], είτε από άμεση επίδραση επί των κυττάρων [39]. Το εν τω βάθει τμήμα της εξωτερικής μυελώδους μοίρας του νεφρού είναι η περιοχή εκείνη που παρουσιάζει αυξημένο κίνδυνο για υποξυγοναιμική βλάβη. Σε αυτό το τμήμα του νεφρού, τα άκρα της αγκύλης του Henle υπόκεινται σε υποξική βλάβη [41]. Με την προσθήκη ΣΜ στο υγρό διάχυσης (έγχυμα) του νεφρού, ο βαθμός υποξικής βλάβης στην περιοχή ενισχύεται, πιθανώς με την αύξηση της νεφρικής αγγειακής αντίστασης [42]. Αξιοσημείωτο είναι το γεγονός ότι το ισο-οσμωτικό ΣΜ «iotrolan» βρέθηκε να επιδρά στις επιμέρους τιμές της πίεσης οξυγόνου σε μεγαλύτερο βαθμό από ότι το χαμηλής ωσμωτικότητας ΣΜ «Iopromide» [43]. Εκτός των ανωτέρω, μία σειρά από άλλους μηχανισμούς έχουν επίσης προταθεί βιβλιογραφικά. Μέχρι σήμερα λίγη προσοχή έχει δοθεί για παράδειγμα σε έναν πολύ απλό μηχανισμό που φαίνεται παρόλα αυτά να είναι υψίστης σημασίας για την ανάπτυξη της ΝΣΜ [21]. Ο μηχανισμός αυτός σχετίζεται με τις ρεολυτικές ιδιότητες των ΣΜ. Όταν το ιξώδες των ισο-οσμωτικών διμερών ληφθεί υπόψη, είναι σαφές ότι τα ισο-οσμωτικά ΣΜ δεν είναι εκ των προτέρων και αναμφισβήτητα ανώτερα ή αν θέλετε καλύτερα ανεκτά από τα χαμηλής ωσμωτικότητας. Αναμφισβήτητα, τα ισο-οσμωτικά ΣΜ μπορεί να επηρεάσουν την αιματική νεφρική ροή στην μυελώδη μοίρα σε μεγαλύτερο βαθμό από ότι τα χαμηλής ωσμωτικότητας, κάτι που εξηγείται αν αναλογιστούμε την επίδραση του υψηλού τους ιξώδους. Αυτό 48

49 υποδεικνύεται από τα ιδιαίτερα μειωμένα επίπεδα μερικής πίεσης οξυγόνου που προκαλείται από τα ισο-ωσμωτικότητα ΣΜ [43]. Ακόμα μεγαλύτερη σημασία στις αλλαγές στο νεφρικό σωληνάριο μπορεί να έχει το επαυξημένο ιξώδες που προκαλείται από τα διμερή ισο-οσμωτικά ΣΜ. Υπό κανονικές συνθήκες, το υγρό στο σωληνάριο έχει χαμηλότερο ιξώδες από το πλάσμα, καθώς το υπερδιήθημα περιέχει πολύ λίγες πρωτεΐνες πλάσματος. Η χρήση των διμερών ισο-οσμωτικών ΣΜ αυξάνει το ιξώδες στο σωληνάριο με συνέπεια την αύξηση στην αντίσταση στη ροή στα νεφρικά σωληνάρια [44]. Κατά συνέπεια, η νεφρική διάμεση πίεση μπορεί να πάρει υψηλές τιμές έως 50 χιλιοστά της στήλης υδραργύρου (50 mmhg). Μια τέτοια πίεση θα μειώσει σε πολύ μεγάλο βαθμό τη ροή στη μυελώδη μοίρα του νεφρού καθώς και το ρυθμό σπειραματικής διήθησης. Συμπερασματικά, τα έως σήμερα δεδομένα όσον αφορά την κατανόηση του παθοφυσιολογικού μηχανισμού ανάπτυξης της ΝΣΜ συμπεριλαμβάνουν και τις ρεολογικές ιδιότητες των υγρών. Η αντίσταση εξαρτάται από το ιξώδες του ρευστού, και όχι την ωσμωτικότητα (νόμος του Poiseuille) [21]. Ίσως λοιπόν, πάρα πολύ προσοχή έχει δοθεί στην επίδραση της ωσμωτικότητας των διαφόρων ΣΜ, παραμελώντας τις όποιες πιθανές επιπτώσεις από τις άλλες φυσικοχημικές ιδιότητές τους [21]. Τέλος, εκτός των ανωτέρω δύο επικρατέστερων μηχανισμών (η μείωση της νεφρικής αιμάτωσης με αποτέλεσμα την πρόκληση αγγειοσυστολής και της απευθείας τοξική επίδραση των ΣΜ στα νεφρικά σωληνάρια) είναι σημαντικό να αναφερθεί ότι και άλλοι παράγοντες με ρόλο ή/και συνεισφορά στον παθοφυσιολογικό μηχανισμό πρόκλησης της ΝΣΜ έχουν προταθεί και σχετίζονται με την αφυδάτωση, την πιθανή ενδοσωληναριακή απόφραξη λόγω π.χ. καθίζησης 49

50 πρωτεϊνών, ενώ από μέρους της επιστημονικής κοινότητας συζητείται και η επίδραση ανοσολογικών παραγόντων [21]. Νοσηρότητα και Θνητότητα ΝΣΜ Η κλινική πορεία της ΝΣΜ εξαρτάται από μία σειρά από παράγοντες. Σε αυτούς συμπεριλαμβάνονται η αρχική τιμή της νεφρικής λειτουργίας εκφραζόμενη είτε με την κρεατινίνη ορού είτε με το egfr, καθώς και η συνύπαρξη διαφόρων παραγόντων κινδύνου, ο βαθμός ενυδάτωσης και άλλα. Η συνήθης πορεία/διάρκεια της ΝΣΜ περιλαμβάνει μια παροδική ασυμπτωματική αύξηση της κρεατινίνης ορού η οποία αρχίζει εντός των πρώτων 24 ωρών από τη χορήγηση του ΣΜ, κορυφώνεται σε διάστημα έως τεσσάρων ημερών απ αυτή, ενώ το σύνηθες και αναμενόμενο είναι η τιμή να επιστρέφει στα προ της χορηγήσεως επίπεδα σε διάστημα από 7 έως 10 ημέρες [3, 4, 9]. Λιγότερα συχνά οι ασθενείς μπορεί να αναπτύξουν μόνιμη νεφρική δυσλειτουργία με πρόκληση χρόνιας νεφρικής ανεπάρκειας και πιθανή συνέπεια την ένταξή τους σε κάποιο πρόγραμμα διάλυσης. Όταν αυτό συμβαίνει είναι αποτέλεσμα συνύπαρξης πολλαπλών παραγόντων κινδύνου και η κατάσταση αυτή συνδέται με δια βίου νοσηρότητα [3]. Σήμερα, αρκετές μελέτες έχουν δείξει ότι οι ασθενείς με παροδική εμφάνιση ΝΣΜ σχετίζονται με αυξημένα διαστήματα νοσηλείας, υψηλότερα ποσοστά θνησιμότητας, καθώς και υψηλότερη συχνότητα καρδιακών και νευρολογικών εκδηλώσεων συγκρινόμενοι με ασθενείς των οποίων η νεφρική λειτουργία παραμένει σταθερή [3]. Αυτές οι παρατηρήσεις έχουν οδηγήσει σε διστακτικότητα στη χρήση ΣΜ όταν ο κίνδυνος πρόκλησης ΝΣΜ θεωρείται υψηλός. Παρόλα αυτά, πολλές μελέτες σχετικά με την ΝΣΜ και των συνεπειών αυτής δεν περιλαμβάνουν ομάδα 50

51 ασθενών που να δρα ως ομάδα ελέγχου (control group) στην οποία θα εντάσσονταν ασθενείς που δεν έλαβαν ΣΜ και στους οποίους θα παρακολουθούνταν κατά παρόμοιο τρόπο η νεφρική τους λειτουργία [3]. Συνεπώς, θα μπορούσε να συμπεράνει κανείς ότι βιβλιογραφικά ίσως ένα μέρος της αναφερόμενης νοσηρότητας και της θνησιμότητας, που έως σήμερα έχει αποδοθεί προηγουμένως στην ΝΣΜ, θα μπορούσε να αποδοθεί σε άλλες αιτίες [3]. Πρόληψη ΝΣΜ Πριν από την χορήγηση ΣΜ και με σκοπό τη μείωση της επίπτωσης της ΝΣΜ, απαιτείται επαρκής εκτίμηση της κλινικής κατάστασης του ασθενούς με αναγνώριση των όποιων πιθανών επιβαρυντικών ή προδιαθεσικών παραγόντων για ανάπτυξη ΝΣΜ υφίστανται [3, 8, 9]. Προς αυτή την κατεύθυνση είναι εξαιρετικά σημαντική η καλή επικοινωνία μεταξύ των ακτινοδιαγνωστών και του παραπέμποντως κλινικού ιατρού [8, 9]. Η χρήση εναλλακτικών στρατηγικών απεικόνισης και μια εξατομικευμένη αξιολόγηση κινδύνου-οφέλους είναι θεμελιώδης για την μείωση των κινδύνων που εμφανίζονται συνεπεία της χορήγησης ΙΣΜ [8, 9]. Παρακάτω περιγράφεται μία σειρά από στρατηγικές που χρησιμοποιούνται σήμερα και έχουν ως σκοπό τη μείωση της επίπτωσης της ΝΣΜ, αλλά και τον περιορισμό των συνεπειών της. Αποφυγή χρήσης ΙΣΜ Στην περίπτωση ασθενών με αυξημένο κίνδυνο για ανάπτυξη ΝΣΜ όπως για παράδειγμα ασθενείς με προϋπάρχον κάποιου βαθμού οξείας νεφρικής βλάβης ή χρόνιας νεφρικής νόσου, προτείνεται η αποφυγή χρήσης ΣΜ, εάν αυτό είναι 51

52 δυνατόν, και η χρήση για παράδειγμα εναλλακτικών μεθόδων απεικόνισης. Έτσι, εάν η διαγνωστική πληροφορία μπορεί να ληφθεί χωρίς τη χρήση ΣΜ (π.χ. CT χωρίς έγχυση ΣΜ) ή με χρήση άλλων εναλλακτικών απεικονιστικών μεθόδων (π.χ., υπερήχων ή απεικόνιση με μαγνητικό συντονισμό (MRI) αυτό θα πρέπει να προτιμάται [3, 8, 9]. Για τις περιπτώσεις εκείνες όπου η χρήση ΣΜ κρίνεται απαραίτητη, ανεξάρτητα από τον κίνδυνο πρόκλησης ΝΣΜ, βάση μιας εξατομικευμένης αξιολόγησης κινδύνου-οφέλους, είναι λογικό να χρησιμοποιείται η χαμηλότερη δυνατή δόση του ΣΜ, ικανού όμως να μας δώσει τις απαραίτητες διαγνωστικές πληροφορίες. Αν και ισχυρά δεδομένα που να υποστηρίζουν μια δόσο-εξαρτώμενη νεφροτοξικότητα των ΣΜ μετά από ενδοφλέβια χορήγηση δεν υπάρχουν, φαίνεται να υπάρχει μία ευθέως ανάλογη της δόσης τοξικότητα μετά από χρήση στην στεφανιογραφία [3]. Ένας παράγοντας κινδύνου για την ανάπτυξη ΝΣΜ θεωρείται ότι είναι η χορήγηση πολλαπλών δόσεων ΣΜ σε σύντομο χρονικό διάστημα [3]. Τα χαμηλής ωσμωτικότητας ΣΜ έχουν ένα χρόνο ημι-ζωής περίπου δύο ωρών. Επομένως, σε ασθενείς με φυσιολογική νεφρική λειτουργία χρειάζεται χρόνος έως περίπου 20 ώρες για την αποβολή του συνόλου της χορηγούμενης δόσης του ΣΜ. Έτσι, έχει προταθεί η αποφυγή επαναχορήγησης ΣΜ σε διαστήματα μικρότερα των 24 ωρών με εξαίρεση βέβαια τις επείγουσες περιπτώσεις όπου η κλινική κατάσταση του ασθενούς απαιτεί κάτι τέτοιο [3]. Δυστυχώς, η παραπάνω σύσταση δεν βασίζεται σε ισχυρά ή επαρκή βιβλιογραφικά δεδομένα που να δικαιολογούν την πρακτική αυτή. 52

53 Επιλογή τύπου ΣΜ Μια μετα-ανάλυση η οποία συνέκρινε τη σχετική νεφροτοξικότητα των ΣΜ υψηλής ωσμωτικότητας (High Osmolarity Contrast medium - HOCM) με αυτή των χαμηλής ωσμωτικότητας (Low Osmolarity Contrast medium - LOCM) από τους Barrett και Carlisle κατέληξε στο συμπέρασμα ότι τα χαμηλής ωσμωτικότητας ΣΜ είναι λιγότερο νεφροτοξικά από τα υψηλής ωσμωτικότητας σε ασθενείς με υποκείμενη νεφρική ανεπάρκεια [45]. Αντίθετα δεν απεδείχθη σημαντική διαφορά σε ασθενείς με φυσιολογική νεφρική λειτουργία. Παρόμοια αποτελέσματα είχε και μια μεγάλη προοπτική μελέτη από τον Rudnick και τους συνεργάτες του[46]. Τα περισσότερα κέντρα σήμερα δεν χρησιμοποιούν πλέον ενδοαγγειακά τα υψηλής ωσμωτικότητας σκευάσματα λόγω της μεγαλύτερης σχετικά συχνότητας εμφάνισης των διαφόρων παρενεργειών που συνδέονται με τη χρήση τους [3]. Μέχρι σήμερα διάφορες μελέτες έχουν αποτύχει να δείξουν ένα σαφές πλεονέκτημα του ισο-ωσμωτικού ΣΜ (iodixanol) συγκριτικά με τα χαμηλής ωσμωτικότητας όσον αφορά την ανάπτυξη ΝΣΜ [47-51]. Μια σχετικά πρόσφατη μετα-ανάλυση 25 μελετών δεν βρήκε καμία διαφορά στην συχνότητα εμφάνισης ΝΣΜ συγκρίνοντας τη χρήση των ισο-ωσμωτικών ΣΜ με αυτήν των χαμηλής ωσμωτικότητας μετά από ενδοφλέβια χορήγηση [52]. Ενυδάτωση Το κύριο προληπτικό μέτρο έναντι της ΝΣΜ είναι η εξασφάλιση επαρκούς ενυδάτωσης [3, 8, 9]. Ο ιδανικός ρυθμός έγχυσης, καθώς και ο συνολικός όγκος που απαιτείται δεν είναι γνωστά μιας και δεν υπάρχουν έως σήμερα ισχυρά βιβλιογραφικά δεδομένα προς αυτή την κατεύθυνση. Γενικά, για την ενυδάτωση 53

