ΠΑΝΔΠΗΣΖΜΗΟ ΠΑΣΡΩΝ ΣΜΖΜΑ ΦΑΡΜΑΚΔΤΣΗΚΖ ΠΑΤΛΟΠΟΤΛΟΤ ΑΘΑΝΑΗΑ

Μέγεθος: px
Εμφάνιση ξεκινά από τη σελίδα:

Download "ΠΑΝΔΠΗΣΖΜΗΟ ΠΑΣΡΩΝ ΣΜΖΜΑ ΦΑΡΜΑΚΔΤΣΗΚΖ ΠΑΤΛΟΠΟΤΛΟΤ ΑΘΑΝΑΗΑ"

Transcript

1 ΠΑΝΔΠΗΣΖΜΗΟ ΠΑΣΡΩΝ ΣΜΖΜΑ ΦΑΡΜΑΚΔΤΣΗΚΖ ΠΑΤΛΟΠΟΤΛΟΤ ΑΘΑΝΑΗΑ ΑΝΑΠΣΤΞΖ ΚΑΗ ΔΦΑΡΜΟΓΖ ΔΡΓΑΛΔΗΧΝ ΒΗΟΠΛΖΡΟΦΟΡΗΚΖ ΓΗΑ ΣΖ ΦΤΛΟΓΔΝΔΣΗΚΖ ΑΝΑΛΤΖ ΚΑΗ ΠΡΟΒΛΔΦΖ ΣΖ ΓΟΜΖ ΚΑΗ ΡΤΘΜΗΖ ΣΖ ΛΔΗΣΟΤΡΓΗΑ ΣΧΝ ΠΡΧΣΔΨΝΧΝ ΓΗΓΑΚΣΟΡΗΚΖ ΓΗΑΣΡΗΒΖ GTGGACATTAGGTACGGATTTCGAGTAACTGGATCTAGGTACGT CCTTGGTCAACTTACCGTACGATCGATGGATCCGATGAATCGTC AGGATGCTCTACTTATCAGGGCTATCATGCGTATGCTATTCGTC CATGCGTAGCGAGTGCTTAATTGCCCGTATGCTAGGGTAGCTAG TATCGATGGCTAATGCGCGTATAGCTAGCTTAGCGCTTTCGATC GAGAGTGCTTAGCTTCAGGCGATTAGTCAGCTAGATCGATGCTG ATGATGCTAGCGTACGTGCTTATACACTAGCTTGAGCTCTAGAT TCGGAATTTAAGTAACCGTACC Πάηξα, Μάξηηνο 2011

2 1 ΑΝΑΠΣΤΞΖ ΚΑΗ ΔΦΑΡΜΟΓΖ ΔΡΓΑΛΔΗΧΝ ΒΗΟΠΛΖΡΟΦΟΡΗΚΖ ΓΗΑ ΣΖ ΦΤΛΟΓΔΝΔΣΗΚΖ ΑΝΑΛΤΖ ΚΑΗ ΠΡΟΒΛΔΦΖ ΣΖ ΓΟΜΖ ΚΑΗ ΡΤΘΜΗΖ ΣΖ ΛΔΗΣΟΤΡΓΗΑ ΣΧΝ ΠΡΧΣΔΨΝΧΝ Τπφ ΑΘΑΝΑΗΑ ΠΑΤΛΟΠΟΤΛΟΤ Σκήκα Φαξκαθεπηηθήο ρνιή Δπηζηεκψλ Τγείαο Παλεπηζηήκην Παηξψλ ΔΠΣΑΜΔΛΖ ΔΞΔΣΑΣΗΚΖ ΔΠΗΣΡΟΠΖ Γεσξγία σηεξνπνχινπ, Αλαπιεξψηξηα Καζεγήηξηα, Σκήκα Φαξκαθεπηηθήο, Παλεπηζηήκην Παηξψλ (Δπηβιέπνπζα) Ησάλλεο Εαξθάδεο, Αλαπιεξσηήο Καζεγεηήο, Σκήκα Ηαηξηθήο, Παλεπηζηήκην Παηξψλ (Μέινο Σξηκεινχο πκβνπιεπηηθήο Δπηηξνπήο) νθία Κνζζίδα, Δξεπλήηξηα Γ Ίδξπκα Ηαηξνβηνινγηθψλ Δξεπλψλ, Αθαδεκία Αζελψλ (Μέινο Σξηκεινχο πκβνπιεπηηθήο Δπηηξνπήο) Παχινο Κιεπεηζάλεο, Δπίθνπξνο Καζεγεηήο, Σκήκα Φαξκαθεπηηθήο, Παλεπηζηήκην Παηξψλ Νηθφιαο Εάγθξεο, Καζεγεηήο, Σκήκα Βηνινγίαο, Παλεπηζηήκην Παηξψλ Αλδξέαο θνξίιαο, Αλαπιεξσηήο Καζεγεηήο, Σκήκα Βηνινγίαο, Δζληθφ Καπνδηζηξηαθφ Παλεπηζηήκην Αζελψλ Βαζίιεηνο Ενπκπνπξιήο, Δξεπλεηήο Β, Δζληθφ Ίδξπκα Δξεπλψλ, Αζήλα

3 2 ΠΔΡΗΔΥΟΜΔΝΑ

4 3 ΠΔΡΗΔΥΟΜΔΝΑ... 2 ΤΝΣΜΖΔΗ... 9 ΚΟΠΟ ΣΖ ΜΔΛΔΣΖ ΔΗΑΓΧΓΖ: ΔΡΓΑΛΔΗΑ ΒΗΟΠΛΖΡΟΦΟΡΗΚΖ ΒΗΟΛΟΓΗΚΔ ΒΑΔΗ ΓΔΓΟΜΔΝΩΝ...17 Μνξθή Αξρείνπ Καηαρψξεζεο Αλάθηεζε Γεδνκέλσλ ζηηο Βηνινγηθέο Βάζεηο Γεδνκέλσλ Βάζεηο Γεδνκέλσλ Μνξηαθήο Βηνινγίαο Σαμηλνκηθέο Βάζεηο Γεδνκέλσλ Βάζεηο Γεδνκέλσλ Αθνινπζηψλ Ννπθιενηηδίσλ Βάζεηο Γεδνκέλσλ Γνληδησκάησλ Βάζεηο Γεδνκέλσλ Αθνινπζηψλ Πξσηετλψλ Πξσηνγελείο Βάζεηο Γεδνκέλσλ Αθνινπζηψλ Πξσηετλψλ Γεπηεξνγελείο Βάζεηο Γεδνκέλσλ Αθνινπζηψλ Πξσηετλψλ Μέζνδνο Kαηαζθεπήο Πξσηετληθψλ Απνηππσκάησλ Γνκηθέο Βάζεηο Γεδνκέλσλ Βάζεηο Γεδνκέλσλ Σαμηλφκεζεο Γνκψλ Πξσηετλψλ ΑΝΑΕΖΣΖΖ ΟΜΟΗΟΣΖΣΑ Δ ΒΑΔΗ ΓΔΓΟΜΔΝΩΝ ΑΚΟΛΟΤΘΗΩΝ...26 ηνίρηζε Αθνινπζηψλ αλά Εεχγε πζηήκαηα Βαζκνιφγεζεο ησλ αλά Εεχγε ηνηρίζεσλ... 28

5 4 Πίλαθεο Αληηθαηάζηαζεο Ακηλνμηθψλ Καηαινίπσλ Πίλαθεο Αληηθαηάζηαζεο PAM Πίλαθεο Αληηθαηάζηαζεο BLOSUM Πνηλέο Δηζαγσγήο Κελψλ Τπνινγηζηηθέο Μέζνδνη ηνίρηζεο-blast ΠΟΛΛΑΠΛΖ ΓΡΑΜΜΗΚΖ ΣΟΗΥΗΖ ΑΚΟΛΟΤΘΗΩΝ...33 πζηήκαηα Βαζκνιφγεζεο Πνιιαπιήο Γξακκηθήο ηνίρηζεο Αθνινπζηψλ Πξννδεπηηθή Πνιιαπιή Γξακκηθή ηνίρηζε Αθνινπζηψλ Λνγηζκηθά Παθέηα Πνιιαπιήο Γξακκηθήο ηνίρηζεο Αθνινπζηψλ Λνγφηππα Aθνινπζηψλ ΦΤΛΟΓΔΝΔΣΗΚΖ ΑΝΑΛΤΖ...38 Δπηινγή Αθνινπζηψλ γηα Φπινγελεηηθή Αλάιπζε Δμειηθηηθέο ρέζεηο Οη Έλλνηεο ησλ Παξάινγσλ θαη ησλ Οξζφινγσλ Φπινγελεηηθά Γέλδξα Γέλδξν κε Ρίδα έλαληη Γέλδξνπ ρσξίο Ρίδα Κιαδφγξακκα έλαληη Φπινγξάκκαηνο Μέζνδνη Καηαζθεπήο ησλ Φπινγελεηηθψλ Γέλδξσλ Μέζνδνη Βαζηζκέλεο ζηελ Απφζηαζε Μέζνδνη Βαζηζκέλεο ζε Υαξαθηήξεο Μέζνδνο Μέγηζηεο Φεηδσιφηεηαο Μέζνδνο Μέγηζηεο Πηζαλνθάλεηαο Πξφηππα Αληηθαηάζηαζεο... 44

6 5 Αμηνιφγεζε ηνπ Φπινγελεηηθνχ Γέλδξνπ Έιμε ησλ Μαθξηψλ Κιαδηψλ Λνγηζκηθά Παθέηα Φπινγελεηηθήο Αλάιπζεο Τπνινγηζηηθά Πξνγξάκκαηα Γξαθηθήο Αλαπαξάζηαζεο Γέλδξσλ ΤΠΟΛΟΓΗΣΗΚΔ ΜΔΘΟΓΟΗ ΑΝΑΛΤΖ ΣΖ ΠΡΩΣΔΪΝΗΚΖ ΓΟΜΖ...47 Μνξηαθή Απεηθφληζε Πξφβιεςε ηεο Γεπηεξνηαγνχο Γνκήο ησλ Πξσηετλψλ ΜΔΡΟ Η: ΦΤΣΗΚΔ DNA ΜΔΘΤΛΟΜΔΣΑΦΟΡΑΔ ΔΗΑΓΩΓΖ...50 Μεζπιίσζε Κπηνζηλψλ ζην Γνληδησκαηηθφ DNA ησλ Φπηψλ Φπηηθέο DNA Μεζπινκεηαθνξάζεο Οηθνγέλεηα ησλ Μεζπινκεηαθνξαζψλ Οηθνγέλεηα ησλ Υξσκνκεζπινκεηαθνξαζψλ Οηθνγέλεηα ησλ DRMs Οηθνγέλεηα ησλ DNA Μεζπινκεηαθνξαζψλ ΜΔΘΟΓΟΛΟΓΗΑ...62 Ολνκαηνινγία ησλ Φπηηθψλ DNA C5-MTs Αλαδήηεζε Οκφινγσλ Φπηηθψλ Πξσηετλψλ DNA C5-MTs ζηηο Γεκφζηεο Βάζεηο Γεδνκέλσλ Πνιιαπιή Γξακκηθή ηνίρηζε Αθνινπζηψλ Φπινγελεηηθή Αλάιπζε Λνγφηππα Αθνινπζηψλ ΑΠΟΣΔΛΔΜΑΣΑ ΚΑΗ ΤΕΖΣΖΖ...64

7 6 Λνγφηππα Αθνινπζίαο ησλ Καηαιπηηθψλ Μνηίβσλ ησλ Φπηηθψλ DNA C5-MTs Φπινγελεηηθή Αλάιπζε ησλ Φπηηθψλ DNA C5-MTs Φπινγελεηηθή Αλάιπζε - Αλάιπζε ησλ Αθνινπζηψλ TRD ΜΔΡΟ II: ΔΤΚΑΡΤΧΣΗΚΔ RNA ΜΔΘΤΛΟΜΔΣΑΦΟΡΑΔ ΔΗΑΓΩΓΖ...77 ΜΔΘΟΓΟΛΟΓΗΑ...81 Αλαδήηεζε Οκφινγσλ Πξσηετλψλ RCMTs ζηηο Γεκφζηεο Βάζεηο Γεδνκέλσλ Φπινγελεηηθή Αλάιπζε Λνγφηππα Αθνινπζηψλ Καηαζθεπή Πξσηετληθψλ Απνηππσκάησλ RCMT Μνξηαθή Απεηθφληζε Οξγάλσζε ησλ Γνληδίσλ RCMT ΑΠΟΣΔΛΔΜΑΣΑ...83 Φπινγελεηηθή Αλάιπζε ησλ Οκφινγσλ Πξσηετλψλ RCMT Λνγφηππα Αθνινπζίαο ησλ Καηαιπηηθψλ Μνηίβσλ RCMT Λνγφηππα Αθνινπζίαο ησλ Πξσηετληθψλ Απνηππσκάησλ RCMT Αλάιπζε ηεο Γνκήο ησλ Γνληδίσλ RCMT ΤΕΖΣΖΖ...97 ΤΠΟΛΟΓΗΣΗΚΟ ΠΡΟΓΡΑΜΜΑ RCMTHMM...99 ΜΔΡΟ ΗΗΗ: ΠΔΠΣΗΓΑΔ ΤΓΓΔΝΔΗ ΣΖ ΚΑΛΛΗΚΡΔΨΝΖ ΔΗΑΓΩΓΖ ΜΔΘΟΓΟΛΟΓΗΑ

8 7 Αλαδήηεζε Οκφινγσλ Πξσηετλψλ KLK ζηηο Γεκφζηεο Βάζεηο Γεδνκέλσλ Αλάιπζε ηεο Πξσηνηαγνχο Γνκήο ησλ Πξσηετλψλ KLK Πξφβιεςε ηεο Γεπηεξνηαγνχο Γνκήο ησλ Πξσηετλψλ KLK Αλάιπζε ηεο Σξηηνηαγνχο Γνκήο ησλ Πξσηετλψλ KLK Φπινγελεηηθή Αλάιπζε πληαηληθή Αλάιπζε ησλ Γνληδίσλ KLK Οξγάλσζε ησλ Γνληδίσλ KLK Αλάιπζε ηνπ Ρπζκνχ Μεηαβνιήο ησλ Ακηλνμέσλ ΑΠΟΣΔΛΔΜΑΣΑ Σαπηνπνίεζε Οκφινγσλ Πξσηετλψλ KLK Γηαηήξεζε Γνκηθψλ Υαξαθηεξηζηηθψλ ησλ KLKs ζηηο Οξζφινγεο Πξσηεΐλεο KLK πζηάδα ησλ Γνληδίσλ KLK Φπινγελεηηθή Αλάιπζε ησλ Οκφινγσλ Πξσηετλψλ KLK Αλάιπζε ηνπ Ρπζκνχ Μεηαβνιήο Γνκή ησλ Γνληδίσλ KLK ΤΕΖΣΖΖ πλεμέιημε ησλ Δλδχκσλ KLK θαη ησλ Δηδηθψλ Τπνζηξσκάησλ ηνπο Βξφγρνο-99 θαη Πξνζαξκνγή ζε Απμεκέλε Δλδπκηθή Γξαζηηθφηεηα ΠΔΡΗΛΖΦΖ ABSTRACT ΒΗΒΛΗΟΓΡΑΦΗΚΔ ΑΝΑΦΟΡΔ ΠΑΡΑΡΣΖΜΑΣΑ

9 8 ΠΑΡΑΡΣΖΜΑ 1. Ολφκαηα θαη αξηζκνί πξφζβαζεο ησλ αληηπξνζσπεπηηθψλ πξσηετλψλ RCMT πνπ αλαιχζεθαλ ζηελ παξνχζα κειέηε ΠΑΡΑΡΣΖΜΑ 2. Ολφκαηα θαη αξηζκνί θαηαρψξεζεο ησλ πξσηετλψλ KLK πνπ αλαιχζεθαλ ζηελ παξνχζα κειέηε ΠΑΡΑΡΣΖΜΑ 3. Οξγάλσζε ησλ γνληδίσλ KLK ΠΑΡΑΡΣΖΜΑ 4. Αλάιπζε ηνπ ξπζκνχ κεηαβνιήο ΒΗΟΓΡΑΦΗΚΟ ΖΜΔΗΧΜΑ ΓΖΜΟΗΔΤΜΔΝΔ ΔΡΓΑΗΔ

10 9 ΤΝΣΜΖΔΗ

11 10 AdoMet S-adenosyl-L-methionine S-αδελνζπιν-L-κεζεηνλίλε BAH Bromo-adjacent homology domain Πεξηνρή αιιειν-επίδξαζεο κε ηε ρξσκαηίλε CLS Chloroplast localization signal εκαηνδνηηθή αιιεινπρία γηα ππνθπηηαξηθφ εληνπηζκφ ζηνλ ρισξνπιάζηε CMT Chromomethyltransferase Υξσκνκεζπινκεηαθνξάζε DDBJ DNA Data Bank of Japan DNA C5-MT DNA (cytosine-5) methyltransferase DNA κεζπινκεηαθνξάζε EMBL European Molecular Biology Laboratory KLK Kallikrein-related peptidases Πεπηηδάζεο ζπγγελείο ηεο θαιιηθξεΐλεο m 5 C 5-methyl-cytosine 5-κεζπινθπηνζίλε m 5 U 5-methyl-uridine 5-κεζπιννπξηδίλε mtdna Mitochondrial DNA Mηηνρνλδξηαθφ DNA NCBI National Center for Biotechnology Information NLS Nuclear localization signal Αθνινπζία-ζήκα ππξεληθνχ εληνπηζκνχ PAM Point accepted mutation Aπνδεθηή ζεκεηαθή κεηάιιαμε PLG Plasminogen Πιαζκηλνγφλν PSA Prostate-specific antigen Δηδηθφ πξνζηαηηθφ αληηγφλν

12 11 RCMT RNA (cytosine-5) methyltransferase RNA κεζπινκεηαθνξάζε RUMT RNA (uridine-5) methyltransferase RNA κεζπινκεηαθνξάζε ηεο νπξηδίλεο rrna Ribosomal RNA Ρηβνζσκηθφ RNA TRD Target recognition domain Πεξηνρή αλαγλψξηζεο ηεο αθνινπζίαο-ζηφρνπ trna Transfer RNA Μεηαθνξηθφ RNA UBA Ubiquitin-associated domain Πεξηνρή αιιειεπίδξαζεο κε ηελ νπβηθνπτηίλε