54 προτιμώνται ενδοφλεβίως ισοτονικά υγρά (π.χ. διάλυμα Lactated Ringer s ή 0.9% φυσιολογικού ορού). Ένα προτεινόμενο πρωτόκολλο είναι 0,9% φυσιολογικού ορού με ρυθμό έγχυσης 100 ml ανά ώρα, αρχίζοντας 6 έως 12 ώρες πριν τη χορήγηση ΣΜ και συνεχίζοντας 4 έως 12 ώρες μετά απ αυτή [3]. Η από του στόματος ενυδάτωση έχει επίσης χρησιμοποιηθεί ευρέως, αλλά με μικρότερη αποτελεσματικότητα συγκριτικά με την ενδοφλέβια. Όσον αφορά τον παιδιατρικό πληθυσμό οι ρυθμοί έγχυσης καθώς και ο όγκος μεταβάλλονται ανάλογα με το βάρος του ασθενούς [3]. Η συσχέτιση της συνύπαρξης συνθηκών αφυδάτωσης ως παράγοντας κινδύνου για ΝΣΜ δεν έχει δηχθεί από όλες τις κλινικές μελέτες. Ωστόσο, σε συνθήκες αφυδάτωσης, η νεφρική ροή του αίματος και ο GFR μειώνονται και η επίδραση των ΙΣΜ σε αυτές τις παραμέτρους επιτείνεται. Θεωρητικά οι προκαλούμενες χαμηλές ροές στο σωληνάριο έχουν ως συνέπεια μια παρατεταμένη έκθεση του σωληναρίου στο ΣΜ [3]. Ο Solomon και συνεργάτες μελέτησαν μια σειρά από ενήλικες ασθενείς με χρόνια νεφρική νόσο που υποβλήθηκαν σε καρδιακή μελέτη (στεφανιογραφία) με χρήση ενδαρτηριακά ΙΣΜ [51]. Η αναφερθείσα επίπτωση της ΝΣΜ μειώθηκε στους ασθενείς που έλαβαν ενδοφλέβια ενυδάτωση περί-επεμβατικά (0,45% ή 0,9% φυσιολογικού ορού, 100 ml ανά ώρα (ml/h), 12 ώρες πριν έως 12 ώρες μετά τη χορήγηση του ΣΜ) [51]. Σε μια άλλη μελέτη, η ενδοφλέβια ενυδάτωση με 0,9% φυσιολογικό ορό είχε καλύτερα αποτελέσματα όσον αφορά την μείωση του κινδύνου εμφάνισης ΝΣΜ συγκριτικά με ενυδάτωση με φυσιολογικό ορό 0,45% [53]. Σε μια άλλη σειρά ασθενών με ήπια έως μέτρια νεφρική δυσλειτουργία που υποβλήθηκαν σε καρδιακό καθετηριασμό, ο συνδυασμός από του στόματος ενυδάτωσης πριν την επέμβαση ακολουθούμενος από ενδοφλέβια ενυδάτωση αποδείχθηκε αποτελεσματικός στη μείωση της εμφανιζόμενης ΝΣΜ [54]. 54

55 Διττανθρακικό Νάτριο (Sodium bicarbonate) Αρκετοί ερευνητές προτείνουν σήμερα η ενυδάτωση να πραγματοποιείται με τη χρήση διαλύματος διττανθρακικού νατρίου [3]. Το διττανθρακικό νάτριο αυξάνει την περιεκτικότητα διττανθρακικών ιόντων στο πλάσμα και ρυθμίζει την περίσσεια ιόντων υδρογόνου με συνέπεια την αύξηση του ph του αίματος. Με αυτόν τον τρόπο επιτυγχάνεται η αντιστροφή των κλινικών εκδηλώσεων της οξέωσης [3]. Ορισμένες μελέτες συμπεριλαμβανομένων κάποιων μετά-αναλύσεων από σειρές ασθενών που υποβλήθηκαν σε αγγειογραφικές καρδιολογικές εξετάσεις, έχουν δείξει ότι η ενδοφλέβια ενυδάτωση με διττανθρακικό νάτριο σχετίζεται με μεγαλύτερη μείωση του κινδύνου πρόκλησης ΝΣΜ (μεγαλύτερη προστασία) συγκριτικά με την ενυδάτωση με 0,9% φυσιολογικού ορού [55, 56]. Παρ όλα αυτά άλλες μετά-αναλύσεις έχουν καταλήξει σε αντικρουόμενα αποτελέσματα, έτσι ώστε μέχρι σήμερα να μην μπορεί η χρήση τους να προταθεί ευρέως [57]. N-ακετυλοκυστεΐνη (N-acetylcysteine) Η αποτελεσματικότητα της χρήσης N-ακετυλοκυστεΐνης (NAK) με σκοπό τη μείωση της επίπτωσης της ΝΣΜ είναι αμφιλεγόμενη. Πολλαπλές μελέτες καθώς και μια σειρά από πρόσφατες μετά-αναλύσεις εμφανίζουν διφορούμενα συμπεράσματα ως προς το αν το ΝΑΚ τελικά μειώνει τον κίνδυνο εμφάνισης ΝΣΜ ή όχι [3, 27-32, 34, 35]. Αν και υπάρχουν ενδείξεις ότι η χορήγηση ΝΑΚ μειώνει τα επίπεδα 55

56 κρεατινίνης ορού σε φυσιολογικούς εθελοντές, δεν φαίνεται να επιφέρει ανάλογες αλλαγές στην κυστατίνη-c (η κυστατίνη-c αναφέρεται ως καλύτερος δείκτης του GFR από την κρεατινίνη ορού) [3]. Αυτό εγείρει αμφιβολίες ως προς την πραγματική αποτελεσματικότητα της ΝΑΚ στην πρόληψη της νεφρικής βλάβης που οφείλεται στα ΣΜ. Υποστηρίζεται ότι η χρήση της μπορεί απλά να οδηγεί σε μείωση των επιπέδων της κρεατινίνης ορού χωρίς πραγματικά αυτό να αναλογεί σε προστατευτική δράση στο νεφρικό παρέγχυμα. Έως σήμερα λοιπόν, δεν υπάρχουν επαρκείς αποδείξεις όσον αφορά την αποτελεσματικότητά της έτσι ώστε να μπορεί κανείς να συστήσει τη χρήση της. Σε καμία περίπτωση συνεπώς η χρήση της ΝΑΚ δεν θα πρέπει να θεωρηθεί ως υποκατάστατο των λοιπών προστατευτικών μέτρων όπως για παράδειγμα της επαρκούς ενυδάτωσης [3]. Διουρητικά: Μανιτόλη και Φουροσεμίδη Η χρήση διουρητικών έχει επίσης προταθεί από διαφόρους ερευνητές με σκοπό την αποφυγή ή την πρόληψη της ΝΣΜ. Ωστόσο οι Solomon και συνεργάτες [58], δεν ανέφεραν ευεργετικά αποτελέσματα από την προσθήκη μανιτόλης στο πρωτόκολλο ενυδάτωσης σε ασθενείς με ή χωρίς σακχαρώδη διαβήτη. Όσον αφορά το διουρητικό Φουροσεμίδη υπήρξε μία παρόξυνση της νεφρικής δυσλειτουργίας, όταν αυτό χρησιμοποιείται σε συνδυασμό με ενυδάτωση. Σήμερα κανένα από τα προαναφερόμενα (ούτε η Μανιτόλη ούτε η Φουροσεμίδη) δεν συνιστάται για τη μείωση του κινδύνου εμφάνισης ΝΣΜ [3]. 56

57 Άλλα σκευάσματα Εκτός των ανωτέρω μια σειρά άλλων σκευασμάτων όπως η θεοφυλλίνη, η ενδοθηλίνη-1, και το fenoldopam με θεωρητική νεφροπροστατευτική δράση, έχουν προταθεί με σκοπό την μείωση της επίπτωσης της ΝΣΜ. Έως σήμερα όμως, τα υπάρχοντα βιβλιογραφικά στοιχεία δεν είναι πειστικά ώστε να συστήνεται η χρήση αυτών των παραγόντων για τη μείωση του κινδύνου εμφάνισης ΝΣΜ [3]. Αιμοκαθαρόμενοι ασθενείς και χρήση ΙΣΜ Οι ασθενείς με ανουρία τελικού σταδίου χρόνιας νεφρικής νόσου (ασθενείς σε αιμοκάθαρση) δύναται να λάβουν ενδοφλέβια ΙΣΜ, χωρίς κίνδυνο για περαιτέρω νεφρική βλάβη. Ο λόγος είναι ότι τα νεφρά τους ουσιαστικά δεν είναι πλέον λειτουργικά. Ωστόσο, υφίσταται ένας θεωρητικός κίνδυνος μετατροπής ενός ολιγουρικού ασθενή, ο οποίος υποβάλλεται σε αιμοκάθαρση σε ανουρικό μετά από χορήγηση σ' αυτόν ενδαγγειακά ΣΜ. Ο κίνδυνος αυτός παραμένει θεωρητικός, καθώς δεν υπάρχουν πειστικά δεδομένα για αυτό [3]. Οι ασθενείς που υποβάλλονται σε αιμοκάθαρση είναι επίσης σε θεωρητικό κίνδυνο από την αύξηση του οσμωτικού φορτίου που προκαλείται από την ενδαγγειακή χορήγηση ΙΣΜ, μίας και η ενδαγγειακή περίσσεια όγκου δεν δύναται να καθαρισθεί. Η οσμωτική αύτη φόρτιση μπορεί θεωρητικά να οδηγήσει σε πνευμονικό οίδημα και σε οίδημα ανά σάρκα. Για την άμβλυνση αυτού του πιθανού κινδύνου, η χορηγούμενη δόση θα πρέπει να διατηρείται στα χαμηλότερα δυνατά όρια για την επίτευξη ενός ικανοποιητικού διαγνωστικού αποτελέσματος (όπως άλλωστε οφείλει να συμβαίνει σε όλους τους ασθενείς) [3]. 57

58 Τα ΣΜ δεν είναι προσδεδεμένα σε πρωτεΐνη, έχουν σχετικά χαμηλά μοριακά βάρη, και εύκολα εκκαθαρίζονται κατά την διάλυση. Εκτός των περιπτώσεων όπου χορηγείται ένας ασυνήθιστα μεγάλος όγκος ΣΜ ή σε περιπτώσεις όπου υπάρχει σημαντική υποκείμενη καρδιακή δυσλειτουργία, δεν υπάρχει καμία ανάγκη για επείγουσα αιμοκάθαρση μετά από ενδαγγειακή χορήγηση ΣΜ [59]. 58

59 ΠΑΡΣΤΑΤΙΝΗ Οι PARs υποδοχείς (Protease-activated receptors - PARs) αποτελούν μία οικογένεια υποδοχέων οι οποίοι ενεργοποιούνται μετά από την πρωτεόλυση του εξωκυττάριου τμήματός τους και πιο συγκεκριμένα του αμινοτελικού τους άκρου. Ο PAR1 αποτελεί το πρώτο μέλος αυτής της οικογένειας [60, 61]. Αποτελείται από συνολικά 425 αμινοξέα τα οποία σχηματίζουν συνολικά επτά διαμεβρανικές περιοχές. Η πρωτεολυτική διάσπαση στο δεσμό του ανθρώπινου PAR1 από τη θρομβίνη (η οποία αποτελεί μία πρωτεάση της σερίνης με κεντρικό ρόλο στην πήξη) πραγματοποιείται στον πεπτιδικό δεσμό μεταξύ των αμινοξέων που βρίσκονται στις θέσεις 41 και 42 και πρόκειται για τα αμινοξέα αργυνίνη και σερίνη [60, 61]. Αποτέλεσμα αυτής της διάσπασης είναι η ενεργοποίηση του PAR1 υποδοχέα, ενώ παράλληλο αποτέλεσμα αποτελεί η απελευθέρωση ενός πεπτιδίου το οποίο περιέχει συνολικά 41 αμινοξέα [62-65]. Έτσι, η πρωτεολυτική διάσπαση του αμινοτελικού άκρου του υποδοχέα PAR1 οδηγεί στην αποκάλυψη ενός προσδεμένου νέου αμινοτελικού άκρου στον υποδοχέα με αλληλουχία αναγνώρισης SFLLRN το οποίο δρα ως αγωνιστής για την αυτό-ενεργοποίησή του. Συγκεκριμένα, αυτή η αλληλουχία συνδέεται με περιοχές στην δεύτερη εξωκυτταρική αγκύλη, με αποτέλεσμα την ενεργοποίησή του και την έναρξη της μεταγωγής σήματος. Το παραπάνω έχει λοιπόν ως αποτέλεσμα την ενεργοποίηση G πρωτεϊνών και την έναρξη μίας σειράς ενδο-κυττάριων βιοχημικών μονοπατιών [63]. Στην παρακάτω εικόνα (Εικόνα 3) απεικονίζεται ο τρόπος με τον οποίο συνδέεται η θρομβίνη με τον υποδοχέα PAR1 και το τι ακολουθεί αυτή τη σύνδεση. 59

60 Εικόνα 3: Σχηματική απεικόνιση του τρόπου με τον οποίο συνδέεται η θρομβίνη με τον υποδοχέα PAR1. Έως σήμερα ο ρόλο της θρομβίνης και του PAR1 υποδοχέα της στη φυσιολογία και στην παθοφυσιολογία έχει μελετηθεί εκτενώς [63]. Αντίθετα μέχρι πρόσφατα λίγη προσπάθεια έχει επικεντρωθεί στην «τύχη» του αποσπώμενου πεπτιδίου 41 αμινοξέων που προκύπτει ως θραύσμα μετά την ενεργοποίηση του PAR1 υποδοχέα. Το πεπτίδιο αυτό σήμερα είναι γνωστό με τον όρο Παρστατίνη (Parstatin) [62, 64, 65]. Εικόνα 4 και 5. 60

61 Εικόνα 4: Σχηματική απεικόνιση του πως η θρομβίνη συνδέεται με τον υποδοχέα PAR1, ενεργοποιείται και το πεπτίδιο Παρστατίνη απελευθερώνεται. Το πεπτίδιο μπορεί να εισέρχεται ενδοκυτταρικά ακόμα και όταν αυτό χορηγείται εξωγενώς μίας και έχει ανιχνευτεί τόσο στην κυτταρική μεμβράνη όσο και εντός του κυτταροπλάσματος. Με βάση την αλληλουχία των αμινοξέων του, διακρίνονται δύο τμήματα: ένα υδρόφοβο και ένα υδρόφιλο τμήμα. Τα πρώτα 23 αμινοξέα (1-23) συνιστούν το υδρόφοβο τμήμα, ενώ τα υπόλοιπα (24-41) συνιστούν το υδρόφιλο, Εικόνα 5. 61

62 Παρστατίνη M 1 GPRRLLLVAACFSLCGPLLSAR Υδρόφοβο τμήμα TRARRPESKATNATLDPR Υδρόφιλο τμήμα Εικόνα 5: Διαχωρισμός Παρστατίνης σε υδρόφοβο και υδρόφιλο τμήμα. Οι πρώτες μελέτες με το πεπτίδιο αυτό αποκάλυψαν μία ισχυρή αντίαγγειογενετική δράση. Η δράση αυτή αποδείχθηκε σε in-vivo μελέτες που πραγματοποιήθηκαν στην χοριοαλλαντοϊκή μεμβράνη κοτόπουλου καθώς και σε exvivo μελέτες σε μοντέλο δακτυλίων αορτής αρουραίου [65]. Πιο πρόσφατες μελέτες έχουν δείξει ότι χαμηλές δόσεις του εν λόγω πεπτιδίου εμφανίζουν μια εντυπωσιακή προστατευτική επίδραση στο μυοκάρδιο αρουραίου μετά από πειράματα πρόκλησης τραυματισμού ισχαιμίας-επαναιμάτωσης [66, 67]. Η Παρστατίνη έχει αποδειχτεί ότι προκαλεί αγγειοδιαστολή στα στεφανιαία αγγεία αρουραίων [67]. Χορήγηση Παρστατίνης πριν, κατά και μετά την ισχαιμία φαίνεται να μειώνει το μέγεθος του εμφράγματος κατά 26%, 23%, και 18% αντίστοιχα [67]. Φαίνεται επίσης, ότι δύναται να προστατεύσει την φυσιολογική νεφρική λειτουργία μετά από οξεία ισχαιμικού τύπου νεφρικής βλάβης. Μία απλή ενδοφλέβια χορήγηση Παρστατίνης πριν από την επαγωγή της νεφροπάθειας από βλάβη ισχαιμίας-επαναιμάτωσης σε νεφρά προκάλεσε αξιοσημείωτη εξασθένηση της εμφανιζόμενης νεφρικής δυσλειτουργίας και ιστολογικής βλάβης [68]. 62


64 64

65 ΕΠΙΣΤΗΜΟΝΙΚΟΣ ΣΚΟΠΟΣ Σκοπός της ερευνητικής εργασίας ήταν αρχικά η ανάπτυξη ενός πειραματικού μοντέλου νεφροτοξικότητας στα σκιαγραφικά μέσα καθώς και η συστηματική δοκιμασία της Παρστατίνης έναντι της νεφροτοξικής βλάβης που προκαλείται από την ενδοφλέβια χορήγηση ΙΣΜ κατά τη διάρκεια τόσο διαγνωστικών όσο και θεραπευτικών ιατρικών πράξεων, όπως για παράδειγμα κατά τη διάρκεια ιατρικών πράξεων στο τμήμα Επεμβατικής Ακτινολογίας (τμήμα Αγγειογραφίας). Υποθέσαμε ότι η Παρστατίνη σε χαμηλές δόσεις μπορεί να μειώσει τις νεφροτοξικές επιπτώσεις των ΣΜ αντίθεσης και να ασκήσει προστατευτικό ρόλο κατά της ανάπτυξης ΝΣΜ κατά αντιστοιχία με την νεφροπροστατευτική δράση που είχε ήδη δειχθεί να επιτυγχάνει μετά από πρόκληση βλάβης ισχαιμίαςεπαναιμάτωσης σε προηγούμενα πειράματα σε αρουραίους [68]. Η επαλήθευση μιας τέτοιας δράσης θα μπορούσε να ανοίξει νέους ορίζοντες όσον αφορά το γενικότερο ρόλο της Παρστατίνης στην προστασία της νεφρικής λειτουργίας στην καθ ημέρα κλινική πράξη όπου η χρήση των ΣΜ συνεχώς αυξάνεται. Άλλωστε, η ανακάλυψη και περαιτέρω ανάπτυξη ενός φαρμάκου που να μπορεί να χορηγηθεί πριν την ενδαγγειακή χορήγηση ΙΣΜ και να παρέχει προστατευτική δράση στους νεφρούς αποτελεί το αντικείμενο πολλών ερευνητικών ομάδων παγκοσμίως. Για να ελεγχθεί αυτή η υπόθεση αναπτύχθηκε ένα πειραματικό μοντέλο ΝΣΜ σε κονίκλους. [69]. 65

66 ΥΛΙΚΑ ΚΑΙ ΜΕΘΟΔΟΙ Παρστατίνη και Πειραματόζωα Όλα τα πειράματα διεξήχθησαν στον ειδικά διαμορφωμένο και εξοπλισμένο χώρο του ζωοτροφείου μεγάλων ζώων του Τμήματος Ιατρικής. Στα πειράματα χρησιμοποιήθηκαν λευκοί κόνικλοι Νέας Ζηλανδίας βάρους 2,8 έως 3,4 χιλιόγραμμα. Τα πειραματόζωα φυλάσσονταν σε ειδικά διαμορφωμένους χώρους. Προσοχή δινόταν έτσι ώστε οι συνθήκες περιβάλλοντος να διατηρούνταν σταθερές. Διατηρούνταν σταθερή θερμοκρασία περιβάλλοντος και κύκλος φωτισμού διάρκειας 12 ωρών (εναλλαγή ημέρας-νύχτας). Εξειδικευμένο προσωπικό ήταν υπεύθυνο για την συντήρηση των πειραματόζωων. Το πειραματικό πρωτόκολλο πραγματοποιήθηκε σύμφωνα με τις προβλεπόμενες διατάξεις της Διακήρυξης του Ελσίνκι, ενώ πριν την έναρξη των πειραμάτων έλαβε έγκρισης από την Επιτροπή Επιστημονικών και Ηθικών Ζητημάτων του Πανεπιστημίου Πατρών [70, 71]. Για τους σκοπούς της μελέτης χρησιμοποιήθηκε ένα συνθετικό πεπτίδιο το οποίο αντιστοιχεί στο ανθρώπινο πεπτίδιο 41 αμινοξέων που αποσπάται από τον υποδοχέα PAR1 μετά την ενεργοποίηση αυτού [65]. Το πεπτίδιο της Παρστατίνης αποκτήθηκε από την εταιρεία Biosynthesis Inc., Lewisville, Tex., USA (καθαρότητα άνω του 95%). Η αλληλουχία αμινοξέων του εν λόγω πεπτιδίου είναι η εξής: MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR. 66

67 Το μοριακό βάρος του χρησιμοποιούμενου πεπτιδίου ήταν ίσο με 4468 Da. Η Παρστατίνη διαλυόταν σε φυσιολογικό ορό (N/S, 0,9%) πριν χορηγηθεί ενδοφλέβια στα πειραματόζωα. Η χορήγηση γινόταν διαμέσου της ωτιαίας του φλέβας μετά από τοποθέτηση ενός φλεβοκαθετήρα. 67

68 Μέρος Ι: Πειραματικό Μοντέλο Νεφροτοξικότητας σε Κόνικλους Η πειραματική αναπαραγωγή της νεφρικής ανεπάρκειας μετά από χορήγηση ΣΜ σε μία in vivo πειραματική πλατφόρμα είναι κάτι το οποίο δεν έχει αναπτυχθεί ή μελετηθεί ευρέως έως σήμερα. Το πιο διαδεδομένο μοντέλο ΝΣΜ σε θηλαστικά και συγκεκριμένα σε λευκούς κονίκλους Νέας Ζηλανδίας έχει περιγραφεί από τους Pettersson G και συνεργάτες [69]. Ο κόνικλος ως πειραματική πλατφόρμα επιλέχτηκε διότι είναι γνωστό ότι η νεφρική λειτουργία του επηρεάζεται σε σημαντικό βαθμό από τα ΙΣΜ [69, 72], ενώ είναι επίσης γνωστό ότι τα νεφρά του κονίκλου είναι περισσότερο ευαίσθητα από αυτά των αρουραίων στην ενδοφλέβια χορήγηση ΙΣΜ [73]. Αρχικά σε μία σειρά υγιή κατά τα άλλα πειραματόζωα πραγματοποιήθηκε προσομοίωση του πειραματικού πρωτοκόλλου χωρίς όμως να χορηγηθεί η προς δοκιμή ουσία ή ιωδιούχο σκιαγραφικό μέσο (ομάδα sham). Ποιο συγκεκριμένα, τα ζώα υποβάλλονταν σε διαχωριστική αναισθησία με συνδυασμό ξυλαζίνης (xylazine, 10mg/kg) και κεταμίνης (ketamine, 50mg/kg), Εν συνεχεία, γινόταν παρακέντηση και τοποθέτηση φλεβοκαθετήρα στην ωτιαία φλέβα τους, ακολουθούσε χορήγηση φυσιολογικού ορού και τα ζώα αφήνονταν να αναρρώσουν από την αναισθησία. Σαράντα οκτώ ώρες μετά πραγματοποιούσαμε αιμοληψίες με σκοπό τον υπολογισμό της τιμής της κρεατινίνης ορού ως τιμή βάσης για τα λοιπά πειράματα. Το δεύτερο στάδιο ήταν η ανάπτυξη, ευρεία δοκιμή και αξιολόγηση του in-vivo μοντέλου ΝΣΜ που χρησιμοποιήθηκε στην παρούσα μελέτη. Σκοπός ήταν η διασφάλιση ενός υψηλού βαθμού αναπαραγωγιμότητας των αποτελεσμάτων (ανάπτυξη ΝΣΜ σε λευκούς κονίκλους Νέας Ζηλανδίας). Στο στάδιο αυτό κύριος οδηγός αποτέλεσε η εργασία των Pettersson και συνεργατών [69]. Η σκιαγραφική 68

69 ουσία που χρησιμοποιήθηκε για το σκοπό αυτό καθώς και για το σύνολο των λοιπών πειραμάτων ήταν η Iopromide (Ultravist 370mg I/ml, Bayer Healthcare Pharmaceuticals, Berlin, Germany) Εικόνα 6. Εικόνα 6. Iopromide. Όπως είναι γνωστό, το συγκεκριμένο ΣΜ εάν χορηγηθεί σε υγιής κονίκλους με ρυθμό ροής 2 ml/min προκαλεί εκτεταμένη βλάβη στους νεφρούς τους συγκριτικά με πειραματόζωα που λαμβάνουν φυσιολογικό ορό (ομάδα ελέγχου). Συγκεκριμένα προκαλεί σημαντική αύξηση της κρεατινίνης ορού (scr levels: 377±77μmol/L έναντι 13±3 μmol/l, αντιστοίχως) ενώ στην ιστοπαθολογική ανάλυση αναγνωρίζεται εκτεταμένος βαθμός νέκρωσης στα νεφρά πειραματόζωων που έλαβαν ΣΜ συγκριτικά με την ομάδα ελέγχου (Βαθμός νέκρωσης: 3.1±0.3 έναντι 0, αντιστοίχως). 69

70 Με σκοπό τα ανωτέρω σε μία σειρά κονίκλων (Ομάδα CIN-control group) χορηγήθηκε Iopromide διαμέσου ενός φλεβοκαθετήρα ο οποίος τοποθετήθηκε στην κεντρική ωτιαία φλέβα (Εικόνα 6). Εικόνα 7. Διαωτιαία ενδοφλέβιος πρόσβαση στον κόνικλο. (α) Ραχιαία επιφάνεια του αυτιού ενός λευκού κονίκλου Νέας Ζηλανδίας όπου γίνεται παρακέντηση της κεντρικής ωτιαίας φλέβας με σκοπό τη χορήγηση δια αυτής του διαλύματος ΣΜ. Διαμέσου της ίδιας πρόσβασης γινόταν και η χορήγηση της υπό δοκιμής ουσίας στα πειράματα που ακολούθησαν. Κατά το στάδιο αυτό, πραγματοποιήθηκε μια σειρά από πειράματα που σκοπό είχαν την σταθεροποίηση όλων των πειραματικών συνθηκών έτσι ώστε να επιτευχτεί η μέγιστη δυνατή επαναληψιμότητα του μοντέλου νεφροτοξικότητας. Ποιο συγκεκριμένα, έγινε έλεγχος των βασικών παραμέτρων (π.χ. θερμοκρασία δωματίου, επίπεδο αναισθησίας ζώου, ρυθμός έγχυσης, όγκος έγχυσης ανά χιλιόγραμμο βάρους) που θα μπορούσαν να επηρεάσουν το πείραμα έτσι ώστε αυτές να 70

71 βελτιστοποιηθούν αλλά και με σκοπό να διατηρούνται σταθερές κατά τη διάρκεια των πειραμάτων έτσι ώστε να μηδενιστεί η όποια πιθανή εξωτερική μεταβλητή. Με σκοπό τον ακριβή υπολογισμό του χρησιμοποιούμενου ΣΜ, χρησιμοποιήθηκαν ειδικοί ογκομετρικοί σωλήνες έγχυσης. Μετά την ολοκλήρωση των πειραμάτων, τα πειραματόζωα μεταφέρονταν στα κλουβιά τους όπου ανάρρωναν της αναισθησίας υπό συνεχή παρακολούθηση. Μετά από 48 ώρες λαμβάνονταν αιμοληψίες με σκοπό τον υπολογισμό της κρεατινίνης ορού καθώς και της ουρίας (BUN- blood urea nitrogen). 71

72 Μέρος ΙΙ Συστηματική δοκιμή Παρστατίνη Το επόμενο στάδιο περιελάμβανε την συστηματική δοκιμή της Παρστατίνης έναντι της ανάπτυξης ΝΣΜ. Το πειραματικό πρωτόκολλο σε αυτή τη φάση περιελάμβανε δύο ομάδες. Στα πειραματόζωα τα οποία συμπεριελήφθησαν στην πρώτη ομάδα χορηγήθηκε διάλυμα συνολικού όγκου 1 ml της υπό δοκιμής ουσίας το οποίο περιείχε συνολική ποσότητα 10 μικρό-γραμμαρίων ανά χιλιόγραμμο σωματικού βάρους (μg/kg) συνολικής δραστικής ουσίας ακριβώς 15 λεπτά προ της έναρξης εγχύσεως του ΣΜ (Ομάδα δοκιμής - Group P 10 ). Ως ομάδα ελέγχου χρησιμοποιήθηκαν πειραματόζωα από το προηγούμενο στάδιο πειραμάτων τα οποία είχαν λάβει ίσο όγκο φυσιολογικού ορού (NaCl 0.9%) (1 ml) επίσης 15 λεπτά προ της εγχύσεως του ΣΜ (ομάδα ελέγχου - Group C). Η υπό δοκιμή δόση βασίστηκε σε πρώιμες μελέτες σε αρουραίους όπου η υπό δοκιμή ουσία είχε θετικά αποτελέσματα σε μελέτες βλάβης του μυοκαρδίου μετά από τραύμα του τύπου της ισχαιμίας/επαναιμάτωσης [67]. Επιπλέον της ανωτέρο δόσης δοκιμάστηκαν μία σειρά από άλλες δόσεις που σκοπό είχαν την αναγνώριση της βέλτιστης δόσης στην οποία επιτυγχάνεται το μέγιστο θεραπευτικό αποτέλεσμα έναντι της ανάπτυξης ΝΣΜ στο συγκεκριμένο πειραματικό μοντέλο. Ποιο συγκεκριμένα μία ομάδα έλαβε δόση δεκαπλάσια από την αρχική (Group P 100, Parstatin=100 μg/kg) και μία ομάδα δόση υποδεκαπλάσια της αρχικής (Group P 1, Parstatin=1 μg/kg), διαλυμένα σε φυσιολογικό ορό. Οι λοιπές παράμετροι του πειράματος παρέμειναν σταθερές όπως καθορίστηκαν στα αρχικά πειράματα. Και σε αυτή τη σειρά μετά από 48 ώρες λαμβάνονταν αιμοληψίες με σκοπό τον υπολογισμό της κρεατινίνης ορού καθώς και 72

73 της ουρίας (BUN) με στόχο να αναγνωριστούν πειραματόζωα τα οποία ανέπτυξαν ΝΣΜ. Εργαστηριακές Μετρήσεις - Ιστοπαθολογική Εξέταση Όπως προαναφέρθηκε, σε όλα τα στάδια της ερευνητικής εργασίας πραγματοποιούνταν αιμοληψίες με σκοπό τον προσδιορισμό τόσο της κρεατινίνης ορού όσο και της ουρίας. Σκοπός αυτών των μετρήσεων ήταν η αναγνώριση των πειραματόζωων εκείνων τα οποία ανέπτυξαν ΝΣΜ 48 ώρες μετά την χορήγηση ΣΜ. Ως κατώφλι για την εμφάνιση ή όχι ΝΣΜ τέθηκε η τιμή της κρεατινίνης ορού άνω του 1.5 mg/dl μετά από 48 ώρες από την ενδοφλέβια έγχυση ΣΜ. Επιπλέον, συγκρίθηκαν οι τιμές της κρεατινίνης ορού καθώς και της ουρίας μεταξύ της ομάδας ελέγχου και των ομάδων που έλαβαν την υπό δοκιμή ουσία έτσι ώστε να αναγνωριστεί πιθανή στατιστικά σημαντική διαφορά. Για την πραγματοποίηση των αιμοληψιών τα πειραματόζωα αναισθητοποιούνταν εκ νέου με το προαναφερθέν μείγμα κεταμίνης και ξυλαζίνης και οι αιμοληψίες πραγματοποιούνταν μετά από παρακέντηση της ωτιαίας αρτηρίας. Εν συνεχεία, τα δείγματα τοποθετούνταν σε ειδικά φιαλίδια, μεταφέρονταν στο εργαστήριο όπου φυγοκεντρούνταν προτού αναλυθούν στον ειδικό αυτόματο αναλυτή (Olympus AU400). Προσοχή δινόταν έτσι ώστε να πραγματοποιείται ποιοτικός έλεγχος του αναλυτή πριν από κάθε μέτρηση έτσι ώστε να διασφαλιστεί η ακρίβεια των αποτελεσμάτων. Μετά την ολοκλήρωση των εργαστηριακών μετρήσεων, ένα ενδεικτικό δείγμα των πειραματόζωων υποβλήθηκε σε ευθανασία με τη χορήγηση υπερβολικής ενδοφλέβιας δόσης προποφόλης και καλίου. Έγινε αυτοψία των νεφρών και 73