13 12 ΚΟΠΟ ΣΖ ΜΔΛΔΣΖ

14 13 ΚΟΠΟ ΣΖ ΜΔΛΔΣΖ θνπφο ηεο παξνχζαο δηαηξηβήο ήηαλ ε αλάπηπμε θαη εθαξκνγή εξγαιείσλ ηεο Βηνπιεξνθνξηθήο γηα ηε θπινγελεηηθή αλάιπζε θαη πξφβιεςε ηεο δνκήο ησλ πξσηετλψλ, νδεγψληαο, θαηά απηφλ ηνλ ηξφπν, ζηελ εμαγσγή ζπκπεξαζκάησλ ζρεηηθά κε ηε βηνρεκηθή ιεηηνπξγία θαηλνθαλψλ πξσηετλψλ. Ζ πξφζθαηε ζπζζψξεπζε κηαο πιεζψξαο γνληδησκάησλ ζηηο δεκφζηεο βάζεηο δεδνκέλσλ, θαζψο επίζεο θαη ε δηαζεζηκφηεηα βηνυπνινγηζηηθψλ εξγαιείσλ, θαηέζηεζε εθηθηή ηελ ηαπηνπνίεζε θαηλνθαλψλ πξσηετληθψλ αθνινπζηψλ θαη θαη επέθηαζε ηε δηεμαγσγή δηεμνδηθψλ θπινγελεηηθψλ αλαιχζεσλ βαζηζκέλσλ ζηηο αθνινπζίεο απηέο, κε ζθνπφ ηελ αλάπηπμε ζεσξηψλ γηα ηελ εμειηθηηθή ηζηνξία πξσηετληθψλ νηθνγελεηψλ. ηελ παξνχζα κειέηε, κε ρξήζε βηνυπνινγηζηηθψλ κεζφδσλ, κειεηήζεθε ε εμειηθηηθή ηζηνξία ηξηψλ ιεηηνπξγηθά ζεκαληηθψλ πξσηετληθψλ νηθνγελεηψλ: (α) ησλ θπηηθψλ DNA κεζπινκεηαθνξαζψλ θαη (β) ησλ επθαξπσηηθψλ RNA κεζπινκεηαθνξαζψλ, νη νπνίεο είλαη έλδπκα πνπ επηθέξνπλ κεζπιίσζε ζηηο λνπθιενηηδηθέο αιιεινπρίεο, θαζψο θαη (γ) ησλ πεπηηδαζψλ ζπγγελψλ ηεο θαιιηθξεΐλεο (KLKs), νη νπνίεο είλαη γλσζηέο πξσηεάζεο κε δξάζε ηχπνπ ζξπςίλεο ή ρπκνζξπςίλεο. Γηα ηε δηεμαγσγή ηεο παξνχζαο έξεπλαο ρξεζηκνπνηήζεθαλ ππνινγηζηηθά εξγαιεία αλαδήηεζεο νκνηφηεηαο ζε βηνινγηθέο βάζεηο δεδνκέλσλ, πνιιαπιήο γξακκηθήο ζηνίρηζεο αθνινπζηψλ, ηαπηνπνίεζεο εζσλίσλ θαη εμσλίσλ, θπινγελεηηθήο αλάιπζεο, θαηαζθεπήο πξσηετληθψλ κνηίβσλ, πξφβιεςεο δεπηεξνηαγνχο θαη ηξηηνηαγνχο πξσηετληθήο δνκήο θαη κνξηαθήο νπηηθνπνίεζεο. Πξνο απηήλ ηελ θαηεχζπλζε, νκφινγεο πξσηετληθέο αθνινπζίεο αλαδεηήζεθαλ ζηηο δεκφζηεο βάζεηο δεδνκέλσλ. Δθηφο απφ ηηο ήδε γλσζηέο αθνινπζίεο ηαπηνπνηήζεθαλ θαη θαηλνθαλείο, νη νπνίεο ζπγθξίζεθαλ κε πνιιαπιή ζηνίρηζε, ελψ ιεηηνπξγηθέο πεξηνρέο αλαδεηήζεθαλ κέζσ ζπληεξεκέλσλ πξνηχπσλ πνπ πξνέθπςαλ απφ ηε ζηνίρηζε ησλ πξσηετληθψλ αθνινπζηψλ. Δλ ζπλερεία, νη εμειηθηηθέο ζρέζεηο ησλ ραξαθηεξηζκέλσλ θαη θαηλνθαλψλ

15 14 πξσηετλψλ ησλ ηξηψλ νηθνγελεηψλ δηεξεπλήζεθαλ κε ηε ρξήζε θπινγελεηηθψλ δέλδξσλ. Ζ ππνινγηζηηθή πξφβιεςε ηεο πξσηνηαγνχο, δεπηεξνηαγνχο θαη ηξηηνηαγνχο δνκήο ησλ θαηλνθαλψλ πξσηετληθψλ αθνινπζηψλ νδήγεζε ζηνλ εληνπηζκφ ζπληεξεκέλσλ δνκηθψλ πεξηνρψλ ζηηο ππφ εμέηαζε πξσηεΐλεο. Σέινο, αλαιχζεθε ε δνκή θαη ζπληαηλία ησλ γνληδίσλ πνπ θσδηθνπνηνχλ ηηο ηαπηνπνηεζείζεο πξσηεΐλεο. Σα απνηειέζκαηα ησλ αλαιχζεσλ νδήγεζαλ ζηε δηαηχπσζε ππνζέζεσλ ζρεηηθά κε ηηο κεηαιιάμεηο ησλ ακηλνμηθψλ θαηαινίπσλ (αληηθαηαζηάζεηο, ελζέζεηο, απαινηθέο), θαζψο θαη ησλ γνληδηαθψλ δηπιαζηαζκψλ/απαινηθψλ πνπ, ελδερνκέλσο, έιαβαλ ρψξα θαηά ηε δηάξθεηα ηεο εμέιημεο ηεο θάζε γνληδηαθήο νηθνγέλεηαο. Καη επέθηαζε, κε ζπλαμηνιφγεζε ησλ γνληδησκαηηθψλ θαη ησλ πξσηετληθψλ αθνινπζηψλ, θαηέζηε δπλαηή ε αλαδηαηχπσζε ηεο εμειηθηηθήο ηζηνξίαο ησλ ηξηψλ νηθνγελεηψλ, θαζψο επίζεο θαη ε εμαγσγή ζεκαληηθψλ ζπκπεξαζκάησλ ζρεηηθά κε ηελ θαηαιπηηθή δξάζε θαη ηελ πηζαλή βηνινγηθή ιεηηνπξγία ησλ θαηλνθαλψλ πξσηετλψλ.

16 15 ΔΗΑΓΧΓΖ: ΔΡΓΑΛΔΗΑ ΒΗΟΠΛΖΡΟΦΟΡΗΚΖ

17 16 Σηο ηειεπηαίεο δεθαεηίεο έρεη παξαηεξεζεί κηα αχμεζε ησλ βηνινγηθψλ δεδνκέλσλ ζε δηεζλείο βάζεηο δεδνκέλσλ κε εθξεθηηθφ ξπζκφ. Ο αξηζκφο ησλ θαηαρσξεκέλσλ λνπθιενηηδηθψλ αθνινπζηψλ (π.ρ. νιφθιεξα γνληδηψκαηα, ESTs, DNA θαη mrna) θαη πξσηετληθψλ αθνινπζηψλ, ησλ ηξηζδηάζηαησλ δνκψλ ησλ βηνκαθξνκνξίσλ, θαζψο επίζεο θαη ε ραξηνγξάθεζε θαη αιιεινχρεζε νιφθιεξσλ γνληδησκάησλ, είρε σο απνηέιεζκα ηε ζπγθέληξσζε ελφο ηεξάζηηνπ φγθνπ αθαηέξγαζησλ δεδνκέλσλ εθηεηακέλεο πνιππινθφηεηαο. Ζ παξαδνζηαθή βηνινγία ήηαλ αδχλαην λα αληαπνθξηζεί ζε απηή ηελ πξφθιεζε θαζηζηψληαο απαξαίηεηε ηε ρξήζε ειεθηξνληθψλ ππνινγηζηψλ γηα ηελ απνηειεζκαηηθή απνζήθεπζε, νξγάλσζε, αλάιπζε θαη εξκελεία απηήο ηεο πιεζψξαο βηνινγηθψλ δεδνκέλσλ. Σα γεγνλφηα απηά δεκηνχξγεζαλ ηηο θαηάιιειεο πξνυπνζέζεηο γηα ηε δεκηνπξγία ηνπ λένπ θαη ζπλερψο εμειηζζφκελνπ επηζηεκνληθνχ πεδίνπ ηεο Βηνπιεξνθνξηθήο. Ζ ζχγρξνλε Βηνινγία δελ είλαη πηα κφλνλ εξγαζηεξηαθή επηζηήκε, αιιά ππνζηεξίδεηαη ζε ζεκαληηθφ βαζκφ απφ ηα εξγαιεία ηεο Πιεξνθνξηθήο. Ο επηθξαηέζηεξνο νξηζκφο ηεο Βηνπιεξνθνξηθήο είλαη: ε επηζηήκε πνπ εθαξκφδεη ππνινγηζηηθέο κεζφδνπο (επηζηήκε ππνινγηζηψλ, εθαξκνζκέλσλ καζεκαηηθψλ, ζηαηηζηηθήο) κε ζθνπφ ηελ απνζήθεπζε, νξγάλσζε, δηαρείξηζε θαη θαηαλφεζε ηεο πιεξνθνξίαο πνπ ζρεηίδεηαη κε βηνκαθξνκφξηα (DNA, RNA, πξσηεΐλεο, πνιπζαθραξίηεο). ηνπο θχξηνπο ζηφρνπο ηεο Βηνπιεξνθνξηθήο πεξηιακβάλνληαη: (α) ε απνδνηηθή νξγάλσζε ησλ βηνινγηθψλ δεδνκέλσλ θαη ε πξφζβαζε ζε απηά, θαζψο θαη ε ζπζζψξεπζε λέσλ δεδνκέλσλ, (β) ε αλάπηπμε κεζφδσλ θαη ππνινγηζηηθψλ εξγαιείσλ κε ζηφρν ηελ εμαγσγή πιεξνθνξηψλ απφ ηα δεδνκέλα, θαη (γ) ε ρξήζε ησλ εξγαιείσλ απηψλ γηα ηελ αλάιπζε θαη εξκελεία ησλ δεδνκέλσλ κε έλα βηνινγηθά απνδεθηφ ηξφπν (Reichhardt, 1999). Αθνινχζσο, πεξηγξάθνληαη δηεμνδηθά ηα εξγαιεία ηεο Βηνπιεξνθνξηθήο, ηα νπνία ρξεζηκνπνηήζεθαλ γηα ηελ πινπνίεζε ηεο παξνχζαο κειέηεο.

18 17 ΒΗΟΛΟΓΗΚΔ ΒΑΔΗ ΓΔΓΟΜΔΝΧΝ Οη δεκφζηεο (ειεχζεξα πξνζβάζηκεο) βηνινγηθέο βάζεηο δεδνκέλσλ (ΒΒΓ) είλαη ειεθηξνληθέο βηβιηνζήθεο βηνινγηθψλ δεδνκέλσλ, ηα νπνία πξνέξρνληαη απφ δηάθνξεο πεγέο (π.ρ. πεηξακαηηθά εξγαζηήξηα, δεκνζηεπκέλε βηβιηνγξαθία). Οη βάζεηο απηέο απνηεινχλ νινθιεξσκέλα ζπζηήκαηα θαηαρψξεζεο βηνινγηθψλ δεδνκέλσλ (εγγξαθψλ, entries) θαη ζπλνδεχνληαη απφ θαηάιιειεο κεραλέο αλαδήηεζεο θαη αλάθηεζεο ησλ απνζεθεπκέλσλ δεδνκέλσλ (Gautham, 2006). Μνξθή Αξρείνπ Καηαρώξεζεο Ζ κνξθή αξρείνπ θαηαρψξεζεο είλαη κηα ζπγθεθξηκέλε κνξθή απνζήθεπζεο ησλ θαηαρσξήζεσλ ζηηο βηνινγηθέο βάζεηο δεδνκέλσλ. Έλα ηππηθφ παξάδεηγκα κνξθήο αξρείνπ είλαη ην απνθαινχκελν «FASTA format». Ζ ζπγθεθξηκέλε κνξθή απνηειείηαη απφ κηα επηθεθαιίδα (header), ε νπνία αξρίδεη κε ην ζχκβνιν «>». Ζ επηθεθαιίδα πεξηιακβάλεη ηνλ αξηζκφ θαηαρψξεζεο ή αξηζκφ πξφζβαζεο (accession number), θαη κηα πξναηξεηηθή ζχληνκε πεξηγξαθή ηεο θαηαρψξεζεο, αθνινπζνχκελε απφ ηελ θπξίσο αθνινπζία. Σν ζχκβνιν «>» δηαρσξίδεη ηελ επηθεθαιίδα απφ ηελ αθνινπζία (Westhead, 2002) (Δηθφλα 1). αξηζκόο πξόζβαζεο πεξηγξαθή θαηαρώξεζεο >gi ref NP_ DNA (cytosine-5)-methyltransferase 1 isoform b [Homo sapiens] MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRK EELSEEGYLAKVKSLLNKDLSLENGAHAYNREVNGRLENGNQARSEARRVGMADANSPPKPLSKPRTPRR SKSDGEAKPEPSPSPRITRKSTRQTTITSHFAKGPAKRKPQEESERAKSDESIKEEDK... Δηθόλα 1: Παξάδεηγκα αξρείνπ ζε κνξθή FASTA.

19 18 Αλάθηεζε Γεδνκέλσλ ζηηο Βηνινγηθέο Βάζεηο Γεδνκέλσλ πλήζσο, ε αλάθηεζε βηνινγηθψλ δεδνκέλσλ απφ ηηο ΒΒΓ γίλεηαη κε «ιέμεηο-θιεηδηά», ηα νπνία κπνξεί λα είλαη ην φλνκα ελφο νξγαληζκνχ, ην φλνκα κηαο αθνινπζίαο ή ν αξηζκφο θαηαρψξεζεο κηαο εγγξαθήο, αλάινγα κε ην είδνο ηεο πιεξνθνξίαο πνπ ζέιεη λα εμάγεη ν ρξήζηεο (Gautham, 2006). Σν πξφγξακκα Entrez ηνπ NCBI (http://www.ncbi.nlm.nih.gov/) απνηειεί έλα δηαθεθξηκέλν νινθιεξσκέλν ζχζηεκα αλάθηεζεο βηνινγηθψλ δεδνκέλσλ, ην νπνίν παξέρεη ζηνλ ρξήζηε ηε δπλαηφηεηα γηα ηαπηφρξνλε αλαδήηεζε ζε φιεο ηηο ΒΓ πνπ πεξηιακβάλνληαη ζην NCBI (Wheeler et al., 2008). Βάζεηο Γεδνκέλσλ Μνξηαθήο Βηνινγίαο Σαμηλνκηθέο Βάζεηο Γεδνκέλσλ Οη βάζεηο απηέο πεξηέρνπλ ηαμηλνκίεο νξγαληζκψλ. Μηα ελδεηθηηθή ηαμηλνκηθή ΒΓ είλαη ν Taxonomy Browser ηνπ NCBI (Wheeler et al., 2008), φπνπ ε ηαμηλφκεζε ησλ νξγαληζκψλ είλαη ηεξαξρηθή, βαζηδφκελε ζε δεδνκέλα λνπθιενηηδηθψλ ή πξσηετληθψλ αθνινπζηψλ (Πίλαθαο 1). Βάζεηο Γεδνκέλσλ Αθνινπζηώλ Ννπθιενηηδίσλ Οη ηξεηο κεγαιχηεξεο δεκφζηεο ΒΓ λνπθιενηηδηθψλ αθνινπζηψλ είλαη ε GenBank (Ζ.Π.Α.) (Benson et al., 2009) ηνπ NCBI, ε EMBL (European Molecular Biology Laboratory) (Kulikova et al., 2007) ηνπ EBI (European Bioinformatics Institute) θαη ε DDBJ (Ηαπσλία) (Sugawara et al., 2008) ηνπ CIB (Center for Information Biology). Οη βάζεηο απηέο απνηεινχλ απνζήθεο αθνινπζηψλ λνπθιενηηδίσλ θαη δηέπνληαη απφ θνηλνχο θαλφλεο φζνλ αθνξά ηελ θαηαρψξεζε, ηαμηλφκεζε θαη ηα πιεξνθνξηαθά ζηνηρεία πνπ παξέρνληαη γηα ηα δεδνκέλα. Δπίζεο, ζπλεξγάδνληαη γηα ηελ θαζεκεξηλή

20 19 αληαιιαγή εγγξαθψλ νη νπνίεο θαηαρσξνχληαη ζηελ θάζε ΒΓ αλεμάξηεηα. Τπάξρνπλ θαη εμεηδηθεπκέλεο ΒΓ λνπθιενηηδηθψλ αθνινπζηψλ φπσο ε JGI (Markowitz et al., 2008). Κάπνηεο απφ απηέο εζηηάδνπλ ζε ζπγθεθξηκέλνπο νξγαληζκνχο θαη θάπνηεο αζρνινχληαη κε ζπγθεθξηκέλεο νκάδεο λνπθιενηηδηθψλ αθνινπζηψλ (Πίλαθαο 1). Πίλαθαο 1. εκαληηθέο βηνινγηθέο βάζεηο δεδνκέλσλ. Βάζε Γεδνκέλσλ URL Ταμηλνκηθέο βάζεηο δεδνκέλωλ Taxonomy Browser wtax.cgi?mode=root Βάζεηο δεδνκέλωλ αθνινπζηώλ λνπθιενηηδίωλ GenBank EMBL DDBJ Βάζεηο δεδνκέλωλ γνληδηωκάηωλ Ensembl Enterz Genome Βάζεηο δεδνκέλωλ αθνινπζηώλ πξωηεϊλώλ PIR SwissProt TrEMBL UniProt UniProtKB Δμεηδηθεπκέλεο βάζεηο δεδνκέλωλ JGI Γνκηθέο βάζεηο δεδνκέλωλ PDB Βάζεηο δεδνκέλωλ ηαμηλόκεζεο πξωηεϊλώλ δνκώλ CATH SCOP

21 20 Βάζεηο Γεδνκέλσλ Γνληδησκάησλ ηηο ΒΓ γνληδησκάησλ θαηαρσξνχληαη νη αθνινπζίεο κεξηθψο ή πιήξσο απνθξππηνγξαθεκέλσλ γνληδησκάησλ. Ζ ΒΓ Ensembl (Hubbard et al., 2009) παξέρεη πξφζβαζε ζε γνληδηψκαηα εμειηθηηθά αλψηεξσλ επθαξπσηηθψλ νξγαληζκψλ. Παξέρεη, επίζεο, απηφκαην ζρνιηαζκφ ησλ απνζεθεπκέλσλ δεδνκέλσλ. Ζ βάζε δεδνκέλσλ Entrez Genome (Wheeler et al., 2008) παξέρεη πξφζβαζε ζε κηα πιεζψξα γνληδησκάησλ απφ πιαζκίδηα, ηνχο, αξραία, βαθηήξηα, θαη επθαξπσηηθνχο νξγαληζκνχο (Πίλαθαο 1). Βάζεηο Γεδνκέλσλ Αθνινπζηώλ Πξσηετλώλ Οη πξσηετληθέο ΒΓ πεξηιακβάλνπλ πξσηετληθέο αθνινπζίεο πνπ ζπλάγνληαη κε ππνινγηζηηθή κεηάθξαζε αθνινπζηψλ απνζεθεπκέλσλ ζηηο λνπθιενηηδηθέο βάζεηο δεδνκέλσλ ή απφ πεηξακαηηθή αιιεινχρεζε πξσηετλψλ. Γηαθξίλνληαη ζε πξσηνγελείο, νη νπνίεο πεξηιακβάλνπλ βηνινγηθά δεδνκέλα ζηελ πξσηνγελή ηνπο κνξθή (δειαδή ρσξίο πεξαηηέξσ αλάιπζε) θαη ζε δεπηεξνγελείο, νη νπνίεο πεξηέρνπλ ηα απνηειέζκαηα ηεο επεμεξγαζίαο βηνινγηθψλ δεδνκέλσλ πνπ είλαη απνζεθεπκέλα ζηηο πξσηνγελείο ΒΓ πξσηετληθψλ αθνινπζηψλ (Gautham, 2006). Πξσηνγελείο Βάζεηο Γεδνκέλσλ Αθνινπζηώλ Πξσηετλώλ Ζ PIR απνηειεί κηα πεξηεθηηθή ΒΓ πξσηετληθψλ αθνινπζηψλ κε ιεηηνπξγηθφ θαη βηβιηνγξαθηθφ ζρνιηαζκφ ησλ θαηαρσξήζεσλ (Wu et al., 2002). Ζ SwissProt (Bairoch and Apweiler, 2000) απνηειεί κηα ΒΓ πξσηετληθψλ αθνινπζηψλ ε νπνία παξέρεη πςειή πνηφηεηα κε απηνκαηνπνηεκέλνπ ζρνιηαζκνχ (π.ρ. πεξηγξαθή ηεο ιεηηνπξγίαο κηαο πξσηεΐλεο, βηβιηνγξαθηθέο αλαθνξέο θ.ν.θ), πεξηνξηζκέλν βαζκφ πιενλαζκνχ (δειαδή ρσξίο αιιειεπηθαιχςεηο) θαη δηαζχλδεζε κε άιιεο ΒΓ. Ωζηφζν, ε ζρεηηθά αξγή δηαδηθαζία ζρνιηαζκνχ ηεο SwissProt νδήγεζε ζηε δεκηνπξγία ηεο ζπκπιεξσκαηηθήο