74 ελήφθησαν δείγματα από το εγχειρητικό πεδίο. Τα δείγματα μονιμοποιήθηκαν σε ουδέτερη φορμόλη και μεταφέρθηκαν στο Εργαστήριο Ανατομίας του Πανεπιστημίου Πατρών για περαιτέρω επεξεργασία. Τα δείγματα μονιμοποιήθηκαν σε παραφίνη και εν συνεχεία κόπηκαν σε λεπτές τομές των 4μm στα οποία ακολούθησε χρώση με αιματοξυλίνη και ηωσίνη. Δυο ανεξάρτητοι ερευνητές μέλη του εργαστηρίου Ανατομικής του Πανεπιστημίου Πατρών, η Καθηγήτρια κ. Ελένη Πέτρου-Παπαδάκη και η ιατρός παθολογοανατόμος κ Κατερίνα Γερονάτσιου χωρίς πρότερη γνώση της ομάδας στην οποία ανήκαν αρχικά τα δείγματα τα οποία μελετούσαν, ανέλυσαν την κάθε τομή ανεξάρτητα ο ένας από τον άλλο. Συνολικά 10 τομές ανά νεφρό εξετάστηκαν με σκοπό να αναγνωριστεί η όποια πιθανή ιστολογική βλάβη (π.χ. παρουσία οιδήματος στα νεφρικά σωληνάρια). Η κάθε τομή βαθμολογήθηκε ανεξάρτητα, από 0 (φυσιολογική ιστολογική εικόνα) έως και 3 (σοβαρές αλλοιώσεις). Η συνολική βαθμολογία για τον κάθε νεφρό χωριστά υπολογίστηκε με την άθροιση των επιμέρους δέκα βαθμολογιών (Μέγιστος βαθμός=30). Στατιστική Ανάλυση Όλες οι διακριτές μεταβλητές αποδίδονται ως απόλυτες μετρήσεις και ποσοστά επί τοις εκατό. Οι συνεχείς μεταβλητές αποδίδονται ως μέσες τιμές ± τυπικό λάθος (Standard Error; SE) ή με τον διάμεσο (median) και τα αντίστοιχα διαστήματα εμπιστοσύνης (confidence intervals CI, που αντιστοιχούν στο 25% και 75% του διάμεσου). Όλες οι μεταβλητές που ακολουθούν κανονική κατανομή (βάση του Kolmogorov-Smirnov test) συγκρίθηκαν με τη χρήση του μη-συζευγμένου Student t-test. Για σύγκριση των δεδομένων με μη κανονικές κατανομές χρησιμοποιήθηκε η μη παραμετρική στατιστική δοκιμή Mann-Whitney (non- 74

75 parametric Mann-Whitney test). Για την στατιστική ανάλυση περισσοτέρων των 2 ομάδων εφαρμόστηκε η δοκιμασία ANOVA. Σε περίπτωση ανίχνευσης στατιστικά σημαντικών διαφορών, η σύγκριση έγινε με την εφαρμογή πολλαπλών συγκρίσεων με τη δοκιμασία Tukey (Tukey post-test multiple comparisons). Για την περιγραφική και στατιστική ανάλυση των δεδομένων χρησιμοποιήθηκαν τα πακέτα λογισμικού Microsoft Office Excel 2007, SPSS έκδοση 18 και Graphpad Prism έκδοση 4.0. Το επίπεδο στατιστικής σημαντικότητας τέθηκε ως p<0.05). 75

76 ΑΠΟΤΕΛΕΣΜΑΤΑ Μέρος Ι Ανάπτυξη Πειραματικού Μοντέλου Νεφροτοξικότητας σε κονίκλους. Στην πρώτη αυτή φάση της μελέτης χρησιμοποιήθηκαν συνολικά τριάντα δύο (n=32) πειραματόζωα. Σε συνολικά επτά εξ αυτών τα οποία αποτέλεσαν την ομάδα Sham (n=7/32, 21,87% μέσου βάρους= 2,97±0,22Kg) πραγματοποιήθηκαν μόνο αιμοληψίες 48 ώρες μετά από την πραγματοποίηση του πειράματος προσομοίωσης, οι οποίες αποσκοπούσαν στην επιβεβαίωση της φυσιολογικών τιμών της κρεατινίνης ορού σε φυσιολογικούς, υγιείς κονίκλους (Group sham) οι οποίοι δεν έχουν υποστεί καμία παρέμβαση πέραν της αναισθησίας και να θέσουμε έτσι την τιμή βάσης για τα λοιπά πειράματα. Βιβλιογραφικά είναι γνωστό ότι οι υγιείς κόνικλοι Νέας Ζηλανδίας έχουν φυσιολογικές τιμές κρεατινίνης ορού (scr) γύρω στο 1 mg/dl (Μέσος όρος (mean): 1.08±0.2 mg/dl) [74]. Οι τιμές της κρεατινίνης ορού της συγκεκριμένης ομάδας επιβεβαίωσαν τα βιβλιογραφικά δεδομένα. Συγκεκριμένα, στα πειραματόζωα του δικού μας πληθυσμού, η τιμή της κρεατινίνης ορού ήταν στα επίπεδα του 0.90 mg/dl (CI: mg/dl). Βασιζόμενοι σε αυτό, θέσαμε ως κατώφλι της τιμής κρεατινίνης για να θεωρήσουμε ότι αναπτύχθηκε ΝΣΜ την τιμή ίση ή άνω του 1,5 mg/dl μετά το πέρας 48 ωρών από την ενδοφλέβια έγχυση του ΙΣΜ που αναλογεί σε αύξηση άνω του 0,5 mg/dl από τις τιμές βάσης. Οι συνθήκες για όλη τη σειρά των πειραμάτων που ακολούθησε όπως προέκυψαν από τα πειράματα ανάπτυξης του μοντέλου περιελάμβαναν τη 76

77 θερμοκρασία δωματίου να διατηρείτε σταθερή στους 24 ο Κελσίου (C), τα πειραματόζωα αναισθητοποιούνταν με τη χρήση μείγματος ξυλαζίνης (xylazine, 10mg/kg) και κεταμίνης (ketamine, 50mg/kg), η συνολική δόση του χορηγούμενου ΣΜ προσαρμοζόταν έτσι ώστε να αντιστοιχούσε σε 10 γραμμάρια Ιωδίου ανά χιλιόγραμμο βάρους (10g I/kg), ενώ προσοχή δινόταν έτσι ώστε η έγχυση να προσαρμόζεται και να ολοκληρώνεται εντός ενός στενού χρονικού παραθύρου λεπτών έτσι ώστε να μην επηρεάζεται το επίπεδο αναισθησίας αλλά και ο ρυθμός έγχυσης του σκιαγραφικού να είναι σε επίπεδο ίσο με 2,5 έως 3,0 ml/min. Η τελευταία αυτή παράμετρος ήταν και αυτή με την μέγιστη επιρροή στην ανάπτυξη ή όχι ΝΣΜ. Συγκεκριμένα, σε όσα πειραματόζωα (n=5/32, 15,62%, μέσου βάρους=3,01±0,22kg) η έγχυση γινόταν ποιο γρήγορα (ρυθμός έγχυσης μεγαλύτερος του 3,0 ml/min) αυτό είχε ως αποτέλεσμα την πρόκληση οξείας βλάβης τέτοιου βαθμού όπου τα ζώα πέθαιναν τις επόμενες ώρες (βαριά οξεία νεφρική ανεπάρκεια) (επιβίωση 0,0%). Σε όσα ζώα ο ρυθμός έγχυσης ήταν μικρότερος του 2,0 ml/min (n=5/32, 15,62%, μέσου βάρους=2,99±0,31kg) τα ζώα δεν ανέπτυσσαν νεφρική βλάβη στις 48 ώρες (0,0% νεφροτοξικότητα). Στα υπόλοιπα δεκαπέντε (Group Control), (n=.15/22, 46,88%, μέσου βάρους=3,13±0,14kg) πραγματοποιήθηκε δια της ωτιαίας φλέβας ενδοφλέβια έγχυση ΙΣΜ (Ιopromide) σε ποσότητα που να αντιστοιχεί σε συγκέντρωση 10 γραμμαρίων Ιωδίου ανά χιλιόγραμμο βάρους. όπως περιγράφηκε παραπάνω. Το σύνολο των πειραματόζωων από την ομάδα ελέγχου χρησιμοποιήθηκε ως ομάδα ελέγχου για τα υπόλοιπα πειράματα. Τέλος, το σκιαγραφικό μέσο προ εγχύσεως θερμαινόταν σε θερμοκρασία δωματίου. 77

78 Οι παραπάνω παράγοντες διατηρήθηκαν σταθεροί και στα κυρίως πειράματα που ακολούθησαν (Πίνακας 3). Πίνακας 3. Πειραματικές συνθήκες Θερμοκρασία δωματίου Θερμοκρασία ΣΜ κατά ~ 24 βαθμούς Κελσίου Θερμοκρασία δωματίου την έγχυση Αναισθησία Χρήση μείγματος ξυλαζίνης (xylazine, 10mg/kg) και κεταμίνης (ketamine, 50mg/kg), ΣΜ και Συνολική δόση αυτού Ρυθμός έγχυσης Iopromide σε δόση 10 γραμμάρια Ιωδίου ανά χιλιόγραμμο βάρους (10g I/kg) 2,5 έως 3,0 ml/min Συνολικός χρόνος λεπτά έγχυσης Πίνακας 3: Πειραματικές συνθήκες. 78

79 Τα αποτελέσματα των μετρήσεων από την ομάδα ελέγχου (Group control) επέδειξαν επίσης μια υψηλή επιτυχία του εφαρμοζόμενου μοντέλου με υψηλά ποσοστά πειραματόζωων να έχουν αύξηση της κρεατινίνης ορού σε παθολογικά επίπεδα ίση ή άνω του 1,5 mg/dl. Αξιοσημείωτη είναι η διαπίστωση ότι μερικά εξ αυτών εμφάνισαν τιμές σε πολύ υψηλά επίπεδα ακόμα και άνω του 4 mg/dl. Πιο αναλυτικά, 13 από τα 15 πειραματόζωα (86,7%) της ομάδας εμφάνισαν παθολογικά επίπεδα κρεατινίνης ορού με την διάμεση τιμή να υπολογίζεται ίση με 3,09 mg/dl (CI: mg/dl). Στον παρακάτω πίνακα (Πίνακας 4) καθώς και στο γράφημα (Γράφημα 1) γίνεται σαφής η διαφορά μεταξύ των δύο αυτών ομάδων. Πίνακας 4. Σύγκριση ομάδας Sham με ομάδα Control CIN (scr> P value scr (mg/dl), medians P value 1.5mg/dl) CI (25%-75%) CIN-control 86.7% (13/15) < (CI: ) έναντι έναντι έναντι CIN-SHAM 0.0% (0/7) 0.90 (CI: ) Πίνακας 4: Αναλυτική παρουσίαση των αποτελεσμάτων του Ιου μέρους. 79

80 3,5 Sham control 3 2,5 2 1,5 1 0,5 0 Kρεατινίνη (scr) Γράφημα 1: Γραφική παράσταση της διαφοράς της τιμής της κρεατινίνης ορού μεταξύ των δύο ομάδων του 1 ου μέρους των πειραμάτων. Οι διάμεσες τιμές και τα αντίστοιχα CI φαίνονται στον Πίνακα 4. 80

81 Συμπεράσματα Επιβεβαίωση της γνωστής από την βιβλιογραφία φυσιολογικής τιμής της κρεατινίνης ορού στο πειραματικό μοντέλο (λευκούς κονίκλους Νέας Ζηλανδίας) που θα χρησιμοποιηθεί για τους σκοπούς της ερευνητικής εργασίας Τέθηκαν οι τιμές κρεατινίνης βάσης καθώς και το κατώφλι στην τιμή κρεατινίνης για την αναγνώριση της ανάπτυξης ΝΣΜ Σταθεροποίηση των πειραματικών συνθηκών Επιβεβαίωση του υψηλού ποσοστού αναπαραγωγιμότητας και αξιοπιστίας του μοντέλου ΝΣΜ που θα χρησιμοποιηθεί στα επόμενα πειράματα. 81

82 Μέρος ΙΙ Συστηματική δοκιμή Παρστατίνης Αυτή η φάση της μελέτης αποτελεί και το κύριο τμήμα της παρούσας ερευνητικής εργασίας. Χρησιμοποιήθηκαν συνολικά 27 πειραματόζωα με σκοπό την διερεύνηση της πιθανής προστατευτικής δράσης της υπό δοκιμής ουσίας έναντι της ανάπτυξης ΝΣΜ στο συγκεκριμένο πειραματικό μοντέλο. Ως ομάδα ελέγχου χρησιμοποιήθηκαν τα πειραματόζωα του προηγούμενου πειράματος (σύνολο 15 πειραματόζωα). Συνολικά δέκα οχτώ εξ αυτών (n=18/27, 66,67%, μέσο βάρος=3,07±0,29 Kg) έλαβαν Παρστατίνη ακριβώς 15 λεπτά προ της έναρξης εγχύσεως του ΣΜ σε διάλυμα 1ml συνολικού διαλύματος, το οποίο αντιστοιχούσε σε συνολική ποσότητα 10 μg/kg συνολικής δραστικής ουσίας (Ομάδα δοκιμής - Group P 10 ). Η χορήγηση της υπό δοκιμής ουσίας γινόταν διαμέσο της ωτιαίας φλέβας. Εν συνεχεία πραγματοποιήθηκε δια της ωτιαίας φλέβας ενδοφλέβια έγχυση ΙΣΜ αντίστοιχης ποσότητας με τα προκαταρκτικά πειράματα (ποσότητα τέτοια ώστε να αντιστοιχεί σε συγκέντρωση 10 γραμμαρίων Ιωδίου ανά χιλιόγραμμο βάρους) διατηρώντας τις ίδιες πειραματικές συνθήκες με προηγουμένως. Στα υπόλοιπα πειραματόζωα χορηγήθηκαν διαφορετικές δόσεις της υπό δοκιμής ουσίας ως εξής: Μία υπό-ομάδα τεσσάρων πειραματόζωων (n=4/27, 14,81%, μέσο βάρος=2,99±0,24 Kg) έλαβε δόση ίση με 100 μg/kg (Group P 100, Parstatin=100 μg/kg) και μία ομάδα πέντε πειραματόζωων (n=5/27, 18,52%, μέσο βάρος=3,02±0,14 Kg) έλαβε δόση ίση με 1 μg/kg (Group P 1, Parstatin=1 μg/kg). Η κατανομή των πειραματόζωων στις υπό-ομάδες φαίνεται στο Γράφημα 2. Γράφημα 2. 82

83 Γράφημα 2: Το γράφημα απεικονίζει αναλυτικά τον τρόπο με τον οποίο σχεδιάστηκε το μέρος ΙΙ της ερευνητικής εργασίας. Οι ομάδες που περιελάμβαναν μία ομάδα ελέγχου καθώς και τρείς υπό-ομάδες διαφόρων δόσεων της υπό δοκιμής ουσίας Παρστατίνης αναισθησία. Το σύνολο των πειραματόζωων ανάρρωσαν χωρίς προβλήματα από την Η ενδοφλέβια χορήγηση της υπό δοκιμή ουσίας (Παρστατίνης) άπαξ 15 λεπτά προ της εγχύσεως ενδοφλεβίως ΙΣΜ (Iopromide) είχε ως αποτέλεσμα την διατήρηση της διάμεσης τιμής της κρεατινίνης ορού σε επίπεδα κοντά σε αυτά της ομάδας των 83

84 φυσιολογικών κονίκλων (1.01 mg/dl, CI: ) 48 ώρες μετά την χορήγηση του ΙΣΜ. Η σύγκριση των διάμεσων τιμών της κρεατινίνης της ομάδας ελέγχου με την ομάδα που έλαβε θεραπεία με Παρστατίνη σε δόση 10 μg/kg ανέδειξε την στατιστικά σημαντική διαφορά μεταξύ των δύο (3.09 mg/dl, CI: έναντι 1.01 mg/dl, CI: ; p = 0.012). Ωστόσο, το θεραπευτικό αυτό αποτέλεσμα που αναδείχτηκε με την χορήγηση της ανωτέρω δόσης της Παρστατίνης φαίνεται να μειώνεται σημαντικά ή ακόμα και να εξαλείφεται πλήρως με τον δεκαπλασιασμό ή υποδεκαπλασιασμό της δόσης αναδεικνύοντας μία σαφώς δόσο-εξαρτώμενη σχέση του φαινομένου. Αναλυτικά τα αποτελέσματα καθώς και οι συγκρίσεις μεταξύ των τιμών των διαφόρων υπό-ομάδων της Παρστατίνης με την ομάδα ελέγχου παρουσιάζονται στον Πίνακα 5. Το Γράφημα 3 απεικονίζει την κατανομή των τιμών της κρεατινίνης των διαφόρων υπό-ομάδων που έλαβαν την υπό δοκιμή ουσία καθώς και των τιμών κρεατινίνης της ομάδας ελέγχου και των φυσιολογικών κονίκλων. 84

85 Γράφημα 3. Γράφημα 3. Κατανομή των τιμών της κρεατινίνης ορού (scr) μεταξύ των διάφορων υπό-ομάδων που χρησιμοποιήθηκαν στη σειρά αυτή των πειραμάτων. 85

86 Πίνακας 5: Αναλυτική παρουσίαση των τιμών της κρεατινίνης ορού (scr) scr (mg/dl), medians CI (25%-75%) P value SHAM CIN-Control έναντι CIN CI: έναντι 0.90 CI: CIN-Control έναντι CIN-P CI: έναντι 8.80 CI: P 10 CIN-Control έναντι CIN CI: έναντι 1.01 CI: CIN-P 100 CIN-Control έναντι CIN-P CI: έναντι 6.55 CI: Πίνακας 5: Σύγκριση των διάμεσων τιμών της κρεατινίνης ορού των υπόομάδων που έλαβαν προστατευτικές δόσεις Παρστατίνης, καθώς και των φυσιολογικών κονίκλων με την ομάδα ελέγχου. Θέλοντας να δώσουμε μία πιο κλινική κατεύθυνση στην ερμηνεία των αποτελεσμάτων και θέτοντας ως κατώφλι το 1,5 mg/dl σαν σημείο αναφοράς παρουσίας κλινικά σημαντικής νεφροτοξικότητας, η πλειονότητα των πειραματόζωων της ομάδας ελέγχου (n=13/15, 86,7%) ανέπτυξαν ΝΣΜ μετά από 48 ώρες παρακολούθηση. Το αντίστοιχο ποσοστό στην ομάδα που έλαβε προστατευτική χορήγηση Παρστατίνης (δόση 10μg/Kg) ήταν σαφώς και στατιστικά 86

87 σημαντικά μικρότερο (n=5/18, 27,8% έναντι n=13/15, 86,7%, p<0,001). Αναλυτική παρουσίαση των αποτελεσμάτων βάση του κριτηρίου της τιμής κρεατινίνης άνω του 1,5mg/dl μετά από 48 ώρες γίνεται στο Πίνακα 6. Το όφελος αυτό φαίνεται πάλι να μην παρατηρείται με τον δεκαπλασιασμό ή τον υποδεκαπλασιασμό της ανωτέρο δόσης. (Το Γράφημα 4 παρουσιάζει τα ανωτέρω) Πίνακας 6. Ποσοστά εμφάνισης κλινικά σημαντικής ΝΣΜ ΝΣΜ (CIN, scr> 1.5mg/dl) P value CIN-Control έναντι CIN-SHAM 86.7% (13/15) έναντι 0.0% (0/7) <0.001 CIN-Control έναντι CIN-P % (13/15) έναντι 80.0% (4/5) CIN-Control έναντι CIN-P % (13/15) έναντι 27.8% (5/18) <0.001 CIN-Control έναντι CIN-P % (13/15) έναντι 100% (4/4) Πίνακας 6: Σύγκριση των ποσοστών ανάπτυξης κλινικά σημαντικής ΝΣΜ λαμβάνοντας ως όριο το κατώφλι τιμής κρεατινίνης ορού άνω του 1,5 mg/dl, 48 ώρες μετά την ενδοφλέβια έγχυση ΙΣΜ. 87

88 Γράφημα 4: Γράφημα 4: Γραφική αναπαράσταση των ανωτέρω. Απεικονίζεται η δοσολογική καμπύλη όπως προέκυψε και υπολογίστηκε από τα πειράματα. Βάση των ανωτέρω, γίνεται σαφές ότι η πλέον αποτελεσματική δόση Παρστατίνης για την αποφυγή πρόκλησης ΝΣΜ στο πειραματικό μας μοντέλο είναι η θεραπεία με 10μg ανά χιλιόγραμμο βάρους. Το θεραπευτικό αποτέλεσμα φαίνεται πως μειώνεται ή και εξαφανίζεται πλήρως τόσο με τον δεκαπλασιασμό (X10) όσο και με τον υποδεκαπλασιασμό (1/10) της αρχικής αυτής δόσης. 88


ΑΠΟΡΡΟΦΗΣΗ ΝΕΦΡΙΚΩΝ ΦΥΣΙΟΛΟΓΙΚΗ ΓΛΥΚΟΖΟΥΡΙΑ ΑΠΟΡΡΟΦΗΣΗ ΝΕΦΡΙΚΩΝ ΣΩΛΗΝΑΡΙΩΝ ΦΥΣΙΟΛΟΓΙΚΗ ΓΛΥΚΟΖΟΥΡΙΑ ΚΛΙΝΙΚΗ ΠΕΡΙΠΤΩΣΗ Γυναίκα 27 ετών, κατά την 26η εβδομάδα κύησης, επισκέπτεται τον γυναικολόγο της στα πλαίσια προγεννητικού ελέγχου. Έχει ελεύθερο

Διαβάστε περισσότερα

Επεμβατική Ακτινολογία: Η εναλλακτική σου στη χειρουργική

Επεμβατική Ακτινολογία: Η εναλλακτική σου στη χειρουργική Επεμβατική Ακτινολογία Ενημέρωση Ασθενών Επεμβατική Ακτινολογία: Η εναλλακτική σου στη χειρουργική Τα τελευταία 20 χρόνια, η Επεμβατική Ακτινολογία παρουσιάζει διαρκή εξέλιξη και αποτελεί μία πολύτιμη

Διαβάστε περισσότερα



Διαβάστε περισσότερα


ΩΣΜΩΣΗ ΚΑΙ ΟΙ ΝΕΦΡΟΙ ΩΣΜΩΣΗ ΚΑΙ ΟΙ ΝΕΦΡΟΙ ΠΩΣ ΜΕΤΑΦΕΡΟΝΤΑΙ ΟΙ ΟΥΣΙΕΣ ΣΤΑ ΥΓΡΑ Μεταφορά τροφών και αποβολή μη χρήσιμων ουσιών: Διάχυση (π.χ. το CO 2 που παράγεται κατά τον μεταβολισμό των κυττάρων, διαχέεται από τα κύτταρα

Διαβάστε περισσότερα

ηλικία περιεκτικότητα σε λίπος φύλο

ηλικία περιεκτικότητα σε λίπος φύλο ΥΓΡΑ ΤΟΥ ΣΩΜΑΤΟΣ Το ύδωρ αποτελεί το 60% του βάρους σώματος α) από την ηλικία (νεογνά 75%) β) περιεκτικότητα σε λίπος (ο λιπώδης ιστός έχει μικρή περιεκτικότητα σε ύδωρ) γ) το φύλο ( το ύδωρ είναι λιγότερο

Διαβάστε περισσότερα



Διαβάστε περισσότερα

Εφαρμογές αρχών φαρμακολογίας

Εφαρμογές αρχών φαρμακολογίας Εφαρμογές αρχών φαρμακολογίας Χριστίνα Δάλλα Λέκτορας Φαρμακολογίας Ιατρική Σχολή, Πανεπιστήμιο Αθηνών cdalla@med.uoa.gr www.med.uoa.gr/pharmacology Ισχύς (potency) ενός φαρμάκου (συνήθως εκφράζεται σε

Διαβάστε περισσότερα


ΚΑΡΔΙΟΤΟΞΙΚΟΤΗΤΑ ΧΗΜΕΙΟΘΕΡΑΠΕΥΤΙΚΩΝ ΦΑΡΜΑΚΩΝ ΚΑΡΔΙΟΤΟΞΙΚΟΤΗΤΑ ΧΗΜΕΙΟΘΕΡΑΠΕΥΤΙΚΩΝ ΦΑΡΜΑΚΩΝ Άννα Ιµπρισίµη, ΤΕ Νοσηλεύτρια, Δ Παθολογική κλινική, ΓΝΘ «Ιπποκράτειο» Δάφνη Μαυροπούλου, ΤΕ Νοσηλεύτρια, Δ Παθολογική κλινική, ΓΝΘ «Ιπποκράτειο» Ελένη Καλαϊτζή,

Διαβάστε περισσότερα

Κανένα για αυτήν την παρουσίαση. Εκπαιδευτικές-ερευνητικές-συμβουλευτικές επιχορηγήσεις την τελευταία διετία: Abbvie,Novartis, MSD, Angelini,

Κανένα για αυτήν την παρουσίαση. Εκπαιδευτικές-ερευνητικές-συμβουλευτικές επιχορηγήσεις την τελευταία διετία: Abbvie,Novartis, MSD, Angelini, Κανένα για αυτήν την παρουσίαση Εκπαιδευτικές-ερευνητικές-συμβουλευτικές επιχορηγήσεις την τελευταία διετία: Abbvie,Novartis, MSD, Angelini, 2 Κυκλοσπορίνη-θεραπευτικές ενδείξεις 3 Θεραπεία σοβαρών μορφών

Διαβάστε περισσότερα

Νοσηλευτικά Πρωτόκολλα διαχείρισης καρδιολογικών ασθενών στην εξωνεφρική κάθαρση. Μονάδα Τεχνητού Νεφρού ΠΓΝ «Αττικόν», Αθήνα

Νοσηλευτικά Πρωτόκολλα διαχείρισης καρδιολογικών ασθενών στην εξωνεφρική κάθαρση. Μονάδα Τεχνητού Νεφρού ΠΓΝ «Αττικόν», Αθήνα Νοσηλευτικά Πρωτόκολλα διαχείρισης καρδιολογικών ασθενών στην εξωνεφρική κάθαρση { Μονάδα Τεχνητού Νεφρού ΠΓΝ «Αττικόν», Αθήνα Το νοσηλευτικό έργο στις ΜΤΝ Σκοπός της η παροχή εξειδικευµένης φροντίδας

Διαβάστε περισσότερα

ΔΕΙΚΤΕΣ ΝΕΦΡΙΚΗΣ ΛΕΙΤΟΥΡΓΙΑΣ. Λ.Β. Αθανασίου. Παθολογική Κλινική, Τμήμα Κτηνιατρικής, ΠΘ

ΔΕΙΚΤΕΣ ΝΕΦΡΙΚΗΣ ΛΕΙΤΟΥΡΓΙΑΣ. Λ.Β. Αθανασίου. Παθολογική Κλινική, Τμήμα Κτηνιατρικής, ΠΘ ΔΕΙΚΤΕΣ ΝΕΦΡΙΚΗΣ ΛΕΙΤΟΥΡΓΙΑΣ Λ.Β. Αθανασίου Παθολογική Κλινική, Τμήμα Κτηνιατρικής, ΠΘ ΧΡΗΣΙΜΟΤΗΤΑ ΔΕΙΚΤΩΝ Διαπίστωση της νεφρικής βλάβης/ νεφροτοξική δράση φαρμάκων Εντόπιση της βλάβης Πρόγνωση Αξιολόγηση

Διαβάστε περισσότερα

Παράρτημα ΙΙΙ Τροποποιήσεις στις σχετικές παραγράφους της περίληψης των χαρακτηριστικών του προϊόντος και του φύλλου οδηγιών χρήσης

Παράρτημα ΙΙΙ Τροποποιήσεις στις σχετικές παραγράφους της περίληψης των χαρακτηριστικών του προϊόντος και του φύλλου οδηγιών χρήσης Παράρτημα ΙΙΙ Τροποποιήσεις στις σχετικές παραγράφους της περίληψης των χαρακτηριστικών του προϊόντος και του φύλλου οδηγιών χρήσης Σημείωση: Αυτές οι τροποποιήσεις στις σχετικές παραγράφους της περίληψης

Διαβάστε περισσότερα

Ανευρύσματα Εγκεφάλου

Ανευρύσματα Εγκεφάλου Ανευρύσματα Εγκεφάλου Το εγκεφαλικό ανεύρυσμα είναι μια παθολογική διάταση σε ένα μέρος του τοιχώματος ενός αγγείου του εγκεφάλου που οφείλεται σε ένα έλλειμμα του μέσου χιτώνα του τοιχώματος του αγγείου.

Διαβάστε περισσότερα

Αθήνα 12 Μαρτίου 2013 ΔΕΛΤΙΟ ΤΥΠΟΥ

Αθήνα 12 Μαρτίου 2013 ΔΕΛΤΙΟ ΤΥΠΟΥ ΕΛΛΗΝΙΚΗ ΝΕΦΡΟΛΟΓΙΚΗ ΕΤΑΙΡΕΙΑ ΜΑΙΑΝΔΡΟΥ 15 11528 ΑΘΗΝΑ ΤΗΛ.: 2107298586 FAX: 2107237705 e-mail: nefreter@otenet.gr HELLENIC SOCIETY OF NEPHROLOGY 15 MEANDROU STR. ATHENS, 11528 GREECE TEL.: (+3021) 07298586

Διαβάστε περισσότερα

Φυσιολογία-Ι. Ουροποιητικό σύστημα. Ισοζύγιο νερού και ηλεκτρολυτών. Β. Στεργίου Μιχαηλίδου Επίκουρη Καθηγήτρια Εργ. Πειραματικής Φυσιολογίας

Φυσιολογία-Ι. Ουροποιητικό σύστημα. Ισοζύγιο νερού και ηλεκτρολυτών. Β. Στεργίου Μιχαηλίδου Επίκουρη Καθηγήτρια Εργ. Πειραματικής Φυσιολογίας Φυσιολογία-Ι Ουροποιητικό σύστημα Ισοζύγιο νερού και ηλεκτρολυτών Β. Στεργίου Μιχαηλίδου Επίκουρη Καθηγήτρια Εργ. Πειραματικής Φυσιολογίας Κύριες λειτουργίες των νεφρών Ρύθμιση του όγκου των υγρών του

Διαβάστε περισσότερα


ΠΑΖΑΪΥΟΥ-ΠΑΝΑΓΙΩΤΟΥ Κ. Γιατί μας απασχολεί Ο σακχαρώδης διαβήτης τύπου 1 και 2 συνοδεύονται από μικρο και μακροαγγειακές επιπλοκές Σημαντικότερη αιτία νοσηρότητας και θνητότητας του διαβητικού πληθυσμού Ο κίνδυνος για καρδιαγγειακή

Διαβάστε περισσότερα

ΜΕΤΑΜΟΣΧΕΥΣΗ ΝΕΦΡΟΥ. Λειτουργία των νεφρών. Συμπτώματα της χρόνιας νεφρικής ανεπάρκειας

ΜΕΤΑΜΟΣΧΕΥΣΗ ΝΕΦΡΟΥ. Λειτουργία των νεφρών. Συμπτώματα της χρόνιας νεφρικής ανεπάρκειας ΜΕΤΑΜΟΣΧΕΥΣΗ ΝΕΦΡΟΥ Η χρόνια νεφρική ανεπάρκεια είναι η προοδευτική, μη αναστρέψιμη μείωση της νεφρικής λειτουργίας, η οποία προκαλείται από βλάβη του νεφρού ποικίλης αιτιολογίας. Η χρόνια νεφρική ανεπάρκεια

Διαβάστε περισσότερα

Περιεχόμενα. 1. Εισαγωγή Εισαγωγή Σημασία των νεφρών στη ζωή Βιβλιογραφία Δομή και λειτουργία των νεφρών...