22 21 TrEMBL (Bairoch and Apweiler, 2000). Ζ TrEMBL πεξηέρεη θαηαρσξήζεηο πνπ δελ έρνπλ θαηαρσξεζεί ζηε βάζε δεδνκέλσλ SwissProt αιιά πξνέθπςαλ απφ ηε κεηάθξαζε ησλ θαηαρσξεκέλσλ λνπθιενηηδηθψλ αθνινπζηψλ ηεο EMBL. Ο ζρνιηαζκφο ησλ θαηαρσξήζεσλ γίλεηαη απηνκαηνπνηεκέλα. Ζ UniProt (Bairoch et al., 2005) απνηειεί κηα παγθφζκηα, πιήξε θαη αλαιπηηθή ΒΓ πξσηετληθψλ αθνινπζηψλ. Δίλαη ην απνηέιεζκα ηεο ζπλεξγαζίαο ησλ SwissProt, TrEMBL θαη PIR. Σν θπξίσο ηκήκα ηεο UniProt, ε UniProtKB (UniProt knowledgebase), απνηειεί κηα ηαμηλνκεκέλε βάζε, κε αθξηβή ζρνιηαζκφ ησλ πξσηετληθψλ αθνινπζηψλ θαη εθηεηακέλε δηαζχλδεζε κε άιιεο ΒΓ (Bairoch et al., 2005). Ζ RefSeq (Pruitt et al., 2007) ηνπ NCBI απνηειεί, επίζεο, κηα πεξηεθηηθή ΒΓ άλεπ πιενλαζκνχ (Πίλαθαο 1). Γεπηεξνγελείο Βάζεηο Γεδνκέλσλ Αθνινπζηώλ Πξσηετλώλ Οη πξσηεΐλεο ζπλήζσο απαξηίδνληαη απφ κηα ή πεξηζζφηεξεο πξσηετληθέο πεξηνρέο. Ζ πξσηετληθή πεξηνρή ζρεκαηίδεηαη απφ θάζε ηκήκα κηαο πνιππεπηηδηθήο αιπζίδαο πνπ κπνξεί λα δηπισζεί αλεμάξηεηα ζε κηα ζπκπαγή, ζηαζεξή δνκή. Οη πξσηεΐλεο κε πνιχπινθε ιεηηνπξγία ζπλήζσο απνηεινχληαη απφ έλα ζπλδπαζκφ πξσηετληθψλ πεξηνρψλ πνπ αιιειεπηδξνχλ κεηαμχ ηνπο (Holland et al., 2006; Ponting and Russell, 2002). Οη ΒΓ ησλ δνκηθψλ πεξηνρψλ ή ησλ νηθνγελεηψλ πξσηετλψλ είλαη ρξήζηκεο γηα ηελ αλάιπζε ησλ πξσηετλψλ, θαη ζπγθεθξηκέλα γηα ηνλ ραξαθηεξηζκφ ηεο ιεηηνπξγίαο ηνπο. Απηέο νη ΒΓ ζπλήζσο απνθαινχληαη «βάζεηο δεδνκέλσλ πξσηετληθψλ ππνγξαθψλ» (protein signature databases), επεηδή πεξηέρνπλ ζπιινγέο ππνγξαθψλ, νη νπνίεο επηηξέπνπλ ηελ αλαγλψξηζε ησλ δνκηθψλ πεξηνρψλ ή ησλ νηθνγελεηψλ πξσηετλψλ, θαη έρνπλ πξνθχςεη απφ ηελ επεμεξγαζία πνιιαπιψλ ζηνηρίζεσλ ελφο ζπλφινπ νκφινγσλ αθνινπζηψλ πξσηετλψλ ρξεζηκνπνηψληαο πνηθίιεο κεζφδνπο πνπ πεξηγξάθνληαη παξαθάησ (Mulder and Apweiler, 2002; Wu et al., 2003). Σα κνηίβα πξνθχπηνπλ απφ πνιιαπιέο ζηνηρίζεηο ρσξίο θελά πνπ αληηζηνηρνχλ ζηα πιένλ ζπληεξεκέλα ηκήκαηα ησλ πξσηετλψλ. Ζ νκάδα ησλ κνηίβσλ πνπ παξαηεξνχληαη ζε κηα νηθνγέλεηα πξσηετλψλ νλνκάδεηαη απνηχπσκα (fingerprint) (Attwood, 2000). Ζ

23 22 θαλνληθή έθθξαζε αληηπξνζσπεχεη κηα ζπλαηλεηηθή αιιεινπρία πνπ έρεη πξνθχςεη απφ έλα ζπληεξεκέλν ηκήκα κηαο πξσηεΐλεο (Hofmann, 2000). Σα πξνθίι αληηζηνηρνχλ ζε φιν ην κήθνο κηαο πνιιαπιήο ζηνίρηζεο πξσηετλψλ πεξηιακβαλνκέλσλ θαη ησλ θελψλ (Gribskov et al., 1987). Σα Hidden Markov Models (HMMs) ζπλδένληαη ζηελά κε ηα πξνθίι θαη βαζίδνληαη ζε πηζαλνζεσξεηηθέο κεζφδνπο (Eddy, 1998) (Δηθφλα 2). Οη δεπηεξνγελείο ΒΓ ρξεζηκνπνηνχλ δηαθνξεηηθέο πξνζεγγίζεηο ή ζπλδπαζκφ πξνζεγγίζεσλ γηα ηελ εμαγσγή ηεο ππνγξαθήο κηαο πξσηετληθήο νηθνγέλεηαο. Γηα παξάδεηγκα, ε κεζνδνινγία ησλ βάζεσλ BLOCKS (Pietrokovski et al., 1996) θαη PRINTS (Attwood et al., 2003) βαζίδεηαη ζηε ρξήζε κνηίβσλ θαη απνηππσκάησλ, αληίζηνηρα. HMMs ρξεζηκνπνηνχληαη απφ ηηο ΒΓ Pfam (Finn et al., 2008) θαη SMART (Letunic et al., 2009). Ζ PROSITE (Hulo et al., 2008) βαζίδεηαη ζηε ρξήζε θαλνληθψλ εθθξάζεσλ θαη πξνθίι. Ζ βάζε CDD (Marchler-Bauer et al., 2009) ρξεζηκνπνηεί πνιιαπιέο ζηνηρίζεηο αθνινπζηψλ θαη HMMs (Δηθφλα 2 θαη Πίλαθαο 2). Κάζε βάζε δεδνκέλσλ παξνπζηάδεη δηαθνξεηηθνχο ηνκείο βέιηηζηεο εθαξκνγήο αλάινγα κε ηνπο επηδησθφκελνπο ζηφρνπο ηεο εθάζηνηε αλάιπζεο. Οη βάζεηο απηέο δηαζπλδένληαη κεηαμχ ηνπο γηα ηελ αληαιιαγή βηνινγηθψλ πιεξνθνξηψλ (Δηθφλα 2 θαη Πίλαθαο 2). Δπίζεο, θάζε ΒΓ δηαζέηεη θαηάιιεια ππνινγηζηηθά εξγαιεία γηα ηελ ηαπηνπνίεζε δνκηθψλ πεξηνρψλ ζηελ ππφ εμέηαζε αθνινπζία θαη επνκέλσο γηα ηνλ πξνζδηνξηζκφ ηεο πξσηετληθήο νηθνγέλεηαο ζηελ νπνία αλήθεη ε αθνινπζία (Mulder and Apweiler, 2002; Wu et al., 2003). Οξηζκέλεο ΒΓ παξέρνπλ αξθεηά εμεηδηθεπκέλεο κεραλέο αλαδήηεζεο, φπσο ε FingerPRINTScan (Scordis et al., 1999) ηεο PRINTS, ε ScanProsite (de Castro et al., 2006) ηεο PROSITE, θαη ε CD-Search (Marchler-Bauer and Bryant, 2004) ηνπ CDD (Πίλαθαο 2).

24 23 Ακολ.1 CGGSLINSWVVSAAHCYKS DIMLIKLKS-AASLNSR-KDSCQGSPVVCSG---K Ακολ.2 CGGILVHRWVLTAAH-ISD------YSHDLMLLRLTEPADTITDA-KDTCVGSPLMGDG---V Ακολ.3 -GGAIINSWILTAAHCVQSNN-PL----DIALIQLSS-ALEFNSVEKDVGQGSLLV-KHEPFV Ακολ.4 CGASLVSRWLVSAAHCVYGNMEPS----DIAMMHLEM-KVNYTDY-VDSCQGSPLMCQEN-WL ΠΡΟΦΗΛ (PROSITE) Μνηίβν 1 Μνηίβν 2 Μνηίβν 3 (BLOCKS) ΑΠΟΣΤΠΧΜΑ (PRINTS) [KV]-D-[STV]-[CG]-[QV]-G-S-[PL]-[LV]-[MV] Καλνληθή έθθξαζε (PROSITE) ΖΜΜ (Pfam, SMART,CDD) Δηθόλα 2: Γηάθνξνη ηύπνη ππνγξαθώλ. ηηο αγθχιεο αλαγξάθνληαη ηα ελαιιαθηηθά ακηλνμηθά θαηάινηπα γηα θάζε ζέζε πνπ παξνπζηάδεη εθθπιηζκφ. Αθνι.: Αθνινπζία Μέζνδνο Kαηαζθεπήο Πξσηετληθώλ Απνηππσκάησλ Ζ γεληθή κεζνδνινγία θαηαζθεπήο πξσηετληθψλ απνηππσκάησλ πεξηγξάθεηαη σο εμήο: Δπηινγή πξσηετληθψλ αθνινπζηψλ απφ νξγαληζκνχο αληηπξνζσπεπηηθψλ ηαμηλνκηθψλ νκάδσλ. Πνιιαπιή ζηνίρηζε θαη επεμεξγαζία ησλ πξσηετληθψλ αθνινπζηψλ κε ρξήζε ηνπ πξνγξάκκαηνο CINEMA (Colour INteractive Editor for Multiple Alignments) (Pettifer et al., 2009). Δμαγσγή ζπλφισλ πξσηετληθψλ κνηίβσλ απφ ηελ πνιιαπιή γξακκηθή ζηνίρηζε ησλ αθνινπζηψλ. Καηαζθεπή απνηππσκάησλ κε ηε ρξήζε ηνπ ινγηζκηθνχ Scan and Compare, κηα επαλαιεπηηθή δηαδηθαζία φπνπ ηα κνηίβα ηνπ απνηππψκαηνο ρξεζηκνπνηνχληαη σο «αληρλεπηέο» γηα ηελ αλαδήηεζε νκνηνηήησλ ζηε βάζε δεδνκέλσλ Swiss-

25 24 Prot/TrEMBL. Ζ δηαδηθαζία νινθιεξψλεηαη φηαλ δελ κπνξνχλ λα βξεζνχλ επηπιένλ αθνινπζίεο ζηε ΒΓ νη νπνίεο λα ζηνηρίδνληαη κε ηα κνηίβα. Καηά απηφλ ηνλ ηξφπν, δεκηνπξγείηαη έλαο πίλαθαο ζπρλνηήησλ (frequency matrix) πνπ πεξηγξάθεη ηε ζπρλφηεηα ησλ ακηλνμηθψλ θαηαινίπσλ ζε θάζε ζέζε ηεο αθνινπζίαο ησλ κνηίβσλ. Μεηά απφ θάζε «πέξαζκα» ησλ κνηίβσλ απφ ηε ΒΓ (database pass) ε ζπρλφηεηα ησλ ακηλνμέσλ ζε θάζε ζέζε επαπμάλεηαη, νχησο ψζηε ηα κνηίβα πνπ παξάγνληαη λα ραξαθηεξίδνπλ εηδηθά ηελ νηθνγέλεηα απφ ηελ νπνία πξνήιζαλ. Σα απνηππψκαηα ζρνιηάδνληαη κε ηε ρξήζε βηβιηνγξαθηθψλ αλαθνξψλ θαη εξγαιείσλ πιεξνθνξηθήο φπσο ην PRECIS (Protein Reports Engineered from Concise Information in Swiss-Prot; (Mitchell et al., 2003). Καηαρψξεζε ησλ απνηππσκάησλ ζηε δεπηεξνγελή πξσηετληθή βάζε δεδνκέλσλ PRINTS (http://www.bioinf.man.ac.uk/dbbrowser/prints;(attwood et al., 2003) εκεησηένλ, ηα απνηππψκαηα ησλ δηαθoξεηηθψλ νηθνγελεηψλ δελ είλαη αιιεινεπηθαιππηφκελα σο εθ ηνχηνπ κπνξνχλ λα ρξεζηκνπνηεζνχλ γηα ηνλ έγθπξν εληνπηζκφ θαηλνθαλψλ κειψλ ηεο νηθνγέλεηαο. Γνκηθέο Βάζεηο Γεδνκέλσλ Ζ PDB (Protein Data Bank) (Berman et al., 2000) απνηειεί κηα δηεζλή απνζήθε πεηξακαηηθά πξνζδηνξηζκέλσλ ηξηηνηαγψλ δνκψλ πξσηετλψλ, λνπθιετληθψλ νμέσλ θαη ζπκπιφθσλ βηνκαθξνκνξίσλ. Δπίζεο, ε PDB παξέρεη κηα ζπιινγή εξγαιείσλ ινγηζκηθνχ γηα ηελ αλάιπζε ησλ καθξνκνξηαθψλ δνκψλ (Πίλαθαο 1). Βάζεηο Γεδνκέλσλ Σαμηλόκεζεο Γνκώλ Πξσηετλώλ Οη ΒΓ απηέο απνηεινχλ ηαμηλνκήζεηο πξσηετληθψλ δνκψλ ηεο PDB κε βάζε ηηο εμειηθηηθέο θαη δνκηθέο ηνπο ζρέζεηο. ηε ΒΓ CATH (Pearl et al., 2005), νη δνκέο

26 25 ηαμηλνκνχληαη βάζεη ησλ θαηεγνξηψλ: Class (ηάμε), Architecture (αξρηηεθηνληθή), Topology (ηνπνινγία), θαη Homology (νκνινγία). ηε βάζε SCOP (Structural Classification Of Proteins) (Andreeva et al., 2004) νη πξσηετληθέο δνκέο ηαμηλνκνχληαη ηεξαξρηθά ζε νηθνγέλεηεο, ππεξνηθνγέλεηεο, πηπρψζεηο, θαη ηάμεηο (Πίλαθαο 1). Πίλαθαο 2. Βάζεηο δεδνκέλσλ ησλ πξσηετληθώλ ππνγξαθώλ Βάζε δεδνκέλσλ BLOCKS CDD Pfam PRINTS PROSITE SMART URL Δργαλεία αναζήηηζης ζηις δεσηερογενείς πρωηεϊνικές ΒΓ Δξγαιείν CD-Search FingerPRINTScan ScanProsite URL

27 26 ΑΝΑΕΖΣΖΖ ΟΜΟΗΟΣΖΣΑ Δ ΒΑΔΗ ΓΔΓΟΜΔΝΧΝ ΑΚΟΛΟΤΘΗΧΝ Ζ ζχγθξηζε δπν αθνινπζηψλ επηηξέπεη ηνλ ππνινγηζκφ ηνπ βαζκνχ νκνηφηεηαο ησλ αθνινπζηψλ θαη θαη επέθηαζε ηελ εμαγσγή ζπκπεξαζκάησλ ζρεηηθά κε ηελ νκνινγία ηνπο. Ωο νκνηφηεηα νξίδεηαη ην πνζνζηφ ησλ ηαπηφζεκσλ θαηαινίπσλ κεηαμχ δπν αθνινπζηψλ. Οη αθνινπζίεο πνπ παξνπζηάδνπλ έλα βαζκφ νκνηφηεηαο ελδέρεηαη λα είλαη νκφινγεο, δειαδή πξνέξρνληαη απφ κηα θνηλή πξνγνληθή αθνινπζία θαη έρνπλ θνηλή εμειηθηηθή ηζηνξία. Ζ βηνρεκηθή ιεηηνπξγία κηαο πξσηεΐλεο θαζνξίδεηαη απφ ηε ζηεξενδνκή ηεο. Ωο εθ ηνχηνπ, εάλ νη ακηλνμηθέο αθνινπζίεο δπν πξσηετλψλ παξνπζηάδνπλ πςειφ βαζκφ νκνηφηεηαο, ηφηε ππάξρεη ζεκαληηθή πηζαλφηεηα νη δπν πξσηεΐλεο λα έρνπλ παξφκνηα ζηεξενδνκή θαη βηνινγηθή ιεηηνπξγία (Westhead, 2002). Ζ ζχγθξηζε δπν αθνινπζηψλ πξαγκαηνπνηείηαη κε ηε γξακκηθή ζηνίρηζε ησλ ακηλνμηθψλ αθνινπζηψλ. ε κηα ζηνίρηζε, νη αθνινπζίεο ηνπνζεηνχληαη ε κηα θάησ απφ ηελ άιιε, νχησο ψζηε ηα ηαπηφζεκα ή παξφκνηα θαηάινηπα λα βξίζθνληαη ζηελ ίδηα ζηήιε (matches). Δάλ ζεσξεζεί φηη κηα ζηνίρηζε αληαλαθιά ηελ εμειηθηηθή ηζηνξία δπν γνληδίσλ ή πξσηετλψλ, ηα αλφκνηα θαηάινηπα πνπ έρνπλ ζηνηρεζεί (mismatches) κπνξνχλ λα ραξαθηεξηζηνχλ σο αληηθαηαζηάζεηο πνπ ζπλέβεζαλ θαηά ηε δηάξθεηα ηεο απφθιηζεο απφ ηελ θνηλή πξνγνληθή αθνινπζία. Δπηπξνζζέησο, ζε κηα πξσηετληθή αθνινπζία ζπγθεθξηκέλα ακηλνμηθά θαηάινηπα κπνξεί λα αληηθαηαζηήζνπλ θάπνηα άιια κε παξφκνηεο θπζηθνρεκηθέο ηδηφηεηεο ρσξίο επηβιαβείο ζπλέπεηεο ζηε δνκή θαη ηε ιεηηνπξγία ηεο πξσηεΐλεο. Οη αληηθαηαζηάζεηο απηέο νλνκάδνληαη ζπληεξεηηθέο αληηθαηαζηάζεηο. Σα αξσκαηηθά ακηλνμέα ηξππηνθάλε-θαηλπιαιαλίλε θαη ηα βαζηθά ακηλνμέα ιπζίλε-αξγηλίλε απνηεινχλ παξαδείγκαηα ζπληεξεηηθψλ αληηθαηαζηάζεσλ. Δπηπιένλ, ζηηο πεξηνρέο φπνπ νη δχν αθνινπζίεο δελ ζηνηρίδνληαη εκθαλίδνληαη σο θελά ζε κηα απφ ηηο δχν αθνινπζίεο, ηα νπνία κπνξνχλ λα εξκελεπζνχλ είηε σο ελζέζεηο ζηε κηα αθνινπζία ή απαινηθέο ζηελ άιιε (Westhead, 2002) (Δηθφλα 3). Τπάξρεη έλα νξηαθφ πνζνζηφ θάησ απφ ην νπνίν ε νκνηφηεηα δπν αθνινπζηψλ δελ ζεσξείηαη αμηφπηζηε γηα ηελ αζθαιή εμαγσγή ζπκπεξαζκάησλ. ηηο πξσηετληθέο αθνινπζίεο, ην πνζνζηφ απηφ είλαη ηεο ηάμεο ηνπ 20-30%. Οη ζηνηρίζεηο κε απηφ ην πνζνζηφ νκνηφηεηαο βξίζθνληαη ζηελ επνλνκαδφκελε «δψλε ηνπ ιπθφθσηνο» (twilight zone) (Doolittle, 1981).