Περιεχόμενα. 1. Εισαγωγή Εισαγωγή Σημασία των νεφρών στη ζωή Βιβλιογραφία Δομή και λειτουργία των νεφρών... Περιεχόμενα 1. Εισαγωγή... 1 1. Εισαγωγή... 1 2. Σημασία των νεφρών στη ζωή... 4 3. Βιβλιογραφία... 6 2. Δομή και λειτουργία των νεφρών... 7 1. Εισαγωγή... 8 2. Νεφρικά αγγεία... 9 3. Νεφρικό σπείραμα...

Διαβάστε περισσότερα

Συµπύκνωση αραίωση ούρων

Συµπύκνωση αραίωση ούρων Συµπύκνωση αραίωση ούρων Boron σελ 1075-1091 Συµπυκνωµένα ούρα υπερωσµωτικά σε σχέση µε τη συγκέντρωση του πλάσµατος Η ικανότητα των νεφρών να παράγουν υπερωσµωτικά ούρα αποτελεί καθοριστικό παράγοντα

Διαβάστε περισσότερα

Αξονική στεφανιογραφία σε ασθενείς μετά από αορτοστεφανιαία παράκαμψη

Αξονική στεφανιογραφία σε ασθενείς μετά από αορτοστεφανιαία παράκαμψη Αξονική στεφανιογραφία σε ασθενείς μετά από αορτοστεφανιαία παράκαμψη Φώτιος Λάσπας Ακτινοδιαγνώστης Τμήμα Αξονικού-Μαγνητικού Τομογράφου Νοσοκομείο «Υγεία» Εισαγωγή Η αορτοστεφανιαία παράκαμψη αποτελεί

Διαβάστε περισσότερα


ΜΗΧΑΝΙΣΜΟΙ ΚΥΤΤΑΡΙΚΗΣ ΜΕΤΑΦΟΡΑΣ ΚΑΙ ΔΙΑΠΕΡΑΤΟΤΗΤΑ ΜΗΧΑΝΙΣΜΟΙ ΚΥΤΤΑΡΙΚΗΣ ΜΕΤΑΦΟΡΑΣ ΚΑΙ ΔΙΑΠΕΡΑΤΟΤΗΤΑ Διάχυση Η διάχυση είναι το κύριο φαινόμενο με το οποίο γίνεται η παθητική μεταφορά διαμέσου ενός διαχωριστικού φράγματος Γενικά στη διάχυση ένα αέριο ή

Διαβάστε περισσότερα


ΑΠΟΡΡΟΦΗΣΗ ΝΕΦΡΙΚΩΝ ΦΥΣΙΟΛΟΓΙΚΗ ΓΛΥΚΟΖΟΥΡΙΑ ΑΠΟΡΡΟΦΗΣΗ ΝΕΦΡΙΚΩΝ ΣΩΛΗΝΑΡΙΩΝ ΦΥΣΙΟΛΟΓΙΚΗ ΓΛΥΚΟΖΟΥΡΙΑ ΚΛΙΝΙΚΗ ΠΕΡΙΠΤΩΣΗ Γυναίκα 27 ετών, κατά την 26η εβδομάδα κύησης, επισκέπτεται τον γυναικολόγο της στα πλαίσια προγεννητικού ελέγχου. Έχει ελεύθερο

Διαβάστε περισσότερα

Ε Ν Η Μ Ε Ρ Ω Σ Ο Υ. νεφρά

Ε Ν Η Μ Ε Ρ Ω Σ Ο Υ. νεφρά Ε Ν Η Μ Ε Ρ Ω Σ Ο Υ νεφρά νεφρών Η υψηλή αρτηριακή πίεση (υπέρταση) είναι ένα από τα δύο κύρια αίτια χρόνιας νεφρικής νόσου παγκοσμίως (το άλλο είναι ο διαβήτης). Επίσης, τα νεφρά έχουν βασικό ρόλο στη

Διαβάστε περισσότερα

ΠΝΕΥΜΟΝΙΚΗ ΥΠΕΡΤΑΣΗ ΣΕ. Παρουσίαση περιστατικού. ΑΜΕΘ Γ.Ν.Θ. «Γ. Παπανικολάου»

ΠΝΕΥΜΟΝΙΚΗ ΥΠΕΡΤΑΣΗ ΣΕ. Παρουσίαση περιστατικού. ΑΜΕΘ Γ.Ν.Θ. «Γ. Παπανικολάου» ΠΝΕΥΜΟΝΙΚΗ ΥΠΕΡΤΑΣΗ ΣΕ ARDS - ΑΝΤΙΜΕΤΩΠΙΣΗ ΜΕ ΝΟ Παρουσίαση περιστατικού ΑΜΕΘ Γ.Ν.Θ. «Γ. Παπανικολάου» Παρουσίαση περιστατικού Από τον απεικονιστικό έλεγχο διαπιστώθηκαν: κατάγµατα λεκάνης και δεξιού άνω

Διαβάστε περισσότερα



Διαβάστε περισσότερα

Συστηματικός ερυθηματώδης λύκος: το πρότυπο των αυτόάνοσων ρευματικών νοσημάτων

Συστηματικός ερυθηματώδης λύκος: το πρότυπο των αυτόάνοσων ρευματικών νοσημάτων Συστηματικός ερυθηματώδης λύκος: το πρότυπο των αυτόάνοσων ρευματικών νοσημάτων Φ.Ν. Σκοπούλη Καθηγήτρια τον Χαροκόπειου Πανεπιστημίου Αθηνών συστηματικός ερυθηματώδης λύκος θεωρείται η κορωνίδα των αυτοάνοσων

Διαβάστε περισσότερα



Διαβάστε περισσότερα



Διαβάστε περισσότερα


ΚΛΙΝΙΚΗ ΠΕΡΙΠΤΩΣΗ Αναστολή αντλίας πρωτονίων ΦΥΣΙΟΛΟΓΙΑ ΚΥΤΤΑΡΙΚΗΣ ΜΕΜΒΡΑΝΗΣ ΚΛΙΝΙΚΗ ΠΕΡΙΠΤΩΣΗ Αναστολή αντλίας πρωτονίων ΦΥΣΙΟΛΟΓΙΑ ΚΥΤΤΑΡΙΚΗΣ ΜΕΜΒΡΑΝΗΣ Περιγραφή της περίπτωσης Άνδρας 43 ετών εισάγεται σε κλινική λόγω επιγαστραλγίας. Μετά από έλεγχο ετέθη η διάγνωση του πεπτικού

Διαβάστε περισσότερα

Τα οφέλη της λαπαροσκοπικής χολοκυστεκτομής στην πράξη - Ο Δρόμος για την Θεραπεία Δευτέρα, 27 Δεκέμβριος :17

Τα οφέλη της λαπαροσκοπικής χολοκυστεκτομής στην πράξη - Ο Δρόμος για την Θεραπεία Δευτέρα, 27 Δεκέμβριος :17 Απαντά ο κ. Θεμιστοκλής Ευκαρπίδης, Γενικός Χειρουργός Ίσως λίγοι από εμάς να είμαστε ενημερωμένοι για τη σπουδαία εργασία που εκτελεί στο σώμα μας, ένα από τα όργανα του, η χοληδόχος κύστη. Εκεί μέσα

Διαβάστε περισσότερα


ΜΗΧΑΝΙΣΜΟΙ ΚΥΤΤΑΡΙΚΗΣ ΜΕΤΑΦΟΡΑΣ ΚΥΤΤΑΡΙΚΗ ΔΙΑΠΕΡΑΤΟΤΗΤΑ ΜΗΧΑΝΙΣΜΟΙ ΚΥΤΤΑΡΙΚΗΣ ΜΕΤΑΦΟΡΑΣ ΚΥΤΤΑΡΙΚΗ ΔΙΑΠΕΡΑΤΟΤΗΤΑ Προσοµοίωση Είναι γνωστό ότι η εξάσκηση των φοιτητών σε επίπεδο εργαστηριακών ασκήσεων, µε χρήση των κατάλληλων πειραµατοζώων, οργάνων και αναλωσίµων

Διαβάστε περισσότερα


ΦΑΡΜΑΚΑ ΚΑΙ ΝΕΦΡΟΣ ΣΧΟΛΙΑ ΤΩΝ ΔΙΑΦΑΝΕΙΩΝ ΦΑΡΜΑΚΑ ΚΑΙ ΝΕΦΡΟΣ ΣΧΟΛΙΑ ΤΩΝ ΔΙΑΦΑΝΕΙΩΝ 1 η διαφάνεια 2 η διαφάνεια Στη διαφάνεια αυτή φαίνονται οι νεφροί, η κοιλιακή αορτή με τη νεφρική αρτηρία, η κάτω κοίλη φλέβα με τη νεφρική φλέβα και οι ουρητήρες

Διαβάστε περισσότερα

www.cirse.org Επεμβατική Ογκολογία Ενημέρωση Ασθενών Επεμβατική Ακτινολογία: Η εναλλακτική σου στη χειρουργική

www.cirse.org Επεμβατική Ογκολογία Ενημέρωση Ασθενών Επεμβατική Ακτινολογία: Η εναλλακτική σου στη χειρουργική Επεμβατική Ογκολογία Ενημέρωση Ασθενών Επεμβατική Ακτινολογία: Η εναλλακτική σου στη χειρουργική www.cirse.org Cardiovascular and Interventional Radiological Society of Europe Cardiovascular and Interventional

Διαβάστε περισσότερα

Διαλύματα - Περιεκτικότητες διαλυμάτων Γενικά για διαλύματα

Διαλύματα - Περιεκτικότητες διαλυμάτων Γενικά για διαλύματα Διαλύματα - Περιεκτικότητες διαλυμάτων Γενικά για διαλύματα Μάθημα 6 6.1. SOS: Τι ονομάζεται διάλυμα, Διάλυμα είναι ένα ομογενές μίγμα δύο ή περισσοτέρων καθαρών ουσιών. Παράδειγμα: Ο ατμοσφαιρικός αέρας

Διαβάστε περισσότερα

Τα αποτελέσματά μας δεν αποτελούν ελεγχόμενη μελέτη ή κλινική δοκιμή, αλλά στοιχεία μητρώου των ασθενών μας.

Τα αποτελέσματά μας δεν αποτελούν ελεγχόμενη μελέτη ή κλινική δοκιμή, αλλά στοιχεία μητρώου των ασθενών μας. CUMMULATINE SUCCESS SCORE % ΙΣΧΙΟ CUMMULATINE SUCCESS RATE % YΛΙΚΟ ΠΡΩΤΟΚΟΛΛΟΥ ΑΣΘΕΝΕΙΣ 42 ΑΝΔΡΕΣ 16 ΓΥΝΑΙΚΕΣ 26 ΗΛΙΚΙΑ 63.1 (42-92) ΥΨΟΣ 171 (162-191) Δ.Μ.Σ 36 (22-47) Το ποσοστό των ασθενών που αναφέρουν

Διαβάστε περισσότερα



Διαβάστε περισσότερα

Διαγνωστική και Θεραπευτική προσέγγιση του ασθενή με Μεταβολική Οξέωση

Διαγνωστική και Θεραπευτική προσέγγιση του ασθενή με Μεταβολική Οξέωση Διαγνωστική και Θεραπευτική προσέγγιση του ασθενή με Μεταβολική Οξέωση Ευγενία Γκαλιαγκούση MD, PhD Β Προπαιδευτική Παθολογική Κλινική Αριστοτέλειο Πανεπιστήμιο Θεσσαλονίκης Διαγνωστική και Θεραπευτική

Διαβάστε περισσότερα


ΓΥΜΝΑΣΙΟ ΑΓΛΑΝΤΖΙΑΣ Σχολική Χρονιά ΓΡΑΠΤΕΣ ΠΡΟΑΓΩΓΙΚΕΣ ΕΞΕΤΑΣΕΙΣ ΙΟΥΝΙΟΥ 2015 ΜΑΘΗΜΑ: ΧΗΜΕΙΑ - ΤΑΞΗ Β. Ονοματεπώνυμο μαθητή/τριας:... ΓΥΜΝΑΣΙΟ ΑΓΛΑΝΤΖΙΑΣ Σχολική Χρονιά 2014-2015 ΓΡΑΠΤΕΣ ΠΡΟΑΓΩΓΙΚΕΣ ΕΞΕΤΑΣΕΙΣ ΙΟΥΝΙΟΥ 2015 ΜΑΘΗΜΑ: ΧΗΜΕΙΑ - ΤΑΞΗ Β Ονοματεπώνυμο μαθητή/τριας:... Τμήμα:... :... Βαθμός/Ολογράφως:... Χρόνος: 2 ώρες Φυσική

Διαβάστε περισσότερα



Διαβάστε περισσότερα

Κωνσταντίνος Τζιόμαλος Επίκουρος Καθηγητής Παθολογίας Α Προπαιδευτική Παθολογική Κλινική ΑΠΘ, Νοσοκομείο ΑΧΕΠΑ

Κωνσταντίνος Τζιόμαλος Επίκουρος Καθηγητής Παθολογίας Α Προπαιδευτική Παθολογική Κλινική ΑΠΘ, Νοσοκομείο ΑΧΕΠΑ Στατίνες στην πρωτογενή πρόληψη Κωνσταντίνος Τζιόμαλος Επίκουρος Καθηγητής Παθολογίας Α Προπαιδευτική Παθολογική Κλινική ΑΠΘ, Νοσοκομείο ΑΧΕΠΑ Πρόληψη καρδιαγγειακών νοσημάτων Πρωτογενής πρόληψη : το σύνολο

Διαβάστε περισσότερα

ΑΚΤΙΝΟΛΟΓΙΚΗ ΟΡΟΛΟΓΙΑ. Φονταρά Σοφία, Ιατρός Ακτινολόγος Πανεπιστημιακός Υπότροφος Ά Εργαστήριο Ακτινολογίας Πανεπιστημίου Αθηνών

ΑΚΤΙΝΟΛΟΓΙΚΗ ΟΡΟΛΟΓΙΑ. Φονταρά Σοφία, Ιατρός Ακτινολόγος Πανεπιστημιακός Υπότροφος Ά Εργαστήριο Ακτινολογίας Πανεπιστημίου Αθηνών ΑΚΤΙΝΟΛΟΓΙΚΗ ΟΡΟΛΟΓΙΑ Φονταρά Σοφία, Ιατρός Ακτινολόγος Πανεπιστημιακός Υπότροφος Ά Εργαστήριο Ακτινολογίας Πανεπιστημίου Αθηνών Η πρώτη ακτινογραφία μέλους ανθρώπινου σώματος. Είναι το χέρι της κυρίας

Διαβάστε περισσότερα

Ο ρόλος της υπερδιήθησης στο Καρδιονεφρικό Σύνδροµο.! Ιωάννης Μακρής Νοσηλευτής MSc Μ.Τ.Ν. ΓΝΑ «Ιπποκράτειο»

Ο ρόλος της υπερδιήθησης στο Καρδιονεφρικό Σύνδροµο.! Ιωάννης Μακρής Νοσηλευτής MSc Μ.Τ.Ν. ΓΝΑ «Ιπποκράτειο» Ο ρόλος της υπερδιήθησης στο Καρδιονεφρικό Σύνδροµο Ιωάννης Μακρής Νοσηλευτής MSc Μ.Τ.Ν. ΓΝΑ «Ιπποκράτειο» Καρδιονεφρικό Σύνδροµο (CRS) Ορισµός Οι διαταραχές της καρδιάς και των νεφρών, όπου οξεία ή χρόνια

Διαβάστε περισσότερα

Από: Ελληνικό Ίδρυμα Ρευματολογικών Ερευνών

Από: Ελληνικό Ίδρυμα Ρευματολογικών Ερευνών Από: Ελληνικό Ίδρυμα Ρευματολογικών Ερευνών Οι ρευματικές παθήσεις είναι συχνές στην αναπαραγωγική ηλικία των γυναικών. Στην πρόσφατη πανελλήνια επιδημιολογική έρευνα για τις ρευματικές παθήσεις στο γενικό

Διαβάστε περισσότερα



Διαβάστε περισσότερα

Ηλεκτρολυτικές διαταραχές των αλκοολικών. Γεώργιος Τουλκερίδης, Νεφρολόγος, Γενικό Νοσοκομείο Λάρνακας, Κύπρος

Ηλεκτρολυτικές διαταραχές των αλκοολικών. Γεώργιος Τουλκερίδης, Νεφρολόγος, Γενικό Νοσοκομείο Λάρνακας, Κύπρος Ηλεκτρολυτικές διαταραχές των αλκοολικών Γεώργιος Τουλκερίδης, Νεφρολόγος, Γενικό Νοσοκομείο Λάρνακας, Κύπρος Αλκοολισμός Διαταραχή από χρήση αλκοόλ (αιθανόλη C 2 H 6 O) 208.000.000 αλκοολικοί σε όλο τον

Διαβάστε περισσότερα

Κορίτσι 20 ετών προσήλθε εξαιτίας εκούσιας λήψης 20 tb παρακεταμόλης (10γρ.) και 30 tb βαλεριάνας Aναφέρεται ταυτόχρονη λήψη αλκοόλ Λήψη ουσιών δύο

Κορίτσι 20 ετών προσήλθε εξαιτίας εκούσιας λήψης 20 tb παρακεταμόλης (10γρ.) και 30 tb βαλεριάνας Aναφέρεται ταυτόχρονη λήψη αλκοόλ Λήψη ουσιών δύο ΤΟΥΛΟΥΜΤΖΗ ΜΑΡΙΑ Κορίτσι 20 ετών προσήλθε εξαιτίας εκούσιας λήψης 20 tb παρακεταμόλης (10γρ.) και 30 tb βαλεριάνας Aναφέρεται ταυτόχρονη λήψη αλκοόλ Λήψη ουσιών δύο ώρες πριν την προσέλευση Αίσθημα ζάλης

Διαβάστε περισσότερα

Γράφει: Ευθυμία Πετράτου, Ειδική Παθολόγος, Υπεύθυνη Ιατρείου Διαταραχής Λιπιδίων, Ιατρικού Π. Φαλήρου

Γράφει: Ευθυμία Πετράτου, Ειδική Παθολόγος, Υπεύθυνη Ιατρείου Διαταραχής Λιπιδίων, Ιατρικού Π. Φαλήρου Γράφει: Ευθυμία Πετράτου, Ειδική Παθολόγος, Υπεύθυνη Ιατρείου Διαταραχής Λιπιδίων, Ιατρικού Π. Φαλήρου Οι δυσλιπιδαιμίες είναι παθολογικές καταστάσεις με διαταραχές των λιπιδίων του αίματος ποσοτικές αλλά

Διαβάστε περισσότερα



Διαβάστε περισσότερα



Διαβάστε περισσότερα

ΣΕΝΑΡΙΟ 1 Παρουσία σε ιατρική εξέταση - Εβδομάδα: 15/9/2014-19/9/2014 Ώρα ΔΕΥΤΕΡΑ ΤΡΙΤΗ ΤΕΤΑΡΤΗ ΠΕΜΠΤΗ ΠΑΡΑΣΚΕΥΗ

ΣΕΝΑΡΙΟ 1 Παρουσία σε ιατρική εξέταση - Εβδομάδα: 15/9/2014-19/9/2014 Ώρα ΔΕΥΤΕΡΑ ΤΡΙΤΗ ΤΕΤΑΡΤΗ ΠΕΜΠΤΗ ΠΑΡΑΣΚΕΥΗ ΑΝΑΛΥΤΙΚΟ ΩΡΟΛΟΓΙΟ ΠΡΟΓΡΑΜΜΑ ΙΑΤΡΙΚΗΣ ΣΧΟΛΗΣ ΦΑΣΗΣ ΙΙ 1 ος ΧΡΟΝΟΣ Χειμερινό Εξάμηνο 9 πμ-10πμ ΣΕΝΑΡΙΟ 1 σε ιατρική εξέταση - Εβδομάδα: 15/9/2014-19/9/2014 «Ιατρική Εξέταση» Ανατομική ορολογία (Ανατομία)

Διαβάστε περισσότερα

Το Xarelto είναι φάρμακο που περιέχει τη δραστική ουσία ριβαροξαβάνη. Διατίθεται σε μορφή δισκίων (2,5, 10, 15 και 20 mg).

Το Xarelto είναι φάρμακο που περιέχει τη δραστική ουσία ριβαροξαβάνη. Διατίθεται σε μορφή δισκίων (2,5, 10, 15 και 20 mg). EMA/230698/2013 EMEA/H/C/000944 Περίληψη EPAR για το κοινό ριβαροξαβάνη Το παρόν έγγραφο αποτελεί σύνοψη της Ευρωπαϊκής Δημόσιας Έκθεσης Αξιολόγησης (EPAR) του. Επεξηγεί τον τρόπο με τον οποίο η Επιτροπή

Διαβάστε περισσότερα

Φλεγμονωδης πολυσυστηματικη αυτόάνοση νοσος που αφορα συχνοτερα νεες γυναικες αναπαραγωγικης ηλικιας.

Φλεγμονωδης πολυσυστηματικη αυτόάνοση νοσος που αφορα συχνοτερα νεες γυναικες αναπαραγωγικης ηλικιας. Φλεγμονωδης πολυσυστηματικη αυτόάνοση νοσος που αφορα συχνοτερα νεες γυναικες αναπαραγωγικης ηλικιας. Ηλίας Κουρής - Ρευματολόγος Η κλινική εικόνα της πάθησης περιλαμβάνει την παρουσια γενικων συμπτωματων

Διαβάστε περισσότερα


ΜΕΤΑΒΟΛΙΚΗ ΦΑΣΗ ΤΗΣ ΑΝΑΚΟΠΗΣ Από την καρδιοπνευμονική στην καρδιοεγκεφαλική αναζωογόνηση ΤΗΣ ΑΝΑΚΟΠΗΣ Μαρία Ι. Σεφέρου Ειδικευόμενη Καρδιολογίας Σισμανόγλειο Γ.Ν.Α. ΑΝΑΚΟΠΗ Ηλεκτρική Φάση Κυκλοφορική Φάση Μεταβολική Φάση ΕΛΛΗΝΙΚΗ

Διαβάστε περισσότερα

ΦΥΣΙΚΕΣ ΚΑΤΑΣΤΑΣΕΙΣ. Οι φυσικές καταστάσεις της ύλης είναι η στερεή, η υγρή και η αέρια.

ΦΥΣΙΚΕΣ ΚΑΤΑΣΤΑΣΕΙΣ. Οι φυσικές καταστάσεις της ύλης είναι η στερεή, η υγρή και η αέρια. ΦΥΣΙΚΕΣ ΚΑΤΑΣΤΑΣΕΙΣ Οι φυσικές καταστάσεις της ύλης είναι η στερεή, η υγρή και η αέρια. Οι μεταξύ τους μεταβολές εξαρτώνται από τη θερμοκρασία και την πίεση και είναι οι παρακάτω: ΣΗΜΕΙΟ ΤΗΞΗΣ ΚΑΙ ΣΗΜΕΙΟ

Διαβάστε περισσότερα


ΣΤΥΤΙΚΗ ΔΥΣΛΕΙΤΟΥΡΓΙΑ. ΣΤΥΤΙΚΗ ΔΥΣΛΕΙΤΟΥΡΓΙΑ. Η στυτική δυσλειτουργία είναι ένα από τα συχνότερα νοσήματα των ανδρών στην σημερινή εποχή.σε νεαρότερες ηλικίες το 30% οφείλεται σε οργανικές αιτίες και το 70 % σε ψυχολογικά αίτια

Διαβάστε περισσότερα


ΔΙΑΒΗΤΙΚΟ ΠΟΔΙ ΚΑΙ ΜΑΓΝΗΤΙΚΟΣ ΣΥΝΤΟΝΙΣΜΟΣ. Κ. ΛΥΜΠΕΡΟΠΟΥΛΟΣ Διευθυντής Γ.Ν.Α. «Γ. Γεννηματάς» ΔΙΑΒΗΤΙΚΟ ΠΟΔΙ ΚΑΙ ΜΑΓΝΗΤΙΚΟΣ ΣΥΝΤΟΝΙΣΜΟΣ Κ. ΛΥΜΠΕΡΟΠΟΥΛΟΣ Διευθυντής Γ.Ν.Α. «Γ. Γεννηματάς» ΔΙΑΒΗΤΙΚΟ ΠΟΔΙ Οι επιπλοκές του διαβήτη στον άκρο πόδα αποτελούν μια από τις συχνότερες αιτίες: νοσηρότητας,

Διαβάστε περισσότερα



Διαβάστε περισσότερα

ΠΑΘΟΦΥΣΙΟΛΟΓΙΑ ΚΑΡΙΑΚΗΣ ΑΝΕΠΑΡΚΕΙΑΣ ΕΠΕΞΗΓΗΣΗ ΟΡΩΝ ΣΤΗΝ ΚΑΡΙΑΚΗ ΑΝΕΠΑΡΚΕΙΑ Προς τα εµπρός ανεπάρκεια: αδυναµία προώθησης του αίµατος στη συστηµατική κυκλοφορία Προς τα πίσω ανεπάρκεια: αύξηση του όγκου

Διαβάστε περισσότερα

Patient Information Sheet (Greek) - Πληροφοριακό Φύλλο Ασθενών MRI - Magnetic Resonance Imaging Μαγνητική Τοµογραφία (MRI)

Patient Information Sheet (Greek) - Πληροφοριακό Φύλλο Ασθενών MRI - Magnetic Resonance Imaging Μαγνητική Τοµογραφία (MRI) Patient Information Sheet (Greek) - Πληροφοριακό Φύλλο Ασθενών MRI - Magnetic Resonance Imaging Μαγνητική Τοµογραφία (MRI) 1. Τι είναι η Μαγνητική Τοµογραφία; Η Μαγνητική Τοµογραφία (MRI) είναι µια προηγµένη

Διαβάστε περισσότερα

Πέτρος Παππάς Αναισθησιολόγος- Εντατικολόγος Επ. Α ΜΕΘ ΓΝ Νίκαιας

Πέτρος Παππάς Αναισθησιολόγος- Εντατικολόγος Επ. Α ΜΕΘ ΓΝ Νίκαιας Πέτρος Παππάς Αναισθησιολόγος- Εντατικολόγος Επ. Α ΜΕΘ ΓΝ Νίκαιας ουδεμία Κλινική Απεικονιστική Βιοχημική Ρυθμιστική λειτουργία πολλαπλών επιπέδων Επίδραση σε πολλούς δείκτες Κοινός τόπος σύγκλισης Glomerular

Διαβάστε περισσότερα



Διαβάστε περισσότερα

Όταν χρειάζεται ρύθμιση της ποσότητας των χορηγούμενων υγρών του ασθενή. Όταν θέλουμε να προλάβουμε την υπερφόρτωση του κυκλοφορικού συστήματος

Όταν χρειάζεται ρύθμιση της ποσότητας των χορηγούμενων υγρών του ασθενή. Όταν θέλουμε να προλάβουμε την υπερφόρτωση του κυκλοφορικού συστήματος Ερωτήσεις Αξιολόγησης Εργαστηριακού Μαθήματος Θέμα: «Κεντρική Φλεβική Πίεση» 1. Τι είναι η Κεντρική Φλεβική Πίεση (ΚΦΠ); Είναι η υδροστατική πίεση των μεγάλων φλεβών που είναι πλησιέστερα στην καρδιά,

Διαβάστε περισσότερα


ΕΛΛΗΝΙΚΗ ΝΕΦΡΟΛΟΓΙΚΗ ΕΤΑΙΡΕΙΑ ΕΛΛΗΝΙΚΗ ΝΕΦΡΟΛΟΓΙΚΗ ΕΤΑΙΡΕΙΑ Αθήνα 8 Μαρτίου 2011 ΔΕΛΤΙΟ ΤΥΠΟΥ Ένας στους δυο θανάτους, ασθενών με Χρόνια Νεφρική Νόσο, οφείλεται σε καρδιαγγειακό επεισόδιο και όχι στη νόσο αυτή καθ αυτή!!! Αυτό ανέφερε

Διαβάστε περισσότερα

Απεικόνιση με σκιαγραφικά μέσα

Απεικόνιση με σκιαγραφικά μέσα Απεικόνιση με σκιαγραφικά μέσα Δείτε οδηγίες για τη χορήγηση σκιαγραφικών στη διεύθυνση http://www.esur.org/contrast- media.51.0.html?&lang=gr&no_cache=1#g_sec tion_0_cover Εστιάστε στο ερωτηματολόγιο

Διαβάστε περισσότερα



Διαβάστε περισσότερα


ΦΥΛΛΟ ΟΔΗΓΙΩΝ ΧΡΗΣΗΣ: ΠΛΗΡΟΦΟΡΙΕΣ ΓΙΑ ΤΟΝ ΧΡΗΣΤΗ IRBEPRESS 75 mg, 150 mg, 300 mg δισκία Ιρβεσαρτάνη ΦΥΛΛΟ ΟΔΗΓΙΩΝ ΧΡΗΣΗΣ: ΠΛΗΡΟΦΟΡΙΕΣ ΓΙΑ ΤΟΝ ΧΡΗΣΤΗ IRBEPRESS 75 mg, 150 mg, 300 mg δισκία Ιρβεσαρτάνη Διαβάστε προσεκτικά ολόκληρο το φύλλο οδηγιών χρήσης προτού αρχίσετε να παίρνετε αυτό το φάρμακο. Φυλάξτε

Διαβάστε περισσότερα


ΦΑΣΜΑΤΟΣΚΟΠΙΚΗ ΑΝΑΛΥΣΗ ΚΑΡΩΤΙΔΩΝ ΕΠΙΔΡΑΣΗ ΣΑΚΧΑΡΟΥ ΦΑΣΜΑΤΟΣΚΟΠΙΚΗ ΑΝΑΛΥΣΗ ΚΑΡΩΤΙΔΩΝ ΕΠΙΔΡΑΣΗ ΣΑΚΧΑΡΟΥ ΧΡΙΣΤΙΝΑ ΚΑΛΟΓΕΡΟΠΟΥΛΟΥ ΑΘΗΝΑ 2010 1 ΣΚΟΠΟΣ Η ανάλυση και μελέτη της μοριακής δομής των καρωτίδων αρτηριών με υπέρυθρη φασματοσκοπία. Η εξαγωγή συμπερασμάτων

Διαβάστε περισσότερα



Διαβάστε περισσότερα

Βιολογία Α Λυκείου Κεφ. 3. Κυκλοφορικό Σύστημα. Καρδιά Αιμοφόρα αγγεία Η κυκλοφορία του αίματος Αίμα