28 27 Ακολ.1 EPTPKQKLKEEPDREARAGVG---KDEKKHRS E + ++K KE+PDREAR +G K + RS Ακολ.2 ELSLRRKSKEDPDREARPEIGKKDKRSSRPRS Δηθόλα 3: Παξάδεηγκα ζηνίρηζεο δπν πξσηετληθώλ αθνινπζηώλ. Σα ηαπηφζεκα θαηάινηπα αλαπαξίζηαληαη κε ηα αληίζηνηρα γξάκκαηα αλάκεζα ζηηο ζηνηρηδφκελεο αθνινπζίεο. Οη ζπληεξεηηθέο αληηθαηαζηάζεηο παξνπζηάδνληαη κε ην ζχκβνιν ζπλ (+). Οη παχιεο (-) ζε κηα αθνινπζία ζπκβνιίδνπλ ηα θελά. Αθνι: Αθνινπζία ηνίρηζε Αθνινπζηώλ αλά Εεύγε Ζ αλαδήηεζε νκνηφηεηαο αθνινπζηψλ ζε ΒΓ πεξηιακβάλεη ζηνίρηζε ηεο ππφ εμέηαζε αθνινπζίαο ή ηεο αθνινπζίαο επεξψηεζεο (query sequence) κε θάζε αθνινπζία ζηε ΒΓ (subject sequence). Ζ δηαδηθαζία απηή νλνκάδεηαη αλά δεχγε γξακκηθή ζηνίρηζε αθνινπζηψλ (pairwise sequence alignment). Ζ νιηθή ζηνίρηζε (global alignment) επηδηψθεη ηε βέιηηζηε επζπγξάκκηζε δπν ζπκβνινζεηξψλ πεξηιακβάλνληαο φζν ην δπλαηφλ πεξηζζφηεξνπο ραξαθηήξεο θαζ φιν ην κήθνο ηνπο. ηελ ηνπηθή ζηνίρηζε (local alignment) ζηφρνο είλαη ε επζπγξάκκηζε επηκέξνπο αθνινπζηψλ πνπ εκθαλίδνπλ πςειφ βαζκφ νκνηφηεηαο (Δηθφλα 4) (Westhead, 2002). θελό ηνπηθή ζηνίρηζε νιηθή ζηνίρηζε Δηθόλα 4: Παξάδεηγκα νιηθήο θαη ηνπηθήο ζηνίρηζεο. Οη επηκέξνπο αθνινπζίεο κε πςειφ βαζκφ νκνηφηεηαο ζπκβνιίδνληαη κε γθξί ρξψκα.

29 28 πζηήκαηα Βαζκνιόγεζεο ησλ αλά Εεύγε ηνηρίζεσλ ηελ επζπγξάκκηζε δπν ζπκβνινζεηξψλ απνδίδεηαη κηα βαζκνινγία (score). Ζ βαζκνινγία απηή θαζνξίδεηαη βάζεη ησλ ηαπηφζεκσλ θαη κε ηαπηφζεκσλ θαηαινίπσλ, ησλ αληηθαηαζηάζεσλ θαη ησλ θελψλ. Γηα παξάδεηγκα, ζηε ζηνίρηζε ηαπηφζεκσλ ακηλνμηθψλ θαηαινίπσλ απνδίδεηαη κεγαιχηεξε βαζκνινγία ζπγθξηηηθά κε ηηο αληηθαηαζηάζεηο. Δπίζεο, ζηηο ζπληεξεηηθέο αληηθαηαζηάζεηο απνδίδεηαη πςειφηεξε βαζκνινγία ζε ζρέζε κε ηηο κε ζπληεξεηηθέο αληηθαηαζηάζεηο, δηφηη ε πηζαλφηεηα λα αληηθαηαζηαζεί έλα ακηλνμχ απφ έλα άιιν κε παξφκνηεο θπζηθνρεκηθέο ηδηφηεηεο θαηά ηε δηαδηθαζία ηεο εμέιημεο είλαη κεγαιχηεξε απφ ην λα αληηθαηαζηαζεί απφ έλα αλφκνην ακηλνμχ (Westhead, 2002). Πίλαθεο Αληηθαηάζηαζεο Ακηλνμηθώλ Καηαινίπσλ Με βάζε ηα πξναλαθεξζέληα, δεκηνπξγήζεθαλ νη πίλαθεο αληηθαηάζηαζεο νη νπνίνη παξέρνπλ έλα βηνινγηθφ ππφβαζξν ζηνπο καζεκαηηθνχο ηχπνπο πνπ νξίδνπλ ηελ νκνηφηεηα κεηαμχ λνπθιενηηδίσλ θαη ακηλνμέσλ. Οη πίλαθεο αληηθαηάζηαζεο πεξηέρνπλ ηε βαζκνινγία γηα ηηο αληηθαηαζηάζεηο ησλ ραξαθηήξσλ θαη είλαη ηεηξαγσληθνί. Έηζη, ζηελ πεξίπησζε ησλ λνπθιενηηδηθψλ αθνινπζηψλ απνηεινχληαη απφ ηέζζεξηο ζηήιεο/ζεηξέο θαη ζηελ πεξίπησζε ησλ πξσηετληθψλ αθνινπζηψλ απφ είθνζη ζηήιεο/ζεηξέο. Δπίζεο, νη πίλαθεο αληηθαηάζηαζεο είλαη ζπκκεηξηθνί εθφζνλ ε αληηθαηάζηαζε ελφο ακηλνμένο Α απφ ην ακηλνμχ Β ζεσξείηαη εμίζνπ πηζαλή κε ηελ αληηθαηάζηαζε ηνπ Β απφ ην Α (Westhead, 2002). Γπν επξχηαηα ρξεζηκνπνηνχκελνη πίλαθεο αληηθαηάζηαζεο ακηλνμέσλ είλαη νη πίλαθεο PAM (Dayhoff et al., 1978) θαη BLOSUM (Henikoff and Henikoff, 1992).

30 29 Πίλαθεο Αληηθαηάζηαζεο PAM Ζ ζεηξά πηλάθσλ αληηθαηάζηαζεο PAM (Point Accepted Mutation) (Dayhoff et al., 1978) πξνθχπηνπλ απφ ηηο ζηνηρίζεηο εμειηθηηθά θνληηλψλ αθνινπζηψλ. Ζ θαηαζθεπή ηνπο βαζίδεηαη ζηελ αξρή φηη νη παξνχζεο πξσηετληθέο αθνινπζίεο απέθθιηλαλ απφ ηηο πξνγνληθέο αθνινπζίεο κέζσ Απνδεθηψλ εκεηαθψλ Μεηαιιάμεσλ (Point Accepted Mutations). πλεπψο, ε κεηάιιαμε ελφο ακηλνμένο Α ζε έλα Β γίλεηαη απνδεθηή θαηφπηλ θπζηθήο επηινγήο. Γειαδή, ην ακηλνμχ Α κπνξεί λα αληηθαηαζηαζεί απφ ην Β κφλν φηαλ ην Β έρεη παξφκνηεο θπζηθνρεκηθέο ηδηφηεηεο κε ην Α, νχησο ψζηε λα κελ κεηαβάιιεηαη ε δνκή θαη ε ιεηηνπξγία ηεο πξσηεΐλεο. Οη πίλαθεο PAM-λ αλαθέξνληαη ζε κηα εμειηθηηθή απφζηαζε λ Απνδεθηψλ εκεηαθψλ Μεηαιιάμεσλ γηα θάζε 100 ακηλνμηθά θαηάινηπα. Έηζη, νη πίλαθεο PAM κε κεγαιχηεξνπο αξηζκνχο αληηθαηνπηξίδνπλ κεγαιχηεξεο εμειηθηηθέο απνθθιίζεηο θαη ελδείθλπληαη γηα ηε ζχγθξηζε εμειηθηηθά απνκαθξπζκέλσλ αθνινπζψλ θαη αληηζηξφθσο (Δηθφλα 5). Πίλαθεο Αληηθαηάζηαζεο BLOSUM Οη πίλαθεο BLOSUM (BLOck SUbstitution Matrix) (Henikoff and Henikoff, 1992) ππνινγίδνπλ ηελ πηζαλφηεηα αληηθαηάζηαζεο ελφο ακηλνμένο απφ έλα άιιν βαζηδφκελνη ζε πεηξακαηηθά απνδεδεηγκέλεο πηζαλφηεηεο αληηθαηάζηαζεο. Δλ αληηζέζεη κε ηνπο πίλαθεο PAM, νη πίλαθεο BLOSUM πξνθχπηνπλ απφ ηηο ζηνηρίζεηο ζπληεξεκέλσλ ακηλνμέσλ, ρσξίο θελά (BLOCKS) πνπ βξίζθνληαη ζε εμειηθηηθά απνκαθξπζκέλεο αθνινπζίεο. Έλαο πίλαθαο BLOSUM-λ πξνθχπηεη απφ ηηο παξαηεξνχκελεο αληηθαηαζηάζεηο κεηαμχ δπν πξσηετληθψλ αθνινπζηψλ νη νπνίεο έρνπλ λ% ηαπηφζεκα ακηλνμηθά θαηάινηπα. Δπνκέλσο, νη πίλαθεο BLOSUM κε κηθξφηεξνπο αξηζκνχο αληηθαηνπηξίδνπλ κεγαιχηεξεο εμειηθηηθέο απνθιίζεηο θαη αληίζηξνθα (Δηθφλα 5).

31 30 PAM 100 BLOSUM 80 PAM 160 BLOSUM 62 PAM 250 BLOSUM 45 Μηθξφηεξε απφθιηζε Μεγαιχηεξε απφθιηζε Δηθόλα 5: Αληηζηνηρία ησλ πηλάθσλ PAM θαη BLOSUM. Πνηλέο Δηζαγσγήο Κελώλ Ζ εηζαγσγή θελψλ ζε κηα ζηνίρηζε είλαη αλαγθαία πξνθεηκέλνπ λα θαηαζηεί ππνινγηζηηθά εθηθηή ε ζχγθξηζε ησλ δπν αθνινπζηψλ. Σα θελά επηδέρνληαη πνηλέο (gap penalties) πξνθεηκέλνπ λα απνθεπρζεί ε θαηαρξεζηηθή εηζαγσγή ησλ θελψλ. Σν ζχζηεκα βαζκνιφγεζεο πνηλψλ πνπ ρξεζηκνπνηείηαη επξέσο είλαη ην επνλνκαδφκελν «affine gap penalty», φπνπ ε πνηλή εηζαγσγήο ελφο θελνχ είλαη κεγαιχηεξε απφ ηελ πνηλή επέθηαζεο ηνπ θελνχ ζηα δηαδνρηθά θαηάινηπα ηεο ζπκβνινζεηξάο. Ζ επηινγή ησλ παξακέηξσλ γηα ηηο πνηλέο ησλ θελψλ εμαξηάηαη απφ ηνλ εθάζηνηε πίλαθα αληηθαηάζηαζεο πνπ ρξεζηκνπνηείηαη γηα ηε ζηνίρηζε ησλ αθνινπζηψλ. Τπνινγηζηηθέο Μέζνδνη ηνίρηζεο-blast Ζ αλαδήηεζε νκνηφηεηαο ζηηο βάζεηο δεδνκέλσλ επηδηψθεη ηε βέιηηζηε πηζαλή ζηνίρηζε ησλ αθνινπζηψλ αλά δεχγε. πλήζσο, γηα ηελ αλαδήηεζε νκνηφηεηαο ζηηο ΒΓ ρξεζηκνπνηνχληαη επξεηηθέο κέζνδνη, νη νπνίεο επηδηψθνπλ ηε γξήγνξε θαη επαίζζεηε αλαδήηεζε ησλ πηζαλφηεξσλ ζηνηρίζεσλ ρσξίο φκσο λα εγγπψληαη ηελ εχξεζε ηεο βέιηηζηεο ζηνίρηζεο. Σν παθέην ινγηζκηθνχ BLAST (Basic Local Alignment Search Tool; (Altschul et al., 1990) απνηειεί ην πιένλ δεκνθηιέο εξγαιείν γηα ηελ εχξεζε ηνπηθψλ νκνηνηήησλ κεηαμχ κηαο αθνινπζίαο

32 31 επεξψηεζεο θαη φισλ ησλ αθνινπζηψλ πνπ ηε ζπγθεθξηκέλε ζηηγκή ππάξρνπλ ζηε ΒΓ. Αξρηθά, ν αιγφξηζκνο BLAST δηαηξεί ηελ αθνινπζία επεξψηεζεο ζε επηκέξνπο αθνινπζίεο ή «ιέμεηο». Σν ηππηθφ κήθνο ησλ ιέμεσλ είλαη 3 γηα ηηο πξσηετληθέο θαη 11 γηα ηηο λνπθιενηηδηθέο αθνινπζίεο. ηε ζπλέρεηα, ν αιγφξηζκνο εληνπίδεη παξφκνηεο ιέμεηο ζηε ΒΓ κε βαζκνινγία ζηνίρηζεο κεγαιχηεξε απφ κηα ηηκή θαησθιίνπ. Σφηε, ε επζπγξάκκηζε επεθηείλεηαη θαη πξνο ηηο δπν θαηεπζχλζεηο. Ζ επέθηαζε ζπλερίδεηαη φζν ε βαζκνινγία ζηνίρηζεο είλαη κεγαιχηεξε ηεο ηηκήο θαησθιίνπ (Altschul et al., 1990; Pertsemlidis and Fondon, 2001). Καηά απηφλ ηνλ ηξφπν, πξνθχπηνπλ ζηνηρίζεηο κε ηε κεγαιχηεξε βαζκνινγία γηα κηα αθνινπζία (HSPs, High Scoring Pairs). Σα απνηειέζκαηα ηεο αλάιπζεο κε ην πξφγξακκα BLAST πεξηιακβάλνπλ κηα ιίζηα κε ηηο παξφκνηεο αθνινπζίεο πνπ βξέζεθαλ ζηε ΒΓ, ηηο ζηνηρηδφκελεο πεξηνρέο ησλ αθνινπζηψλ θαη ζηαηηζηηθά ζηνηρεία. Ζ ηειηθή βαζκνινγία ηεο θάζε ηνπηθήο ζηνίρηζεο είλαη ην άζξνηζκα ησλ βαζκνινγηψλ ησλ HSPs. Ζ ζηαηηζηηθή ζεκαληηθφηεηα κηαο ζηνίρηζεο θαζνξίδεηαη απφ ηελ E-value (Δxpectation value), ε νπνία ππνδεηθλχεη ηελ πηζαλφηεηα νη ζηνηρίζεηο λα έρνπλ πξνθχςεη ηπραία. Δπνκέλσο, κηθξφηεξε Δ-value ζπλεπάγεηαη κεγαιχηεξε πηζαλφηεηα νη ζηνηρίζεηο λα κελ έρνπλ πξνθχςεη ηπραία. Ζ ρξήζε πςειφηεξσλ E-value εμππεξεηεί ηελ εχξεζε ζηνηρίζεσλ κεηαμχ εμειηθηηθά απνκαθξπζκέλσλ αθνινπζηψλ (Altschul et al., 1990; Pertsemlidis and Fondon, 2001). Τπάξρνπλ πνιιαπιά εηδηθά πξνγξάκκαηα BLAST (Πίλαθαο 3). Κάζε πξφγξακκα παξνπζηάδεη ηδηαίηεξα πιενλεθηήκαηα αλάινγα κε ηνλ επηδησθφκελν ζηφρν θάζε αλάιπζεο. Σν πξφγξακκα PSI-BLAST (Position Specific Iterated-BLAST) απνηειεί αλαβαζκηζκέλε έθδνζε ηνπ πξνγξάκκαηνο BLAST (Altschul et al., 1997). Σν PSI- BLAST, εθαξκφδεη κηα επαλαιεπηηθή δηαδηθαζία ζηνίρηζεο, θαηά ηελ νπνία έλα πξνθίι πνπ δεκηνπξγείηαη απφ ζεκαληηθέο ζηνηρίζεηο ζην πξψην ζηάδην ηεο αλάιπζεο ρξεζηκνπνηείηαη σο επεξψηεζε ζην δεχηεξν ζηάδην ηεο αλάιπζεο. Ζ δηαδηθαζία απηή επαλαιακβάλεηαη. Σν πξφγξακκα PSI-BLAST είλαη θαηάιιειν γηα ηνλ εληνπηζκφ αζζελψλ ζηνηρίζεσλ (π.ρ. απηψλ πνπ βξίζθνληαη ζηε «δψλε ηνπ ιπθφθσηνο»). Σν πξφγξακκα ακθίδξνκν BLAST (reciprocal BLAST), πνπ είλαη κηα παξαιιαγή ηνπ βαζηθνχ πξνγξάκκαηνο BLAST (Altschul et al., 1997), αλαδεηά ηηο ακθίδξνκεο βέιηηζηεο ζηνηρίζεηο. Πξψηα, κηα αθνινπζία επεξψηεζεο Α ρξεζηκνπνηείηαη γηα ηνλ εληνπηζκφ ηεο αθνινπζίαο Β ζε κηα βάζε δεδνκέλσλ. ηε ζπλέρεηα, ε Β ρξεζηκνπνηείηαη

33 32 γηα αλαδήηεζε έλαληη ηεο ΒΓ πνπ εληνπίζηεθε ε Α. Δάλ, ην βέιηηζην HSP είλαη ε αθνινπζία Α, ηφηε νη αθνινπζίεο Α θαη Β ζεσξνχληαη νκφινγεο. Πίλαθαο 3: Δηδηθά πξνγξάκκαηα BLAST Δξγαιείν Αθνινπζία επεξώηεζεο Αθνινπζία ζηε ΒΓ ρόιηα BLASTn λνπθιενηίδηα λνπθιενηίδηα εχξεζε ζπγγεληθψλ αθνινπζηψλ BLASTp πξσηεΐλε πξσηεΐλε εχξεζε απνκαθξπζκέλσλ αθνινπζηψλ tblastn πξσηεΐλε λνπθιενηίδηα 1 εχξεζε εμσλίσλ tblastx λνπθιενηίδηα 1 λνπθιενηίδηα 1 εχξεζε ESTs 2 1 κεηάθξαζε ζηα έμη πιαίζηα αλάγλσζεο 2 ESTs: Expressed Sequence Tags

34 33 ΠΟΛΛΑΠΛΖ ΓΡΑΜΜΗΚΖ ΣΟΗΥΗΖ ΑΚΟΛΟΤΘΗΧΝ Ζ πνιιαπιή γξακκηθή ζηνίρηζε αθνινπζηψλ (multiple sequence alignment) είλαη ε ζηνίρηζε δχν ή πεξηζζφηεξσλ αθνινπζηψλ. Οη ζέζεηο πνπ θαηαιακβάλνπλ ηα ακηλνμηθά θαηάινηπα ή νη λνπθιενηηδηθέο βάζεηο ζε κηα πνιιαπιή γξακκηθή ζηνίρηζε αθνινπζηψλ αλαθέξνληαη σο «ραξαθηήξεο» (Δηθφλα 6). εκαληηθά ζπκπεξάζκαηα κπνξνχλ λα εμαρζνχλ απφ κηα πνιιαπιή γξακκηθή ζηνίρηζε αλαθνξηθά κε ηελ εμειηθηηθή ηζηνξία ησλ αθνινπζηψλ. Γηα παξάδεηγκα, κπνξεί λα πξνβιεθζνχλ νη κεηαιιάμεηο (ελζέζεηο/απαινηθέο θαη αληηθαηαζηάζεηο) πνπ εκθαλίζηεθαλ θαηά ηε δηαδηθαζία ηεο εμέιημεο. Απφ κηα πνιιαπιή γξακκηθή ζηνίρηζε πξσηετληθψλ αθνινπζηψλ κπνξνχλ, επίζεο, λα πξνζδηνξηζηνχλ ηα ακηλνμηθά θαηάινηπα πνπ είλαη απαξαίηεηα γηα ηελ εηδηθή ιεηηνπξγία κηαο πξσηεΐλεο. Παξαδείγκαηνο ράξε, εάλ έλα ακηλνμηθφ θαηάινηπν είλαη ζπληεξεκέλν ζε φιεο ηηο ζηνηρηζκέλεο πξσηετληθέο αθνινπζίεο (Δηθφλα 6), είλαη εθηθηφ λα ππνζέζνπκε φηη ην ακηλνμχ είλαη ζεκαληηθφ γηα ηε βηνρεκηθή ιεηηνπξγία, θαζψο επίζεο θαη γηα ηε ζηαζεξνπνίεζε ηεο δνκήο ηεο πξσηετλεο (Barton, 1990; Wang and Jiang, 1994). Ζ βαζηθή δηαδηθαζία γηα ηε δεκηνπξγία κηαο πνιιαπιήο γξακκηθήο ζηνίρηζεο είλαη ε εμήο: Αλαδήηεζε λνπθιετληθψλ ή ακηλνμηθψλ αθνινπζηψλ πξνο ζηνίρηζε ζε βάζεηο δεδνκέλσλ. Πεξηθνπή ησλ αθνινπζηψλ, νχησο ψζηε λα ζηνηρίδνληαη αθνινπζίεο πνπ έρνπλ παξφκνην κήθνο. Δθηέιεζε πξνγξάκκαηνο πνιιαπιήο γξακκηθήο ζηνίρηζεο. Με απηνκαηνπνηεκέλε επεμεξγαζία ηεο ζηνίρηζεο κε ηδηαίηεξε έκθαζε ζηηο πεξηνρέο πνπ είλαη «πινχζηεο» ζε θελά. Δλδείθλπηαη δηφξζσζε ηεο ζηνίρηζεο κε δηαγξαθή αθνινπζηψλ νη νπνίεο αιινηψλνπλ ηε ζηνίρηζε ζε ζεκαληηθφ βαζκφ. πλίζηαηαη ε επαλαζηνίρηζε ησλ αθνινπζηψλ ρξεζηκνπνηψληαο δηαθνξεηηθνχο πίλαθεο αληηθαηάζηαζεο θαη/ή ζχζηεκα βαζκνιφγεζεο.

35 34 Αθνι.1 Αθνι.2 Αθνι.3 Αθνι.4 Αθνι.5 GGVDSCQGDSGGPLVCNNKLQGIVSWG-MQVCAQ G-ADACQGDSGGPLVCGNVLQGLVSWGTVEPCGQ DQKDSCNGDSGGPLICNGYLQGLVSFG-KAPCGQ AGRDSCQGDSGGPVVCNGSLQGLVSWG-DYPCAR GGKSTCSGDSGGPLVCNGVLQGITSWG-SEPCAL.:*.******::*.. ***:.*:* *. 1 ζέζε=1 ραξαθηήξαο Δηθόλα 6: Πνιιαπιή γξακκηθή ζηνίρηζε πξσηετληθώλ αθνινπζηώλ. Ο αζηεξίζθνο (*) ππνδειψλεη ηαπηφζεκα ακηλνμηθά θαηάινηπα. Ζ ηειεία (.) ζπκβνιίδεη ακηλνμέα κε ζπληεξεκέλεο θπζηθνρεκηθέο ηδηφηεηεο. Ζ άλσ-θάησ ηειεία (:) ππνδεηθλχεη ακηλνμηθά θαηάινηπα κε αξθεηά ζπληεξεκέλεο θπζηθνρεκηθέο ηδηφηεηεο. Οη νξηδφληηεο παχιεο (-) αλαπαξηζηνχλ ηα θελά. Κάζε ζηήιε (ζέζε ηεο ζηνίρηζεο) αληαπνθξίλεηαη ζε έλαλ ραξαθηήξα. Αθνι.: Αθνινπζία πζηήκαηα Βαζκνιόγεζεο Πνιιαπιήο Γξακκηθήο ηνίρηζεο Αθνινπζηώλ Έλαο ηξφπνο γηα λα αμηνινγήζνπκε εάλ ε πνιιαπιή ζηίρηζε είλαη θαιήο πνηφηεηαο θαη έρεη πξαγκαηηθά βηνινγηθή ζεκαζία είλαη ε βαζκνιφγεζε ηεο ζηνίρηζεο. ηηο πνιιαπιέο ζηνηρίζεηο δελ ππάξρεη έλαο βέιηηζηνο ηξφπνο βαζκνιφγεζεο δηφηη βξίζθνληαη πνιινί ραξαθηήξεο ζε κηα ζηήιε, γεγνλφο πνπ δελ ηζρχεη κε ηηο αλά δεχγε ζηνηρίζεηο. Καηά ζπλέπεηα, ππάξρνπλ δηάθνξεο πξνζεγγίζεηο βαζκνιφγεζεο πνιιαπιψλ ζηνηρίζεσλ Σν sum-of pairs (SP) είλαη έλα ζπλεζηζκέλν ζχζηεκα βαζκνιφγεζεο, φπνπ νη βαζκνινγίεο θάζε δεχγνπο ραξαθηήξσλ πνπ βξίζθνληαη ζε κηα ζηήιε ηεο ζηνίρηζεο αζξνίδνληαη γηα λα πξνθχςεη ε ηειηθή βαζκνινγία (SP-score). Γεληθά, πςειφ SP-score ππνδειψλεη φηη ε ζηνίρηζε είλαη θαιήο πνηφηεηαο (Thompson et al., 1999). Ζ βαζκνινγία Ε (Z-score) απνηειεί έλα ελαιιαθηηθφ ζχζηεκα βαζκνιφγεζεο. Γηα λα πξνθχςεη απηφ, νη αθνινπζίεο ζηνηρίδνληαη θαη ππνινγίδεηαη ε αξρηθή βαζκνινγία. Δλ ζπλερεία, γίλεηαη ηπραία αλαδηάηαμε ησλ αθνινπζηψλ θαη ππνινγίδεηαη ν κέζνο φξνο θαη ε ηππηθή απφθιηζε ησλ «ηπραηνπνηεκέλσλ» βαζκνινγηψλ πνπ πξνθχπηνπλ απφ ηε ζχγθξηζε ησλ αλαδηαηαγκέλσλ αθνινπζηψλ. Ζ παξαπάλσ δηαδηθαζία επαλαιακβάλεηαη αξθεηέο θνξέο. Σν Z-score ηζνχηαη κε: [(αξρηθή βαζκνινγία)-(κέζνο φξνο ησλ

36 35 ηπραηνπνηεκέλσλ βαζκνινγηψλ)]/(ηππηθή απφθιηζε ησλ ηπραηνπνηεκέλσλ βαζκνινγηψλ). πκβαηηθά, βαζκνινγία Z=6 αληηπξνζσπεχεη κηα πηζαλή νκνινγία θαη βαζκνινγία Z 9 κία ζαθή νκνινγία (Barton and Sternberg, 1987). Πξννδεπηηθή Πνιιαπιή Γξακκηθή ηνίρηζε Αθνινπζηώλ Ζ πην γλσζηή θαη ζρεηηθά απνδνηηθή κέζνδνο πνιιαπιήο γξακκηθήο ζηνίρηζεο είλαη ε πξννδεπηηθή (ή ηεξαξρηθή) πνιιαπιή ζηνίρηζε αθνινπζηψλ. Ζ ζπλνπηηθή δηαδηθαζία απεηθνλίδεηαη ζηελ Δηθφλα 7. Αξρηθά, ζηνηρίδνληαη νη αθνινπζίεο αλα δεχγε θαη ππνινγίδεηαη έλαο βαζκφο νκνηφηεηαο γηα θάζε δεχγνο. Καηαζθεπάδεηαη έλα δέλδξννδεγφο (guide tree), ην νπνίν θαζνξίδεη ηε ζεηξά κε ηελ νπνία ζηνηρίδνληαη νη αθνινπζίεο. Δλ ζπλερεία, δεκηνπξγείηαη ε πνιιαπιή ζηνίρηζε μεθηλψληαο απφ ην δεχγνο ησλ πην θνληηλψλ αθνινπζηψλ θαη πξνζζέηνληαο πξννδεπηηθά ηα δεχγε ησλ πην απνκαθξπζκέλσλ αθνινπζηψλ. Απηή ε κέζνδνο έρεη ην κεηνλέθηεκα φηη ηα θελά πνπ έρνπλ εηζαρζεί ζηηο αξρηθέο ζηνηρίζεηο δηαηεξνχληαη θαη ζηηο επφκελεο ζηνηρίζεηο (Feng and Doolittle, 1987; Livingstone and Barton, 1993). Δηθόλα 7: Ζ βαζηθή ηδέα ηεο πξννδεπηηθήο πνιιαπιήο ζηνίρηζεο. Α, δέλδξννδεγφο θαη Β, ζεηξά κε ηελ νπνία ζηνηρίδνληαη νη αθνινπζίεο.

37 36 Λνγηζκηθά Παθέηα Πνιιαπιήο Γξακκηθήο ηνίρηζεο Αθνινπζηώλ Έλα απφ ηα πην δεκνθηιή θαη εχρξεζηα πξνγξάκκαηα πξννδεπηηθήο πνιιαπιήο γξακκηθήο ζηνίρηζεο αθνινπζηψλ, ην νπνίν δηαηίζεηαη ειεχζεξα κέζσ δηαδηθηχνπ, είλαη ην πξφγξακκα CLUSTALW (http://www.ebi.ac.uk/tools/clustalw2/;(thompson et al., 1994) Σν γξάκκα W ζην CLUSTALW ζπκβνιίδεη ηε ζηάζκηζε (weighting) ησλ αθνινπζηψλ. πγθεθξηκέλα, νη αθνινπζίεο κε κεγάιε κεηαμχ ηνπο νκνηφηεηα ζηαζκίδνληαη νχησο ψζηε λα κελ επεξεαζηεί ζεκαληηθά ην απνηέιεζκα ηεο ηειηθήο ζηνίρηζεο. ην πξφγξακκα γίλεηαη, επίζεο, επηιεθηηθή εηζαγσγή θελψλ ζηηο ζέζεηο πνπ νη ραξαθηήξεο δε κπνξνχλ λα ζηνηρηζηνχλ. Δπηπιένλ, ην CLUSTALW αλαζέηεη βαζκηαίεο πνηλέο θελψλ ζηηο ακηλνμηθέο αθνινπζίεο. Γηα παξάδεηγκα, ζα αλαηεζεί πςειφηεξε ηηκή πνηλήο ζε έλα απνκνλσκέλν θελφ απφ φηη ζε έλα θελφ πνπ βξίζθεηαη δίπια ζε έλα άιιν. Δπίζεο, ην πξφγξακκα παξέρεη ηε δπλαηφηεηα επαλαζηνίρηζεο ησλ αθνινπζηψλ πξνο βειηηζηνπνίεζε ησλ απνηειεζκάησλ. Αθφκα, πεξηιακβάλεη ηε δπλαηφηεηα γξαθηθήο αλαπαξάζηαζεο ηεο πνιιαπιήο ζηνίρηζεο θαη επεμεξγαζία απφ ην ρξήζηε (Barton, 1993). Έλα άιιν ππνινγηζηηθφ πξφγξακκα πξννδεπηηθήο πνιιαπιήο ζηνίρηζεο αθνινπζηψλ είλαη ην MUSCLE (http://www.ebi.ac.uk/tools/muscle/index.html). Tν πξφγξακκα απηφ εθαξκφδεη κηα παξαιιαγή ηεο πξννδεπηηθήο ζηνίρηζεο, ε νπνία είλαη γξήγνξε, αθξηβή θαη ηθαλή λα ρεηξηζηεί έλα κεγάιν αξηζκψλ αθνινπζηψλ (Edgar, 2004). Οη ζχγρξνλεο ππνινγηζηηθέο κέζνδνη πνιιαπιήο ζηνίρηζεο θάλνπλ, επίζεο, ρξήζε δνκηθήο πιεξνθνξίαο πξνθεηκέλνπ λα βειηηψζνπλ ηελ πνηφηεηα ηεο ζηνίρηζεο. Γηα παξάδεηγκα, ην PROMALS3D (http://prodata.swmed.edu/promals3d/ promals3d.php) ζηνηρίδεη ηηο πξσηετληθέο αθνινπζίεο κε βάζε ηελ ηξηηνηαγή ηνπο δνκή (Pei et al., 2008). Έλα πιενλέθηεκα ησλ κεζφδσλ απηψλ είλαη φηη, κνινλφηη είλαη αξθεηά ρξνλνβφξεο, είλαη πην αθξηβείο.

38 37 Λνγόηππα Aθνινπζηώλ Οη ζπλαηλεηηθέο αθνινπζίεο (consensus sequences) αληηπξνζσπεχνπλ ηελ παξαηεξνχκελε ζπρλφηεηα ελφο λνπθιενηηδίνπ ή ακηλνμένο ζηε ζπγθεθξηκέλε ζέζε κηαο πνιιαπιήο ζηνίρηζεο αθνινπζηψλ. Σα ινγφηππα αθνινπζηψλ (sequence logos) απνηεινχλ έλα γξαθηθφ ηξφπν αλαπαξάζηαζεο ησλ ζρεηηθψλ ζπρλνηήησλ. Ζ ρξήζε ηνπο ζπλίζηαηαη ζηελ αλαπαξάζηαζε πεξηνρψλ κηθξνχ κήθνπο φπσο είλαη ηα πξσηετληθά κνηίβα. Σα ινγφηππα δεκηνπξγνχληαη βάζεη εηδηθψλ γηα ηε ζέζε πηλάθσλ πηζαλνηήησλ (PSSMs, Position-Specific Scoring Matrices), νη νπνίνη θαηαγξάθνπλ ηελ πηζαλφηεηα εκθάληζεο ελφο λνπθιενηηδίνπ ή ακηλνμένο ζηε ζπγθεθξηκέλε ζέζε κηαο ζηνίρηζεο (Henikoff and Henikoff, 1997). Έλα δηαθεθξηκέλν πξφγξακκα γηα ηε δεκηνπξγία ινγνηχπσλ είλαη ην Weblogo (http://weblogo.berkeley.edu/logo.cgi) (Crooks et al., 2004) (Δηθφλα 8). Δηθόλα 8: Παξάδεηγκα ινγόηππνπ πξσηετληθώλ αθνινπζηώλ. Σν χςνο ησλ γξακκάησλ ζπκβνιίδεη ηε ζπρλφηεηα παξαηήξεζεο ελφο ακηλνμηθνχ θαηαινίπνπ ζηε ζπγθεθξηκέλε ζέζε. Σν ινγφηππν δεκηνπξγήζεθε κε ρξήζε ηνπ Weblogo.

39 38 ΦΤΛΟΓΔΝΔΣΗΚΖ ΑΝΑΛΤΖ Ζ θπινγέλεζε είλαη ε εθηίκεζε ηεο εμειηθηηθήο ηζηνξίαο θαη ε θπινγελεηηθή αλάιπζε είλαη ην κέζν κειέηεο ηεο. Ζ θπινγελεηηθή αλάιπζε βαζίδεηαη ζηελ πνιιαπιή ζηνίρηζε λνπθιενηηδηθψλ θαη πξσηετληθψλ αθνινπζηψλ, νη νπνίεο αληηθαηνπηξίδνπλ ηηο εμειηθηηθέο ζρέζεηο γνληδίσλ ή πξσηετλψλ. Δάλ κηα νκάδα αθνινπζηψλ ζηνηρίδνληαη πνιχ θαιά, ηφηε ελδερνκέλσο απέθιηλαλ απφ κηα θνηλή πξνγνληθή αθνινπζία. Αληίζεηα, εάλ νη αθνινπζίεο δελ ζηνηρίδνληαη θαιά, ηφηε πηζαλφλ δελ πξνήιζαλ απφ έλαλ θνηλφ πξφγνλν, αιιά κάιινλ έρνπλ κηα απνκαθξπζκέλε εμειηθηηθή ζρέζε. Οη πνιιαπιέο ζηνηρίζεηο ζηε ζπλέρεηα ηξνθνδνηνχλ πξνγξάκκαηα ππνινγηζκνχ θπινγελεηηθψλ δέλδξσλ. Τπάξρεη έλα επξχ θάζκα εθαξκνγήο ησλ κεζφδσλ θπινγελεηηθήο, ζην νπνίν, πέξαλ απφ ηε κνξηαθή θαη ζπζηεκαηηθή εμέιημε, ζπκπεξηιακβάλνληαη νη κειέηεο βηνπνηθηιφηεηαο, ε θαξκαθεπηηθή έξεπλα, νη επηδεκηνινγηθέο κειέηεο θ.ν.θ. (Graur and Li, 1999; Page and Holmes, 1998). Δπηινγή Αθνινπζηώλ γηα Φπινγελεηηθή Αλάιπζε Ζ επηινγή ησλ καθξνκνξηαθψλ αθνινπζηψλ πνπ ππφθεηληαη ζε θπινγελεηηθή αλάιπζε εμαξηάηαη απφ ηε γεληθφηεξε θηινζνθία ηεο αλάιπζεο. Γηα ηε κειέηε ζπγγελψλ νξγαληζκψλ (π.ρ. πξσηεπφλησλ) ην κηηνρνλδξηαθφ DNA (mtdna) (Moore, 1995) είλαη κηα ρξήζηκε αθνινπζία. Λφγσ ηνπ πςεινχ αξηζκνχ ελδνγελψλ κεηαιιάμεσλ πνπ έρεη ζπζζσξεχζεη, ην mtdna εμειίζζεηαη κε ηαρχηεξν ξπζκφ απφ ην ππξεληθφ DNA. Όζνλ αθνξά ηε θπινγελεηηθή αλάιπζε απνκαθξπζκέλσλ νξγαληζκψλ (π.ρ. βαθηήξηα θαη επθαξπψηεο), είλαη αλαγθαία ε κειέηε ελφο κνξίνπ ην νπνίν βξίζθεηαη ζε φινπο ηνπο δσληαλνχο νξγαληζκνχο. ε απηέο ηηο πεξηπηψζεηο ζπλίζηαηαη ην ξηβνζσκηθφ RNA (rrna) (Hillis and Dixon, 1991) ην νπνίν παξνπζηάδεη ρακειφ βαζκφ αλεθηηθφηεηαο ζηηο κεηαιιάμεηο θαη εμειίζζεηαη κε πνιχ αξγφ ξπζκφ. Γηα ηε κειέηε κηαο πξσηεΐλεο ή ζπγθεθξηκέλεο πξσηετληθήο πεξηνρήο ελδείθλπληαη νη πξσηετληθέο αθνινπζίεο (Hashimoto et al., 1994). Οη κεηαιιάμεηο ζε απηέο ηηο αθνινπζίεο «επηβηψλνπλ» ππφ ηελ πξνυπφζεζε φηη δελ έρνπλ θαηαζηξνθηθέο ζπλέπεηεο γηα ηε δνκή θαη ηε ιεηηνπξγία ηεο