Βιολογία Α Λυκείου Κεφ. 3. Κυκλοφορικό Σύστημα. Καρδιά Αιμοφόρα αγγεία Η κυκλοφορία του αίματος Αίμα Βιολογία Α Λυκείου Κεφ. 3 Κυκλοφορικό Σύστημα Καρδιά Αιμοφόρα αγγεία Η κυκλοφορία του αίματος Αίμα Η μεταφορά των θρεπτικών ουσιών στα κύτταρα και των ιστών και η απομάκρυνση από αυτά των άχρηστων γίνεται

Διαβάστε περισσότερα


ΧΗΜΕΙΑ Β ΓΥΜΝΑΣΙΟΥ ΕΝΟΤΗΤΑ: 1.2 ΕΝΟΤΗΤΑ: 1.2 Η ύλη συναντάται σε τρεις φυσικές καταστάσεις: Στερεή: έχει καθορισμένη μάζα, σχήμα και όγκο. Υγρή: έχει καθορισμένη μάζα και όγκο, ενώ σχήμα κάθε φορά παίρνει το σχήμα του δοχείου που το

Διαβάστε περισσότερα


ΑΛΛΕΡΓΙΑ: Ο ΑΟΡΑΤΟΣ ΕΧΘΡΟΣ ΠΩΣ ΓΙΝΕΤΑΙ ΚΑΠΟΙΟΣ ΑΛΛΕΡΓΙΚΟΣ; ΑΛΛΕΡΓΙΑ: Ο ΑΟΡΑΤΟΣ ΕΧΘΡΟΣ ΠΩΣ ΓΙΝΕΤΑΙ ΚΑΠΟΙΟΣ ΑΛΛΕΡΓΙΚΟΣ; Αλλεργία, όπως ορίζει και η λέξη, σημαίνει άλλο έργο. Είναι η μη αναμενόμενη αντίδραση του ανοσιακού συστήματος του οργανισμού εναντίον ακίνδυνων

Διαβάστε περισσότερα


ΛΙΘΙΑΣΗ ΟΥΡΟΠΟΙΗΤΙΚΟΥ ΣΥΣΤΗΜΑΤΟΣ - ΝΕΦΡΩΝ - ΟΥΡΗΤΗΡΑ - ΚΥΣΤΕΩΣ - ΟΥΡΗΘΡΑΣ ΛΙΘΙΑΣΗ ΟΥΡΟΠΟΙΗΤΙΚΟΥ ΣΥΣΤΗΜΑΤΟΣ - ΝΕΦΡΩΝ - ΟΥΡΗΤΗΡΑ - ΚΥΣΤΕΩΣ - ΟΥΡΗΘΡΑΣ Τι είναι η "λιθίαση του ουροποιητικού" Λιθίαση ουροποιητικού είναι η δημιουργία λίθου ή λίθων μέσα στην αποχετευτική μοίρα του

Διαβάστε περισσότερα

Παράρτημα III. Τροποποιήσεις των σχετικών παραγράφων της περίληψης των χαρακτηριστικών του προϊόντος και των φύλλων οδηγιών χρήσης

Παράρτημα III. Τροποποιήσεις των σχετικών παραγράφων της περίληψης των χαρακτηριστικών του προϊόντος και των φύλλων οδηγιών χρήσης Παράρτημα III Τροποποιήσεις των σχετικών παραγράφων της περίληψης των χαρακτηριστικών του προϊόντος και των φύλλων οδηγιών χρήσης Σημείωση: Οι σχετικές παράγραφοι της Περίληψης των Χαρακτηριστικών του

Διαβάστε περισσότερα



Διαβάστε περισσότερα

ΦΥΛΛΟ ΟΔΗΓΙΩΝ ΧΡΗΣΗΣ FORTEKOR FLAVOUR 5 mg Δισκία επικαλυμμένα με υμένιο για γάτες και σκύλους


Διαβάστε περισσότερα


ΓΕΝΙΚΑ ΓΙΑ ΤΗ ΝΕΦΡΟΛΙΘΙΑΣΗ 1 ΓΕΝΙΚΑ ΓΙΑ ΤΗ ΝΕΦΡΟΛΙΘΙΑΣΗ Κυριακή Σταματέλου Ειδικός Νεφρολόγος, MBA Τι είναι η νεφρολιθίαση; Η νεφρολιθίαση λέγεται κοινά «πέτρες στα νεφρά» και είναι γνωστή στην ανθρωπότητα από τα αρχαία χρόνια.

Διαβάστε περισσότερα

Το Simponi είναι αντιφλεγμονώδες φάρμακο. Χορηγείται σε ενήλικες για τη θεραπεία των ακόλουθων νόσων:

Το Simponi είναι αντιφλεγμονώδες φάρμακο. Χορηγείται σε ενήλικες για τη θεραπεία των ακόλουθων νόσων: EMA/411054/2015 EMEA/H/C/000992 Περίληψη EPAR για το κοινό γολιμουμάμπη Το παρόν έγγραφο αποτελεί σύνοψη της Ευρωπαϊκής Δημόσιας Έκθεσης Αξιολόγησης (EPAR) του. Επεξηγεί τον τρόπο με τον οποίο η Επιτροπή

Διαβάστε περισσότερα

ΕΛΛΗΝΙΚΗ ΔΗΜΟΚΡΑΤΙΑ Ανώτατο Εκπαιδευτικό Ίδρυμα Πειραιά Τεχνολογικού Τομέα. Χημική Τεχνολογία. Εργαστηριακό Μέρος

ΕΛΛΗΝΙΚΗ ΔΗΜΟΚΡΑΤΙΑ Ανώτατο Εκπαιδευτικό Ίδρυμα Πειραιά Τεχνολογικού Τομέα. Χημική Τεχνολογία. Εργαστηριακό Μέρος ΕΛΛΗΝΙΚΗ ΔΗΜΟΚΡΑΤΙΑ Ανώτατο Εκπαιδευτικό Ίδρυμα Πειραιά Τεχνολογικού Τομέα Χημική Τεχνολογία Εργαστηριακό Μέρος Ενότητα 6: Διαλυμένο Οξυγόνο Ευάγγελος Φουντουκίδης Τμήμα Μηχανολόγων Μηχανικών Τ.Ε. Άδειες

Διαβάστε περισσότερα



Διαβάστε περισσότερα

Προεκλαμψία. Έγκαιρη εκτίμηση κινδύνου στις 11 13+6 εβδομάδες

Προεκλαμψία. Έγκαιρη εκτίμηση κινδύνου στις 11 13+6 εβδομάδες Προεκλαμψία Έγκαιρη εκτίμηση κινδύνου στις 11 13+6 εβδομάδες Ο έλεγχος για προεκλαμψία μεταξύ των εβδομάδων 11 έως 13+6 μπορεί να εντοπίσει κυήσεις υψηλού κινδύνου, επιτρέποντας τη θεραπεία με α σπιρίνη

Διαβάστε περισσότερα


ΦΑΡΜΑΚΟΚΙΝΗΤΙΚΗ ΦΑΡΜΑΚΟΔΥΝΑΜΙΚΗ αλληλεπιδράσεις μεταξύ χημικών ουσιών και ζώντων οργανισμών) ΦΑΡΜΑΚΟΚΙΝΗΤΙΚΗ Διακίνηση του φαρμάκου στον οργανισμό ΦΑΡΜΑΚΟΔΥΝΑΜΙΚΗ Μηχανισμό δράσης Βιοχημικές δράσεις Φυσιολογικές δράσεις η φυσιολογική

Διαβάστε περισσότερα

Αρχές Πειραματικής. Έρευνας


Διαβάστε περισσότερα


Διαβάστε περισσότερα


ΤΕΧΝΟΛΟΓΙΚΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΚΥΠΡΟΥ ΣΧΟΛΗ ΕΠΙΣΤΗΜΩΝ ΥΓΕΙΑΣ ΤΕΧΝΟΛΟΓΙΚΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΚΥΠΡΟΥ ΣΧΟΛΗ ΕΠΙΣΤΗΜΩΝ ΥΓΕΙΑΣ Πτυχιακή Εργασία Χαμηλά επίπεδα βιταμίνης D σχετιζόμενα με το βρογχικό άσθμα στα παιδιά και στους έφηβους Κουρομπίνα Αλεξάνδρα Λεμεσός [2014] i ΤΕΧΝΟΛΟΓΙΚΟ

Διαβάστε περισσότερα

ITP Ιδιοπαθής/ αυτοάνοση θρομβοπενική πορφύρα

ITP Ιδιοπαθής/ αυτοάνοση θρομβοπενική πορφύρα ITP Ιδιοπαθής/ αυτοάνοση θρομβοπενική πορφύρα Αθανασία Μουζάκη, Καθηγήτρια Εργαστηριακής Αιματολογίας-Αιμοδοσίας, Αιματολογικό Τμήμα, Παθολογική Κλινική, Τμήμα Ιατρικής, Παν/ο Πατρών Τα είδη της ITP είναι:

Διαβάστε περισσότερα

Αξιολόγηση και θεραπεία Από τα πρωτόκολλα των SOS Ιατρών Επιμέλεια Γεώργιος Θεοχάρης

Αξιολόγηση και θεραπεία Από τα πρωτόκολλα των SOS Ιατρών Επιμέλεια Γεώργιος Θεοχάρης Αξιολόγηση και θεραπεία Από τα πρωτόκολλα των SOS Ιατρών Επιμέλεια Γεώργιος Θεοχάρης Παθολόγος Αξιολόγηση βαρύτητας περιστατικού - Από την βαρύτητα των κλινικών σημείων (αναπνευστική συχνότητα >35, ταχυκαρδία,

Διαβάστε περισσότερα

Φαρμακολογία Τμήμα Ιατρικής Α.Π.Θ.

Φαρμακολογία Τμήμα Ιατρικής Α.Π.Θ. ΑΡΙΣΤΟΤΕΛΕΙΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΘΕΣΣΑΛΟΝΙΚΗΣ ΑΝΟΙΧΤΑ ΑΚΑΔΗΜΑΙΚΑ ΜΑΘΗΜΑΤΑ Α.Π.Θ. Ενότητα 3: Φαρμακοδυναμική Μαρία Μυρωνίδου-Τζουβελέκη Α.Π.Θ. Άδειες Χρήσης Το παρόν εκπαιδευτικό υλικό υπόκειται σε άδειες χρήσης

Διαβάστε περισσότερα

Παράρτημα IV. Επιστημονικά πορίσματα

Παράρτημα IV. Επιστημονικά πορίσματα Παράρτημα IV Επιστημονικά πορίσματα 1 Επιστημονικά πορίσματα Οι αναστολείς συμμεταφορέα γλυκόζης-νατρίου 2 (SGLT2) χρησιμοποιούνται σε συνδυασμό με δίαιτα και άσκηση σε ασθενείς με διαβήτη τύπου 2, είτε

Διαβάστε περισσότερα

Τελικό κείμενο της Μελέτης. Σύνδρομο Πολυκυστικών Ωοθηκών: Διατροφή και Υγεία

Τελικό κείμενο της Μελέτης. Σύνδρομο Πολυκυστικών Ωοθηκών: Διατροφή και Υγεία Τελικό κείμενο της Μελέτης Σύνδρομο Πολυκυστικών Ωοθηκών: Διατροφή και Υγεία Τα τελικά προϊόντα προχωρημένης γλυκοζυλίωσης (Advanced Glycation End products, ) είναι μόρια υψηλής δραστικότητας, τα οποία

Διαβάστε περισσότερα



Διαβάστε περισσότερα

Εγκρίθηκαν κατά τη συνεδρίαση της PRAC στις 6-9 Ιανουαρίου 2015

Εγκρίθηκαν κατά τη συνεδρίαση της PRAC στις 6-9 Ιανουαρίου 2015 22 Ιανουαρίου 2015 EMA/PRAC/63325/2015 Επιτροπή Φαρμακοεπαγρύπνησης-Αξιολόγησης Κινδύνου Συστάσεις της Επιτροπής Φαρμακοεπαγρύπνησης- Αξιολόγησης Κινδύνου (PRAC) σχετικά με ενδείξεις που αιτιολογούν επικαιροποίηση

Διαβάστε περισσότερα

Μυϊκή Βλάβη, Οξειδωτικό στρες, αντιοξειδωτικά και άσκηση

Μυϊκή Βλάβη, Οξειδωτικό στρες, αντιοξειδωτικά και άσκηση Μυϊκή Βλάβη, Οξειδωτικό στρες, αντιοξειδωτικά και άσκηση Μυϊκή συστολή Αδυναμία δεσμίνης να δεχτεί την πίεση στην οποία υποβάλλεται ο μυς Χρονική σειρά γεγονότων στη μυϊκή βλάβη Proposed mechanism of

Διαβάστε περισσότερα


ΦΥΛΛΟ ΟΔΗΓΙΩΝ ΧΡΗΣΗΣ: ΠΛΗΡΟΦΟΡΙΕΣ ΓΙΑ ΤΟΝ ΧΡΗΣΤΗ ΦΥΛΛΟ ΟΔΗΓΙΩΝ ΧΡΗΣΗΣ: ΠΛΗΡΟΦΟΡΙΕΣ ΓΙΑ ΤΟΝ ΧΡΗΣΤΗ Xenetix 250 (250 mg I/mL), ενέσιμο διάλυμα Xenetix 300 (300 mg I/mL), ενέσιμο διάλυμα Xenetix 350 (350 mg I/mL), ενέσιμο διάλυμα Ιοβιτριδόλη Διαβάστε προσεκτικά

Διαβάστε περισσότερα

ΕΛΕΓΧΟΣ ΑΓΓΕΙΑΚΗΣ ΚΥΚΛΟΦΟΡΙΑΣ. Ειδικές έννοιες φυσιολογίας ρύθμισης της αρτηριακής πίεσης

ΕΛΕΓΧΟΣ ΑΓΓΕΙΑΚΗΣ ΚΥΚΛΟΦΟΡΙΑΣ. Ειδικές έννοιες φυσιολογίας ρύθμισης της αρτηριακής πίεσης 1 ΕΛΕΓΧΟΣ ΑΓΓΕΙΑΚΗΣ ΚΥΚΛΟΦΟΡΙΑΣ Κωνσταντίνος Καλλαράς Καθηγητής Φυσιολογίας Ειδικές έννοιες φυσιολογίας ρύθμισης της αρτηριακής πίεσης Είναι ουσιώδες να γνωρίζει κανείς με ποιούς τρόπους η ΑΠ διατηρείται

Διαβάστε περισσότερα

Φυσιολογία-Ι. Ουροποιητικό σύστημα

Φυσιολογία-Ι. Ουροποιητικό σύστημα Φυσιολογία-Ι Ουροποιητικό σύστημα Συμπύκνωση και αραίωση των ούρων Β. Στεργίου Μιχαηλίδου Επίκουρη Καθηγήτρια Εργ. Πειραματικής Φυσιολογίας Συμπύκνωση και αραίωση των ούρων Η ποσότητα ούρων που παράγεται

Διαβάστε περισσότερα



Διαβάστε περισσότερα



Διαβάστε περισσότερα

Γυμνάσιο Aγίου Αθανασίου Σχολική χρονιά: 2012-2013 Μάθημα: Χημεία Όνομα μαθητή/τριας: Ημερομηνία:

Γυμνάσιο Aγίου Αθανασίου Σχολική χρονιά: 2012-2013 Μάθημα: Χημεία Όνομα μαθητή/τριας: Ημερομηνία: Γυμνάσιο Aγίου Αθανασίου Σχολική χρονιά: 2012-2013 Μάθημα: Χημεία Τάξη Β Όνομα μαθητή/τριας: Ημερομηνία: 1) Να γράψετε τι ονομάζεται μείγμα; 2) Να γράψετε τι ονομάζεται ετερογενές μείγμα; 3) Να γράψετε

Διαβάστε περισσότερα



Διαβάστε περισσότερα