40 39 πξσηεΐλεο. Απηφ νθείιεηαη ζην γεγνλφο φηη, ιφγσ ηνπ εθθπιηζκνχ ηνπ γελεηηθφπ θψδηθα, νη αιιαγέο ζηελ ηξίηε ζέζε ελφο θσδηθνλίνπ δελ επεξεάδνπλ ηελ θσδηθνπνηνχκελε ακηλνμηθή αθνινπζία. Δμειηθηηθέο ρέζεηο Οη Έλλνηεο ησλ Παξάινγσλ θαη ησλ Οξζόινγσλ Ο πξνζδηνξηζκφο ηεο αιιεινπρίαο φιν θαη πεξηζζφηεξσλ γνληδησκάησλ παξέρεη κηα πιεζψξα λνπθιενηηδηθψλ θαη πξφβιεςε ησλ θσδηθνπνηνχκελσλ πξσηετληθψλ αθνινπζηψλ. Καηά ζπλέπεηα, πξνθχπηεη ε αλάγθε γηα πξνζδηνξηζκφ ηεο έθθξαζεο ησλ λέσλ γνληδίσλ θαη ηεο βηνρεκηθήο ιεηηνπξγίαο ησλ θαηλνθαλψλ πξσηετλψλ. Έλαο γξήγνξνο, αλέμνδνο θαη απνηειεζκαηηθφο ηξφπνο γηα λα επηηεπρζεί απηφ είλαη ε κειέηε ησλ εμειηθηηθψλ ζρέζεσλ κεηαμχ ησλ αθνινπζηψλ κε θπινγελεηηθή αλάιπζε. Σν πξψην βήκα ζηε κειέηε ησλ εμειηθηηθψλ ζρέζεσλ ησλ αθνινπζηψλ είλαη ε αλαδήηεζε νκφινγσλ αθνινπζηψλ ζηηο βάζεηο δεδνκέλσλ. πλεπψο, ε ζχγθξηζε νκνιφγσλ επηηξέπεη ηε δεκηνπξγία ππνζέζεσλ ζρεηηθά κε ηελ πηζαλή ιεηηνπξγία ησλ λέσλ γνληδίσλ ή πξσηετλψλ βαζηζκέλνη απνθιεηζηηθά ζηελ νκνινγία ηνπο κε γνλίδηα θαη πξσηεΐλεο πεηξακαηηθά απνδεδεηγκέλεο ιεηηνπξγίαο. Οη ππνζέζεηο απηέο απνηεινχλ έλα θαιφ ζεκείν εθθίλεζεο γηα ην ζρεδηαζκφ πεηξακάησλ. Σα δηάθνξα είδε νκφινγσλ αθνινπζηψλ παξαηίζεληαη παξαθάησ (Δηθφλα 9): Οξζόινγεο (orthologs) είλαη νη νκφινγεο αθνινπζίεο πνπ πξνέξρνληαη απφ γεγνλφηα εηδνγέλεζεο. Δθπξνζσπνχλ γνλίδηα πξνεξρφκελα απφ έλα πξνγνληθφ γνλίδην ζηνλ ηειεπηαίν θνηλφ πξφγνλν ησλ εηδψλ κε ηα νπνία είλαη ζπλδεδεκέλα. Σείλνπλ λα έρνπλ θνηλή ιεηηνπξγία. Παξάινγεο (paralogs) είλαη νη νκφινγεο αθνινπζίεο πνπ πξνέξρνληαη απφ γνληδηαθφ δηπιαζηαζκφ. Δθπξνζσπνχλ γνλίδηα πξνεξρφκελα απφ έλα θνηλφ πξνγνληθφ γνλίδην ην νπνίν δηπιαζηάζηεθε ζε έλα είδνο θαη χζηεξα απέθιηλε. Σείλνπλ λα έρνπλ δηαθνξεηηθή ιεηηνπξγία. Ξελόινγεο (xenologs) είλαη νη νκφινγεο αθνινπζίεο πνπ πξνέξρνληαη απφ νξηδφληηα κεηαθνξά γελεηηθνχ πιηθνχ κεηαμχ δχν εηδψλ

41 40 Δηθόλα 9: Ζ ππνζεηηθή εμέιημε ελόο γνληδίνπ (γξακκέο) από έλα θνηλό πξνγνληθό γνλίδην ζε ηξία είδε Α, Β θαη Γ. Παξαηεξνχληαη δχν γεγνλφηα εηδνγέλεζεο θαη δχν γεγνλφηα γνληδηαθνχ δηπιαζηαζκνχ. Σα γνλίδηα Γ2 θαη Γ3 είλαη παξάινγα κεηαμχ ηνπο, αιιά νξζφινγα ηνπ B2. Δπίζεο, θαη ηα δχν είλαη παξάινγα ηνπ Β1 θαη νξζφινγα ηνπ A1. Σν γνλίδην ΑΒ1 πξνέθπςε απφ κεηαθνξά γελεηηθνχ πιηθνχ (ηφμν) απφ ην είδνο Β ζην είδνο Α. πλεπψο, ην ΑΒ1 είλαη μελφινγν ζε φια ηα άιια γνλίδηα. Φπινγελεηηθά Γέλδξα Ζ απαξάζηαζε ησλ θπινγελεηηθψλ ζρέζεσλ πνπ πξνθχπηνπλ απφ ηε θπινγελεηηθή αλάιπζε γίλεηαη κε ρξήζε ηνπ θπινγελεηηθνχ δέλδξνπ (Hall, 2000) (Δηθφλα 10), ην νπνίν απνηειείηαη απφ ηα εμήο βαζηθά ζηνηρεία: Σα θύιια αλαπαξηζηνχλ ηαμηλνκηθέο κνλάδεο (taxa) νη νπνίεο είλαη νκάδεο νξγαληζκψλ, εηδψλ, γνληδίσλ θιπ. Οη γξακκέο ηνπ δέλδξνπ θαινχληαη βξαρίνλεο. Σα ζεκεία πνπ ελψλνληαη νη βξαρίνλεο νλνκάδνληαη θόκβνη. Ο εζωηεξηθόο θόκβνο αληηπξνζσπεχεη ηνλ πην πξφζθαην θνηλφ πξφγνλν ησλ ηαμηλνκηθψλ κνλάδσλ πνπ πξνήιζαλ απφ απηφλ. Οη ηεξκαηηθνί θόκβνη είλαη ηα θχιια ηνπ δέλδξνπ.

42 41 Έλαο θιάδνο (clade) πεξηιακβάλεη έλαλ θφκβν θαη φιεο ηηο ηαμηλνκηθέο κνλάδεο πνπ πξνθχπηνπλ απφ απηφλ. Ο ηξφπνο δηαθιάδσζεο ηνπ δέλδξνπ νλνκάδεηαη ηνπνινγία. Δηθόλα 10: Γξαθηθή αλαπαξάζηαζε θπινγελεηηθνύ δέλδξνπ. Γέλδξν κε Ρίδα έλαληη Γέλδξνπ ρσξίο Ρίδα ην δέλδξν κε ξίδα αληηθαηνπηξίδεηαη ν πην θνληηλφο θνηλφο πξφγνλνο απφ ηνλ νπνίν πξνήιζαλ νη ππφ εμέηαζε ηαμηλνκηθέο κνλάδεο, ελ αληηζέζεη κε ην δέλδξν ρσξίο ξίδα φπνπ πεξηγξάθεηαη ε ζπζρέηηζε κεηαμχ ησλ ηαμηλνκηθψλ κνλάδσλ (Δηθφλα 11). Ζ ηνπνζέηεζε ξίδαο ζε θπινγελεηηθφ δέλδξν γίλεηαη κε δηάθνξνπο ηξφπνπο. Γηα παξάδεηγκα, εάλ δερζνχκε ηελ χπαξμε ελφο κνξηαθνχ ξνινγηνχ (δειαδή ίδην ξπζκφ εμειηθηηθήο δηαθνξνπνίεζεο γηα φιεο ηηο αθνινπζίεο) (Zuckerlandl and Pauling, 1965), ηφηε ε ξίδα βξίζθεηαη ζην ελδηάκεζν ζεκείν ηνπ καθξχηεξνπ βξαρίνλα ηνπ θπινγελεηηθνχ δέλδξνπ. Ζ ηνπνζέηεζε ηεο ξίδαο κπνξεί, επίζεο, λα γίλεη κε βάζε κηα ηαμηλνκηθή κνλάδα αλαθνξάο (outgroup) ε νπνία ζρεηίδεηαη ιηγφηεξν κε ηελ νκάδα ησλ εμεηαδφκελσλ ηαμηλνκηθψλ κνλάδσλ (Felsenstein, 2004).

43 42 Δηθόλα 11: Γξαθηθή απεηθόληζε Α, δέλδξνπ κε ξίδα θαη Β, δέλδξνπ ρσξίο ξίδα Κιαδόγξακκα έλαληη Φπινγξάκκαηνο ην θιαδφγξακκα έρεη βαξχλνπζα ζεκαζία ε ηνπνινγία θαη φρη ην κήθνο ησλ βξαρηφλσλ, ελ αληηζέζεη κε ην θπιφγξακκα φπνπ ηα κήθε ησλ βξαρηφλσλ αληηθαηνπηξίδνπλ ηελ εμειηθηηθή δηαθνξνπνίεζε (Page and Holmes, 1998) (Δηθφλα 12). Δηθόλα 12: Γξαθηθή απεηθόληζε Α, θιαδνγξάκκαηνο θαη Β, θπινγξάκκαηνο

44 43 Μέζνδνη Καηαζθεπήο ησλ Φπινγελεηηθώλ Γέλδξσλ Οη κέζνδνη πνπ ρξεζηκνπνηνχληαη γηα ηελ θαηαζθεπή δέλδξσλ κπνξνχλ λα ηαμηλνκεζνχλ ζε κεζφδνπο βαζηζκέλεο ζε απνζηάζεηο (distance methods) θαη ζε κεζφδνπο βαζηζκέλεο ζε ραξαθηήξεο ή επξεηηθέο κέζνδνη (heuristic methods). Οη κέζνδνη απφζηαζεο ππνινγίδνπλ ηηο απνζηάζεηο θάζε δεχγνπο αθνινπζηψλ ηνπ αξρηθνχ ζπλφινπ. Δλ ζπλερεία, νη αθνινπζίεο νκαδνπνηνχληαη ζχκθσλα κε ηηο θαζνξηζκέλεο απνζηάζεηο θαη θαηαζθεπάδεηαη έλα δέλδξν (Farris, 1972). Οη κέζνδνη πνπ βαζίδνληαη ζε ραξαθηήξεο αλαδεηνχλ δέλδξα πνπ βειηηζηνπνηνχλ ηελ πξνζαξκνγή ησλ δεδνκέλσλ ησλ ραξαθηήξσλ ζε έλα θπινγελεηηθφ δέλδξν. Υξεζηκνπνηνχλ ηα δεδνκέλα ησλ ραξαθηήξσλ κε ηέηνην ηξφπν, ψζηε ε ζέζε θάζε ραξαθηήξα λα εθηηκάηαη ζε ζπλάξηεζε κε ηηο ζέζεηο ησλ ππνινίπσλ ραξαθηήξσλ (Hasegawa and Fujiwara, 1993; Nei and Kumar, 2000; Page and Holmes, 1998). Μέζνδνη Βαζηζκέλεο ζηελ Απόζηαζε Ζ πην δηαδεδνκέλε κέζνδνο βαζηζκέλε ζηελ απφζηαζε είλαη απηή ηεο «Έλσζεο Γεηηφλσλ» (Mailund et al., 2006). Ζ δφκεζε ηνπ εμειηθηηθνχ δέλδξνπ μεθηλάεη κε έλα «δέλδξν-αζηέξη» φπνπ φιεο νη ηαμηλνκηθέο κνλάδεο ζπλδένληαη ζε έλαλ εζσηεξηθφ θφκβν. ηε ζπλέρεηα, ην θνληηλφηεξν δεχγνο ηαμηλνκηθψλ κνλάδσλ («γείηνλεο») ζπλδέεηαη κε έλα δηαθνξεηηθφ θφκβν. Ζ δηαδηθαζία επαλαιακβάλεηαη κέρξηο φηνπ ην «δέλδξν-αζηέξη» απνζπληεζεί ζε έλα πιήξσο δνκεκέλν δέλδξν. Μέζνδνη Βαζηζκέλεο ζε Υαξαθηήξεο Μέζνδνο Μέγηζηεο Φεηδσιόηεηαο Ζ κέζνδνο ηεο κέγηζηεο θεηδσιφηεηαο (maximum parsimony) απνζθνπεί ζηελ εχξεζε ελφο θπινγελεηηθνχ δέλδξνπ πνπ απαηηεί ηνλ ειάρηζην αξηζκφ αληηθαηαζηάζεσλ

45 44 ραξαθηήξσλ γηα ηελ εξκελεία ησλ δηαθνξψλ ησλ εμεηαδφκελσλ αθνινπζηψλ. Ζ κέζνδνο βαζίδεηαη ζηελ αξρή φηη ε απινχζηεξε εμήγεζε ησλ δεδνκέλσλ είλαη πηζαλφηεξα ε πιένλ νξζή (Huelsenbeck, 1995; Swofford et al., 1996). Μέζνδνο Μέγηζηεο Πηζαλνθάλεηαο H κέζνδνο ηεο κέγηζηεο πηζαλνθάλεηαο (maximum likelihood) είλαη κηα πηζαλνζεσξεηηθή κέζνδνο πνπ αλαδεηά ην εμειηθηηθφ κνλνπάηη κε ηε κέγηζηε πηζαλφηεηα γηα ηελ παξαγσγή ησλ δνζέλησλ δεδνκέλσλ. (Felsenstein, 1981; Huelsenbeck and Crandall, 1997). Πξόηππα Αληηθαηάζηαζεο Έρεη απνδεηρζεί φηη ηα πξφηππα αληηθαηάζηαζεο επεξεάδνπλ ζεκαληηθά ηελ θαηαζθεπή ησλ θπινγελεηηθψλ δέλδξσλ (Swofford et al., 1996). Σα πξφηππα αληηθαηάζηαζεο βαζίδνληαη ζηελ ππφζεζε φηη ε εμέιημε είλαη κηα ηπραία δηαδηθαζία πνπ βαζίδεηαη ζηηο αληηθαηαζηάζεηο κεηαμχ βάζεσλ (κεηαπηψζεηο θαη κεηαζηξνθέο) ή κεηαμχ ακηλνμηθψλ θαηαινίπσλ (Lio and Goldman, 1998). Ο ξπζκφο αληηθαηάζηαζεο ελφο ακηλνμένο απφ έλα άιιν γηα έλα κεγάιν αξηζκφ ακηλνμηθψλ αθνινπζηψλ ππνινγίδεηαη κε ην πξφηππν αληηθαηάζηαζεο JTT ησλ εξεπλεηψλ Jones, Taylor, θαη Thornton (Jones et al., 1992). πλνπηηθά, ζε έλα ζχλνιν πξσηετληθψλ αθνινπζηψλ πνπ είλαη ηαπηφζεκεο θαηά 85%, ηα πεξηζζφηεξν φκνηα δεχγε αθνινπζηψλ ζηνηρίδνληαη. Oη παξαηεξνχκελεο αληηθαηαζηάζεηο κεηαμχ ακηλνμέσλ γηα θάζε δεχγνο αθνινπζηψλ θαηαγξάθνληαη θαη θαλνληθνπνηνχληαη (Dayhoff et al., 1978). Σν πξφγξακκα JTT ζπληζηάηαη γηα ζπγγεληθέο αθνινπζίεο. Σν πξφγξακκα LG (Le and Gascuel, 2008) βαζίδεηαη ζε έλα ζχλνιν ζηνηρηδφκελσλ, εμειηθηηθά ζπγγεληθψλ θαη απνκαθξπζκέλσλ, πξσηετληθψλ αθνινπζηψλ γηα ηνλ ππνινγηζκφ ηνπ ξπζκνχ αληηθαηάζηαζεο ελφο ακηλνμηθνχ θαηαινίπνπ απφ έλα άιιν.

46 45 Αμηνιόγεζε ηνπ Φπινγελεηηθνύ Γέλδξνπ Ζ bootsrap είλαη κηα δεκνθηιήο δηαδηθαζία γηα ηελ αμηνιφγεζε ηεο ζηαζεξφηεηαο ελφο θπινγελεηηθνχ δέλδξνπ (Felsenstein, 1985; Hillis and Bull, 1993). Ζ δηαδηθαζία έρεη σο εμήο: λέα ςεπδν-ζχλνια δεδνκέλσλ δεκηνπξγνχληαη κε δεηγκαηνιεςία ζηειψλ ηπραίσλ ραξαθηήξσλ απφ ην αξρηθφ ζχλνιν. Δπεηδή ε δεηγκαηνιεςία είλαη ηπραία, κεξηθέο ζέζεηο κπνξεί λα επηιεγνχλ πεξηζζφηεξεο απφ κία θνξά, ελψ ηπραίεο άιιεο ζέζεηο κπνξεί λα κελ επηιεγνχλ θακία θνξά. Δλ ζπλερεία, θαηαζθεπάδνληαη δέλδξα βαζηζκέλα ζηα ςεπδν-ζχλνια θαη ην αξρηθφ ζχλνιν δεδνκέλσλ. Σέινο, ππνινγίδεηαη ν αξηζκφο πνπ αληηπξνζσπεχεη πφζεο θνξέο έλαο ζπγθεθξηκέλνο βξαρίνλαο εκθαλίδεηαη ζην δέλδξν. Απηφο ν αξηζκφο είλαη ε ηηκή bootstrap. Οη ηηκέο bootstrap παξέρνπλ έλδεημε ηεο ζεκαληηθφηεηαο ηεο ηνπνινγίαο ηνπ δέλδξνπ. Γεληθά, ηηκέο bootstrap κεγαιχηεξεο απφ 70% ππνδειψλνπλ φηη ν βξαρίνλαο είλαη νξζφο κε πηζαλφηεηα 95%. Έιμε ησλ Μαθξηώλ Κιαδηώλ Έλα απφ ηα πην ζεκαληηθά πξνβιήκαηα ηεο θπινγελεηηθήο αλάιπζεο είλαη ε «έιμε ησλ καθξηψλ θιαδηψλ», δειαδή ε ηάζε ησλ αξθεηά απνκαθξπζκέλσλ αθνινπζηψλ (απηέο κε ηα καθξηά θιαδηά) λα ελψλνληαη κεηαμχ ηνπο παξφιν πνπ δε ζρεηίδνληαη πξαγκαηηθά (Bergsten, 2005). Απηφ νθείιεηαη κεξηθψο ζην γεγνλφο φηη νη αθνινπζίεο κε καθξηά θιαδηά έρνπλ εμειηρζεί κε ηαρχ ξπζκφ θαη έρνπλ ζπζζσξεχζεη έλα κεγάιν αξηζκφ κεηαιιάμεσλ (ζπγθξηηηθά κε ηηο ππφινηπεο αθνινπζίεο), ν νπνίνο μεπεξλά ηνλ αξηζκφ ησλ νκφινγσλ ζέζεσλ πνπ έρνπλ δηαηεξήζεη κε ηηο πξαγκαηηθά ζπγγεληθέο ηνπο αθνινπζίεο. Απηφ έρεη σο ζπλέπεηα ηα καθξηά θιαδηά λα «έιθνληαη» κεηαμχ ηνπο. Ζ έιμε ησλ καθξηψλ θιαδηψλ έρεη σο απνηέιεζκα ηελ αιινίσζε ησλ ηηκψλ bootstrap ζε φιν ην δέλδξν. Έλαο απνηειεζκαηηθφο ηξφπνο λα εμεηάζνπκε εάλ είλαη ηα καθξηά θιαδηά πνπ δεκηνπξγνχλ ην πξφβιεκα, είλαη λα αθαηξέζνπκε απηέο ηηο αθνινπζίεο απφ ην ζχλνιν δεδνκέλσλ θαη λα εμεηάζνπκε εάλ νη ηηκέο bootstrap απμάλνληαη. Ζ κέζνδνο ηεο κέγηζηεο πηζαλνθάλεηαο θαίλεηαη λα επεξεάδεηαη ζε κηθξφηεξν βαζκφ απφ ην πξφβιεκα ηεο έιμεο ησλ καθξηψλ θιαδηψλ (Hillis et al., 1994).

47 46 Λνγηζκηθά Παθέηα Φπινγελεηηθήο Αλάιπζεο Έλαο κεγάινο αξηζκφο πξνγξακκάησλ θπινγελεηηθήο αλάιπζεο δηαηίζεληαη ζην δηαδίθηπν. Έλα πεξηεθηηθφ παθέην θπινγελεηηθήο αλάιπζεο είλαη ην MEGA (http://www.megasoftware.net;(kumar et al., 2008), ην νπνίν θαηαζθεπάδεη δέλδξα κε ηηο κεζφδνπο απφζηαζεο θαη κέγηζηεο θεηδσιφηεηαο. Δπηπιένλ, παξέρεη ηε δπλαηφηεηα γξαθηθήο αλαπαξάζηαζεο ησλ δέλδξσλ. Γηα θπινγελεηηθέο αλαιχζεηο κε ηε κέζνδν ηεο κέγηζηεο πηζαλνθάλεηαο, πξνηείλεηαη ην πξφγξακκα PHYML (PHYlogenetic analysis using Maximum Likelihood) (http://www.atgc-montpellier.fr/phyml/;(guindon et al., 2005). Tν ζπγθεθξηκέλν πξφγξακκα θαηαζθεπάδεη αξρηθά έλα δέλδξν κε ηε κέζνδν ηεο «Έλσζεο Γεηηφλσλ» θαη ζηε ζπλέρεηα αλαδεηά ην πην πηζαλνθαλέο δέλδξν ρξεζηκνπνηψληαο έλαλ αιγφξηζκν «αλάβαζεο ιφθνπ» (hillclimbing algorithm). Δπίζεο, ηo πξφγξακκα απηφ είλαη ηθαλφ λα ρεηξηζηεί κεγάια ζχλνια δεδνκέλσλ. Τπνινγηζηηθά Πξνγξάκκαηα Γξαθηθήο Αλαπαξάζηαζεο Γέλδξσλ Τπάξρνπλ δηάθνξα πξνγξάκκαηα γξαθηθήο αλαπαξάζηαζεο θπινγελεηηθψλ δέλδξσλ ειεχζεξα δηαζέζηκα ζην δηαδίθηπν φπσο ην Dendroscope (http://www-ab.informatik.unituebingen.de/software/dendroscope;(huson et al., 2007) θαη ην NJPLOT (http://pbil.univlyon1.fr/software/njplot.html;(perriere and Gouy, 1996), ηα νπνία δηαρεηξίδνληαη ηππηθά αξρεία δέλδξσλ. Σα πξνγξάκκαηα απηά, πέξαλ απφ ην ζρεδηαζκφ δέλδξσλ, παξέρνπλ ηε δπλαηφηεηα ζην ρξήζηε γηα δηάθνξνπο γξαθηθνχο ρεηξηζκνχο. Γηα παξάδεηγκα, πξνγξάκκαηα φπσο ην Dendroscope επηηξέπνπλ ζην ρξήζηε λα ρεηξηζηεί ηελ εκθάληζε ηεο θαηάηαμεο ησλ δηαθιαδψζεσλ ηνπ δέλδξνπ, ηελ ηνπνζέηεζε ηεο ξίδαο ζην δέλδξν, ηελ εκθάληζε ελφο ζπγθεθξηκέλνπ θιάδνπ θαη ησλ δηαθφξσλ εηδψλ δέλδξσλ θ.ν.θ.

48 47 ΤΠΟΛΟΓΗΣΗΚΔ ΜΔΘΟΓΟΗ ΑΝΑΛΤΖ ΣΖ ΠΡΧΣΔΨΝΗΚΖ ΓΟΜΖ Μνξηαθή Απεηθόληζε Σα ππνινγηζηηθά πξνγξάκκαηα κνξηαθήο απεηθφληζεο παξέρνπλ ηε δπλαηφηεηα απεηθφληζεο κηαο πξσηετληθήο δνκήο βάζεη ησλ αηνκηθψλ ζπληεηαγκέλσλ κε ηε δεκηνπξγία ελφο εηθνληθνχ ηξηζδηάζηαηνπ πεξηβάιινληνο ηεο ππν εμέηαζε πξσηεΐλεο. Οη πξσηετληθέο δνκέο απεηθνλίδνληαη κε γξαθηθέο αλαπαξαζηάζεηο ηνπ ηχπνπ ρσξνπιεξσηηθφ κνληέιν, κνληέιν ηεο θνξδέιαο, κνληέιν ηνπ πνιππεηπηδηθνχ ζθειεηνχ θαη κνληέιν ησλ ζπξκάησλ. Δπηπξνζζέησο, ηα πξνγξάκκαηα γξαθηθήο αλαπαξάζηαζεο παξέρνπλ ηε δπλαηφηεηα επηινγήο θαη εκθάληζεο ζπγθεθξηκέλσλ αηφκσλ, ην ρξσκαηηζκφ αηφκσλ κε βάζε δηάθνξεο ηδηφηεηεο θαη ηελ εκθάληζε ησλ αιιειεπηδξάζεσλ ηεο πξσηεΐλεο κε ην ππφζηξσκα (Tramontano, 2005). Σν RasMol (http://www.umass.edu/microbio/rasmol/;(sayle and Milner-White, 1995) θαη ην PyMol (http://www.pymol.org/) απνηεινχλ νινθιεξσκέλα ππνινγηζηηθά παθέηα κνξηαθήο απεηθφληζεο, ηα νπνία ρξεζηκνπνηνχλ αξρεία ζε κνξθή PDB format. Πξόβιεςε ηεο Γεπηεξνηαγνύο Γνκήο ησλ Πξσηετλώλ Ζ δεπηεξνηαγήο δνκή κηαο πξσηεΐλεο θαζνξίδεηαη απφ ηηο α-έιηθεο, ηηο β-πηπρσηέο επηθάλεηεο θαη ηηο ζηξνθέο. Ζ πξφγλσζε ηεο δεπηεξνηαγνχο δνκήο απνζθνπεί ζηελ πξφβιεςε πεξηνρψλ πνπ δηακνξθψλνπλ ηηο α-έιηθεο, ηηο β-πηπρσηέο επηθάλεηεο θαη ηηο ζηξνθέο ζηελ ππφ εμέηαζε αθνινπζία-ζηφρν. Γεδνκέλνπ φηη ε πξσηνηαγήο αθνινπζία κηαο πξσηεΐλεο θαζνξίδεη ηελ ηξηηνηαγή δνκή ηεο, ηφηε είλαη εθηθηή ε πξφγλσζε ηεο δεπηεξνηαγνχο δνκήο κηαο πξσηεΐλεο βάζεη ηεο αθνινπζίαο. Τπάξρνπλ δηάθνξεο ππνινγηζηηθέο ηερληθέο πξφγλσζεο ηεο δεπηεξνηαγνχο δνκήο, νη νπνίεο ρξεζηκνπνηνχλ δηαθνξεηηθέο πξνζεγγίζεηο. Οη επξεηηθέο κέζνδνη ζπγθξίλνπλ ηελ αθνινπζία κηαο πξσηεΐλεο άγλσζηεο δνκήο (πξσηεΐλε αλαθνξάο, κήηξα) κε αθνινπζίεο πξσηετλψλ

49 48 γλσζηήο δνκήο (πξσηεΐλε-πξφηππν), νη νπνίεο είλαη απνζεθεπκέλεο ζηηο δνκηθέο βάζεηο δεδνκέλσλ. Δάλ βξεζεί θάπνηα πξσηεΐλε-πξφηππν κε θαηάιιειν πνζνζηφ νκνηφηεηαο, ηφηε απηή κπνξεί λα ρξεζηκνπνηεζεί γηα ηελ πξφβιεςε ηεο δεπηεξνηαγνχο δνκήο ηεο πξσηεΐλεο-ζηφρνπ. Απηή ε πξνζέγγηζε ελδείθλπηαη ζηηο πεξηπηψζεηο πνπ νη αθνινπζίεο ησλ πξσηετλψλ ζηφρνπ-πξνηχπνπ κνηξάδνληαη πςειφ βαζκφ νκνηφηεηαο (Tramontano, 2005). Σν ππνινγηζηηθφ πξφγξακκα FDM (Cheng et al., 2005a) βαζίδεηαη ζε απηή ηε κέζνδν. πγθεθξηκέλα, ζπγθξίλεη ηελ ππφ εμέηαζε αθνινπζία κε ηηο αθνινπζίεο ησλ γλσζηψλ πξσηετληθψλ δνκψλ ηεο PDB ρξεζηκνπνηψληαο ην πξφγξακκα BLAST γηα ηελ αλαγλψξηζε ελφο ή πεξηζζφηεξσλ αθνινπζηψλ-πξνηχπσλ. Τπάξρνπλ κέζνδνη πνπ βαζίδνληαη ζηελ επνλνκαδφκελε αξρή ηεο «πξνδηάζεζεο γηα ζπγθεθξηκέλε δεπηεξνηαγή δνκή» (secondary structure propensity), φηη δειαδή ππάξρνπλ ακηλνμηθά θαηάινηπα ηα νπνία έρνπλ κεγαιχηεξε πηζαλφηεηα λα βξίζθνληαη ζε ζπγθεθξηκέλε δεπηεξνηαγή δνκή απφ φηη άιια ακηλνμέα. Γηα παξάδεηγκα, ην αζπαξαγηληθφ νμχ ηείλεη λα βξίζθεηαη ζηηο α-έιηθεο, ε βαιίλε ζηηο β-πηπρσηέο επηθάλεηεο, ελψ ε πξνιίλε θαη ε γιπθίλε ζπλήζσο απαληψληαη ζηηο ζηξνθέο. Σν πξφγξακκα GOR (Sen et al., 2005) ελ κέξεη θάλεη ρξήζε απηήο ηεο κεζφδνπ. Άιιεο κέζνδνη βαζίδνληαη ζε «εμειηθηηθή πιεξνθνξία», ε νπνία εμάγεηαη απφ πνιιαπιέο ζηνηρίζεηο ζπγγεληθψλ πξσηετληθψλ αθνινπζηψλ. Σα πξνθίι πνπ πξνθχπηνπλ απφ ηηο πνιιαπιέο ζηνηρίζεηο κε ην πξφγξακκα PSI-BLAST ρξεζηκνπνηνχληαη γηα ηελ εθπαίδεπζε ηερλεηψλ λεπξσληθψλ δηθηχσλ (artificial neural networks) πξνο βειηηζηνπνίεζε ησλ πξνγλψζεσλ. Τπνινγηζηηθά πξνγξάκκαηα πνπ εθαξκφδνπλ ηελ πξναλαθεξζείζα κέζνδν γηα πξφγλσζε δεπηεξνηαγνχο δνκήο είλαη ηα αθφινπζα: PSIPRED (McGuffin et al., 2000), Jpred (Cole et al., 2008), Porter (Pollastri and McLysaght, 2005), SSpro (Cheng et al., 2005b) θαη GOR (Sen et al., 2005). Σν πξφγξακκα CDM (Consensus Data Mining) βειηηψλεη ηελ πξφγλσζε ηεο δεπηεξνηαγνχο δνκήο ζπλδπάδνληαο ηα πξνηεξήκαηα πνπ παξέρνπλ ηα πξνγξάκκαηα FDM θαη GOR

50 ΜΔΡΟ Η: ΦΤΣΗΚΔ DNA ΜΔΘΤΛΟΜΔΣΑΦΟΡΑΔ 49

51 50 ΔΗΑΓΧΓΖ Μεζπιίσζε Κπηνζηλώλ ζην Γνληδησκαηηθό DNA ησλ Φπηώλ Ζ κεηαθνξά κηαο κεζπινκάδαο ζηε ζέζε C5 ηεο θπηνζίλεο απνηειεί ζπλήζε ρεκηθή ηξνπνπνίεζε ηνπ γνληδησκαηηθνχ DNA ζηνπο εμειηθηηθά αλψηεξνπο επθαξπσηηθνχο νξγαληζκνχο (Hermann et al., 2004). ην γνληδίσκα ησλ νξγαληζκψλ απηψλ ππάξρνπλ αθνινπζίεο πινχζηεο ζε CpG δηλνπθιενηίδηα, νη επνλνκαδφκελεο λεζίδεο CpGs, νη νπνίεο ζπλήζσο βξίζθνληαη ζην 5 άθξν ησλ γνληδίσλ, πιεζίνλ ησλ ζεκείσλ έλαξμεο ηεο αληηγξαθήο ηνπ γνληδησκαηηθνχ DNA (Antequera and Bird, 1999). Σν πνζνζηφ ησλ κεζπιησκέλσλ θπηνζηλψλ ζην γνληδησκαηηθφ DNA θπκαίλεηαη απφ 3 σο 8% ζηα ζπνλδπισηά (Hermann et al., 2004) θαη απφ 6 σο 30% ζηα θπηά (Finnegan et al., 1998). Ο πςειφο βαζκφο κεζπιησκέλσλ θπηνζηλψλ ζηα θπηά απνδίδεηαη ζην γεγνλφο φηη ζηα θπηά ε κεζπιίσζε ησλ θπηνζηλψλ ιακβάλεη ρψξα ζηα CpG δηλνπθιενηίδηα θαη ζηα CpNpG ηξηλνπθιενηίδηα (φπνπ ην N ζπκβνιίδεη νπνηνδήπνηε λνπθιενηίδην), ελψ ζηα ζπνλδπισηά ιακβάλεη ρψξα κφλν ζηα CpG δηλνπθιενηίδηα (Finnegan et al., 1998; Gruenbaum et al., 1981). Έρεη πξνηαζεί φηη ν θχξηνο ζθνπφο ηεο παξνπζίαο ησλ θαηαινίπσλ 5-κεζπινθπηνζίλεο (m 5 C) ζηα εμειηθηηθά αλψηεξα θπηά είλαη ε θαηαζηνιή ηεο κεηαγξαθήο ησλ κεηαζεηψλ ζηνηρείσλ (Finnegan et al., 1998). Σα κεηαζεηά ζηνηρεία θαζηζηνχλ ην γνληδίσκα ηνπ μεληζηή νξγαληζκνχ αζηαζέο έλεθα ησλ ελζέζεσλ ηνπο κέζα ζηα εμψληα. πλέπεηα ησλ ελζέζεσλ απηψλ είλαη ε κεηαγξαθηθή ελεξγνπνίεζε ησλ κεηαζεηψλ ζηνηρείσλ, ε νπνία νδεγεί είηε ζηελ απελεξγνπνίεζε είηε ζηε κεηαβνιή ηεο ξπζκηδφκελεο κεηαγξαθήο ησλ γνληδίσλ ηνπ μεληζηή (Kidwell and Lisch, 2001). Ζ αληίδξαζε κεηαθνξάο κηαο κεζπινκάδαο ζηελ C5 ζέζε ησλ θπηνζηλψλ θαηαιχεηαη απφ ηα έλδπκα DNA κεζπινκεηαθνξάζεο. Οη DNA κεζπινκεηαθνξάζεο ρξεζηκνπνηνχλ σο δφηε κεζπινκάδαο ηελ S-αδελνζπιν-L-κεζεηνλίλε (AdoMet). Ο θαηαιπηηθφο κεραληζκφο ησλ DNA κεζπινκεηαθνξαζψλ πεξηιακβάλεη δέζκεπζε κε νκνηνπνιηθφ δεζκφ ηεο ζεηνινκάδαο ηεο θπζηεΐλεο ηνπ ελεξγνχ θέληξνπ ηνπ ελδχκνπ ζηε ζέζε 6 ηεο θπηνζίλεο. Σα ειεθηξφληα, επνκέλσο, κεηαθέξνληαη ζηε ζέζε 5 δεκηνπξγψληαο έλα θαξβαληφλ. Δλ ζπλερεία, ην θαξβαληφλ απηφ πξνζβάιιεη ηε

52 51 κεζπινκάδα ηνπ ζπκπαξάγνληα AdoMet. Μεηά ηελ πξνζζήθε ηεο κεζπινκάδαο αθνινπζεί β-απφζπαζε πξσηνλίνπ ζηε ζέζε 5, επαλαζρεκαηηζκφο ηνπ δηπινχ δεζκνχ κεηαμχ ησλ ζέζεσλ 5 θαη 6, θαη απειεπζέξσζε ηνπ έλδπκνπ (Jeltsch, 2006) (Δηθφλα 13). Δηθόλα 13: Καηαιπηηθόο κεραληζκόο ηεο δξάζεο ησλ DNA κεζπινκεηαθνξαζώλ. Ζ αληίδξαζε αξρίδεη κε ππξελφθηιε πξνζβνιή ηεο ζεηνινκάδαο ηεο θπζηεΐλεο ζηε ζέζε 6 ηεο θπηνζίλεο-ζηφρνπ. Σν γινπηακηληθφ νμχ πνπ βξίζθεηαη ζηε ζπληεξεκέλε αθνινπζία ENV δξα σο πξσηνληνδφηεο ζηε ζέζε 3 ηεο θπηνζίλεο. Ζ αληίδξαζε νινθιεξψλεηαη κε κεηαθνξά ηεο κεζπινκάδαο ζηε ζέζε 5 θαη απειεπζέξσζε ηνπ ελδχκνπ. Ο δφηεο κεζπινκάδαο AdoMet ππνδεηθλχεηαη κε κπιε γξαθή (Σξνπνπνηεκέλν απφ(jeltsch et al., 2006). Φπηηθέο DNA Μεζπινκεηαθνξάζεο Οη θπηηθέο DNA κεζπινκεηαθνξάζεο, νη νπνίεο ζην εμήο ζα αλαθέξνληαη σο θπηηθέο DNA C5-MTs, πξαγκαηνπνηνχλ δπν ιεηηνπξγίεο: (α) αλαγλψξηζε κηαο ζπγθεθξηκέλεο λνπθιενηηδηθήο αθνινπζίαο ζηφρνπ θαη (β) θαηάιπζε ηεο κεηαθνξάο κηαο κεζπινκάδαο απφ ηνλ δφηε κεζπινκάδαο AdoMet ζηε C5 ζέζε ηεο θπηνζίλεο (Chen and Li, 2004). Οη θπηηθέο DNA C5-MTs απαξηίδνληαη απφ δπν πεξηνρέο: ηε κε-ζπληεξεκέλε ακηλνηειηθή πεξηνρή θαη ηε ζπληεξεκέλε, «θαηαιπηηθή» θαξβνμπηειηθή πεξηνρή (Chen and Li, 2004; Kumar et al., 1994) (Δηθφλα 14). Ζ δνκή ηεο C-ηειηθήο πεξηνρήο νκνηάδεη κε απηή ησλ βαθηεξηαθψλ DNA κεζπινκεηαθνξαζψλ, ε νπνία πεξηέρεη έμη ζπληεξεκέλα πξσηετληθά κνηίβα ηα νπνία είλαη «δηαγλσζηηθά» ησλ DNA κεζπινκεηαθνξαζψλ (Chen and Li, 2004; Kumar et al., 1994; Posfai et al., 1989). Ζ παξαηήξεζε απηή ππνδειψλεη φηη επθαξπσηηθνί θαη πξνθαξπσηηθνί νξγαληζκνί έρνπλ δηαηεξήζεη έλαλ θνηλφ κεραληζκφ κεζπιίσζεο ησλ θπηνζηλψλ ηνπ DNA. Δπίζεο, νη θπηηθέο DNA C5-MTs πεξηέρνπλ κηα πεξηνρή αλαγλψξηζεο ηεο αθνινπζίαο ζηφρνπ (TRD, Target Recognition Domain)

53 GK-επαλαιήςεηο 52 (Kumar et al., 1994) (Δηθφλα 14). Οη θπηηθέο DNA C5-MTs ηαμηλνκνχληαη ζε ηέζζεξηο θχξηεο νηθνγέλεηεο βάζεη ηεο πξσηνηαγνχο πξσηετληθήο ηνπο δνκήο (δειαδή, ηεο νξγάλσζεο ησλ πξσηετληθψλ πεξηνρψλ) (Chen and Li, 2004; Finnegan and Kovac, 2000). AtMET1 NLS Πεξηνρή πξόζδεζεο ζην ζύκπινθν ηεο αληηγξαθήο ηνπ DNA Πεξηνρή πινύζηα ζε βαζηθά θαη όμηλα ακηλνμέα BAH BAH _ I IV VI VIII TRD IX X 1534 CrMET1 Πεξηνρή πινύζηα ζε ζξεηνλίλεο CLS I IV VI VIII IX X 1344 AtCMT3 BAH I CD IV VI VIII IX X 839 AtDRM2 UBA VI VIII IX X I IV V 626 AtDnmt2 I IV VI VIII IX X 383 Δηθόλα 14: ρεκαηηθή απεηθόληζε ηεο πξσηνηαγνύο δνκήο ησλ θπηηθώλ DNA-C5- MTs. Σν κήθνο ησλ πξσηετληθψλ αθνινπζίσλ αλαγξάθεηαη ζην θαξβνμπηειηθφ άθξν. NLS, Nuclear Localization Signal; BAH, Bromo-Adjacent Homology domain; TRD, Target Recognition Domain; CD, ChromoDomain; UBA, UBiquitin Associated domain; CLS, Chloroplast Localization Signal.

54 53 Οηθνγέλεηα ησλ Μεζπινκεηαθνξαζώλ 1 Ζ Μεζπινκεηαθνξάζε 1 (MET1, MEthylTransferase 1,) απνηειεί ην πξψην κέινο ηεο νηθνγέλεηαο ησλ θπηηθψλ DNA C5-MTs, ην νπνίν απνκνλψζεθε απφ ην πξφηππν θπηφ Arabidopsis thaliana (Finnegan and Dennis, 1993). Απνηειείηαη απφ 1534 ακηλνμηθά θαηάινηπα θαη παξνπζηάδεη κεγαιχηεξε ζπγγέλεηα γηα ηα εκηκεζπιησκέλα ππνζηξψκαηα. Γηα ην ιφγν απηφ πηζηεχεηαη φηη ε θχξηα ιεηηνπξγία ηεο MET1 είλαη ε δηαηήξεζε ηεο κεζπιησηηθήο θαηάζηαζεο ζην γνληδίσκα ησλ θπηψλ (Finnegan and Dennis, 1993). Ζ θαηαιπηηθή C-ηειηθή πεξηνρή ηεο ΜΔΣ1, ε νπνία νκνηάδεη κε ηε κεζπινκεηαθνξάζε Dnmt1 ησλ ζειαζηηθψλ, πεξηέρεη ηα έμη δηαγλσζηηθά πξσηετληθά κνηίβα ησλ DNA κεζπινκεηαθνξαζψλ (Δηθφλα 14). Ζ N- θαη C-ηειηθή πεξηνρή ζπλδένληαη κε κηα ζεηξά ελαιιαζζφκελσλ γιπθίλσλ θαη ιπζίλσλ. ηε Ν-ηειηθή πεξηνρή δηαθξίλεηαη κηα πεξηνρή πξφζδεζεο ζην ζχκπινθν αληηγξαθήο ηνπ DNA θαη κηα αθνινπζία-ζήκα ππξεληθνχ εληνπηζκνχ (NLS, Nuclear Localization Signal,) (Hicks and Raikhel, 1993). Μηα πεξηνρή πινχζηα ζε βαζηθά ακηλνμέα βξίζθεηαη ζηηο θπηηθέο MET1, ε νπνία ζεσξείηαη πηζαλφο ζηφρνο ησλ πξσηεαζψλ (Bernacchia et al., 1998; Pradhan and Adams, 1995). Δπίζεο, δηαθξίλεηαη κηα πεξηνρή πινχζηα ζε γινπηακηληθά θαη αζπαξαγηληθά νμέα. Παξφιν πνπ ν ξφινο ηεο πεξηνρήο απηήο δελ έρεη απνζαθεληζζεί, ε ζπληήξεζε ησλ φμηλσλ ακηλνμηθψλ θαηαινίπσλ ζηελ ίδηα ζέζε ζηηο θπηηθέο DNA C5-MTs ππνδεηθλχεη φηη ε πεξηνρή απηή ελδέρεηαη λα είλαη ζεκαληηθή γηα ηε δξάζε ηεο MET1 (Finnegan and Kovac, 2000). Γηαθξίλνληαη δπν πεξηνρέο αιιειεπίδξαζεο κε ηε ρξσκαηίλε (BAH), νη νπνίεο πηζηεχεηαη φηη εκπιέθνληαη ζε πξσηετληθέο αιιειεπηδξάζεηο θαη ζπλδένπλ ηε κεζπιίσζε κε ηελ αληηγξαθή θαη ηε κεηαγξαθή ηνπ DNA (Callebaut et al., 1999). Όιεο νη πεηξακαηηθά πξνζδηνξηζκέλεο πξσηεΐλεο ΜΔΣ1 εθθξάδνληαη ζε δηαηξνχκελα θχηηαξα (Fujimoto et al., 2006; Genger et al., 1999; Giannino et al., 2003; Nakano et al., 2000; Pradhan et al., 1998; Steward et al., 2000; Teerawanichpan et al., 2004), εληζρχνληαο ηελ ππφζεζε φηη ηα γνλίδηα πνπ θσδηθνπνηνχλ ηηο πξσηεΐλεο ΜΔΣ1 ζπλδένληαη κε ηελ αληηγξαθή ηνπ DNA κε ζθνπφ ηε δηαηήξεζε ηεο κεζπιησηηθήο θαηάζηαζεο ζην γνληδίσκα ησλ θπηψλ.

55 54 Πίλαθαο 4: Οη θπηηθέο DNA C5-MTs πνπ αλαιύζεθαλ ζηελ παξνύζα κειέηε Όλνκα πξσηεΐλεο Οξγαληζκόο Λεηηνπξγία (Βηβιηνγξαθηθή Αλαθνξά) Αξηζκόο πξόζβαζεο MET AtMET1 Arabidopsis thaliana Γηαηήξεζε κεζπιίσζεο CpG-πηζαλφλ CpNpG-ζε κνλά αληίγξαθα DNA, rrna, ζηα θεληξνκεξίδηα (Kankel et al., 2003) AtMET2a Α. thaliana Γηαηήξεζε κεζπιίσζεο? (Genger et al., 1999) AtMET2b Α. thaliana Γηαηήξεζε κεζπιίσζεο? (Genger et al., 1999) AtMET3 Α. thaliana Γηαηήξεζε κεζπιίσζεο? (Genger et al., 1999) BrMET1a Brassica rapa Γηαηήξεζε κεζπιίσζεο? (Fujimoto et al., 2006) BrMET2b B. rapa Γηαηήξεζε κεζπιίσζεο? (Fujimoto et al., 2006) CrMET1 Clamydomona Γηαηήξεζε κεζπιίσζεο CpG, CpNpG, reinhardtii CpA, CpT ζε ρισξνπιάζηεο (Nishiyama et al., 2002) AAA32829 NP_ NP_ NP_ BAF34635 BAF34636 BAB91073 CrMETL C. reinhardtii Άγλσζηε DcMET1 Daucus carota Γηαηήξεζε κεζπιίσζεο? AAC39355 (θαξόην) (Bernacchia et al., 1998) DcMET2 D. carota Γηαηήξεζε κεζπιίσζεο? (Bernacchia et al., 1998) LeMET Lycopersicon Άγλσζηε esculentum (ηνκάηα) AAC39356 CAA05207 NtMET1 Nicotiana tabacum Γηαηήξεζε κεζπιίσζεο? BAF36443 (θαπλόο) (Nakano et al., 2000) OsMET1-1 Oryza sativa Γηαηήξεζε κεζπιίσζεο? AAP44671 (όξπδα) (Teerawanichpan et al., 2004)

56 55 OsMET1-2 O. sativa Γηαηήξεζε κεζπιίσζεο? (Teerawanichpan et al., 2004) DAA01513 PpMETI Prunus persica Γηαηήξεζε κεζπιίσζεο? AAM96952 (ξνδάθηλν) (Giannino et al., 2003) PsMET Pisum sativum Γηαηήξεζε κεζπιίσζεο CpG θαη CpNpG AAC49931 (κπηδέιη) (Pradhan et al., 1998) PtMETL Populus trichocarpa Άγλσζηε jgi * VcMet1 Volvox carteri Γηαηήξεζε κεζπιίσζεο CpG ζε κεηαζεηά ζηνηρεία θαη δηαγνλίδηα (Babinger et al., 2007) ABD64771 ZmMET1 Zea mays Γηαηήξεζε κεζπιίσζεο AAG15406 (αξαβόζηηνο) (Steward et al., 2000) MmDnmt1 Mus musculus (κπο) Γηαηήξεζε κεζπιίσζεο θαη κεξηθή απαξρήο κεζπιίσζε (Goll and Bestor, 2005) P13864 CMT AaCMT Arabidopsis arenosa Άγλσζηε (Henikoff and Comai, 1998) AAB95486 AtCMT1 A. thaliana Άγλσζηε (Henikoff and Comai, 1998) AAC02660 AtCMT2 A. thaliana πλδέεηαη κε ηελ εηεξνρξσκαηίλε (Genger et al., 1999) AtCMT3 A. thaliana Γηαηήξεζε κεζπιίσζεο CpNpG ζε επαλαιακβαλφκελα ζηνηρεία ηνπ DNA θαη κεηαζεηά ζηνηρεία ζηελ εηεξνρξσκαηίλε (Bartee et al., 2001; Lindroth et al., 2001) BrCMT Β. rapa Γηαηήξεζε κεζπιίσζεο? (Fujimoto et al., 2006) AAK69757 AAK71870 BAF34637 HvCMTI Hordeum vulgare Γηαηήξεζε κεζπιίσζεο θαηά ηελ CAJ01708 (θξηζή) αλάπηπμε ηνπ ελδνζπέξκηνπ (Radchuk et al., 2005) NtCMT N. tabacum Άγλσζηε BAC53936 OsCMTL O. sativa Άγλσζηε XP_476210

57 56 OsMET2a O. sativa Άγλσζηε NP_ PtCMTL P. trichocarpa Άγλσζηε jgi * ZMET2 Z. mays Γηαηήξεζε κεζπιίσζεο CpNpG ζε κεηαζεηά ζηνηρεία (Papa et al., 2001) AAK11516 ZMET5 Z. mays Γηαηήξεζε κεζπιίσζεο CpNpG ζε κεηαζεηά ζηνηρεία (Papa et al., 2001) AAM28227 DRM AtDRM1 A. thaliana De novo κεζπιίσζε CpG, CpNpG θαη NP_ CpNpN. Γηαηήξεζε κεζπιίσζεο CpG, θαη CpNpΝ (Cao et al., 2003; Cao et al., 2000) AtDRM2 A. thaliana De novo κεζπιίσζε CpG, CpNpG θαη AAF66129 CpNpN. Γηαηήξεζε κεζπιίσζεο CpG, θαη CpNpΝ (Cao et al., 2003; Cao et al., 2000) AtDRML A. thaliana Άγλσζηε AAN12982 HvDnmt3-1 H. vulgare De novo κεζπιίσζε? Γηαθνξνπνίεζε CAJ01711 ελδνζπεξκίνπ (Radchuk et al., 2005) MtDRML1 Medicago truncatula Άγλσζηε ABE82825 MtDRML1 M. truncatula Άγλσζηε ABE92108 NtDRM1 N. tabacum De novo κεζπιίσζε CpNpG θαη CpNpN BAC67060 (Wada et al., 2003) OsDMT106 O. sativa Άγλσζηε AAT85176 OsZmet3 O. sativa Άγλσζηε AAN61474 ZmDMT106 Z. mays Άγλσζηε AAM93211 Zmet3 Z. mays Άγλσζηε AAF68437 MmDnmt3a M. musculus De novo κεζπιίσζε CpG, πηζαλφλ CpΑ (Goll and Bestor, 2005) AAC40177 MmDnmt3b M. musculus De novo κεζπιίσζε CpG (Goll and Bestor, 2005) Dnmt2 AtDnmt2L Α. thaliana Άγλσζηε, κεζπιίσζε RNA? AAC40178 NP_ (Goll et al., 2006)

58 57 CrDnmt2L C. reinhardtii Άγλσζηε jgi * OsDnmt2L O. sativa Άγλσζηε NP_ ZMET4 Z. mays Άγλσζηε AAK40306 MmDnmt2 M. musculus Μεζπιίσζε RNA? (Goll et al., 2006) AAC40130 SpPMT1 Schizosaccharomyc Άγλσζηε P40999 es pombe Gmet Geobacter Πξνθαξπσηηθή πεξηνξηζηηθή ABB30500 metallireducens κεζπινκεηαθνξάζε (Roberts et al., 2003) Προκαρσωηικές περιοριζηικές μεθσλομεηαθοράζες M. HhaI Haemophilus haemolyticus Πξνθαξπσηηθή πεξηνξηζηηθή κεζπινκεηαθνξάζε (Cheng et al., 1993) P05102 * URL : Οηθνγέλεηα ησλ Υξσκνκεζπινκεηαθνξαζώλ Οη ρξσκνκεζπινκεηαθνξάζεο (CMTs, ChromoMethylTransferases,) ραξαθηεξίδνληαη απφ ηελ έλζεζε κηαο δνκηθήο πεξηνρήο (CD, ChromoDomain,) ε νπνία ζρεηίδεηαη κε ηελ εηεξνρξσκαηίλε, κεηαμχ ησλ θαηαιπηηθψλ κνηίβσλ II θαη IV. Μέιε ηεο νηθνγέλεηαο CMT έρνπλ βξεζεί απνθιεηζηηθά ζηα θπηά (Henikoff and Comai, 1998). H πεξηνρή CD απνηειείηαη απφ πεξίπνπ 60 ακηλνμηθά θαηάινηπα θαη ζεσξείηαη φηη έρεη αξραία πξνέιεπζε (Eissenberg, 2001) δηφηη πεξηνρέο CD δηαθξίλνληαη ζηελ πξσηεΐλε Polycomb ηεο Drosophila θαη εκπιέθνληαη ζηελ θαζνδήγεζε ηεο πξσηεΐλεο απηήο ζηελ εηεξνρξσκαηίλε (Eissenberg, 2001) φπνπ νη ρξσκνκεζπινκεηαθνξάζεο δηαδξακαηίδνπλ ζεκαληηθφ ξφιν. Σν πξψην κέινο ηεο νηθνγέλεηαο CMT, ε πξσηεΐλε CMT3, απνκνλψζεθε απφ ηελ Arabidopsis thaliana (Bartee et al., 2001; Lindroth et al., 2001). Μεηάιιαμε ηνπ γνληδίνπ AtCMT3 είρε σο απνηέιεζκα ηελ απψιεηα κεζπιίσζεο ζηηο ηξηλνπθιενηηδηθέο αθνινπζίεο CpNpG (θαη κηα ειάζζσλα απψιεηα κεζπιίσζεο ζηηο δηλνπθιενηηδηθέο αθνινπζίεο CpG) ζηα θεληξνκεξίδηα, θαζψο επίζεο θαη ηελ επαλελεξγνπνίεζε κεηαζεηψλ ζηνηρείσλ (Bartee et al., 2001; Lindroth et al., 2001)

59 58 (Πίλαθαο 4). Έρεη δεηρζεί φηη νη θπηηθέο CMTs εκπιέθνληαη ζηνλ έιεγρν ησλ επαλαιακβαλφκελσλ ζηνηρείσλ DNA (Buryanov and Shevchuk, 2005). Οη πεξηνρέο CpNpG πιενλάδνπλ ζηα επαλαιακβαλφκελα ζηνηρεία ηνπ DNA, θαη απαληψληαη ζηελ εηεξνρξσκαηίλε. Δλδέρεηαη ε κεζπιίσζε ησλ ηξηλνπθιενηηδίσλ CpNpG λα έρεη εμειηρζεί γηα ηε δηαηήξεζε ηεο κεζπιησηηθήο θαηάζηαζεο ζηελ εηεξνρξσκαηίλε ηνπ γνληδηψκαηνο ησλ θπηψλ (Papa et al., 2001). Δπηπξνζζέησο, νη CMTs έρνπλ πηζαλφλ εμειηρζεί γηα ηε κεζπιίσζε θαη απελεξγνπνίεζε απηψλ ησλ κεηαζεηψλ ζηνηρείσλ κε ππνθηλεηέο πνπ δελ δηαζέηνπλ CpG αθνινπζίεο θαη, ζπλεπψο, είλαη αλζεθηηθέο ζηελ κεζπιίσζε CpG. Σα CpG δηλνπθιενηίδηα ήηαλ πηζαλφλ ε πξνηηκεζείζα αθνινπζία-ζηφρνο γηα κεζπιίσζε ζηνλ θνηλφ πξφγνλν ησλ ζπνλδπισηψλ θαη ησλ αλζνθφξσλ θπηψλ (Goll and Bestor, 2005). Μηα πεξηνρή BAH δηαθξίλεηαη ζηηο CMTs, ζε αληηδηαζηνιή κε ηηο πξσηεΐλεο MET1, νη νπνίεο πεξηέρνπλ δχν πεξηνρέο BAH (Δηθφλα 14). Όπσο αλαθέξζεθε πξνεγνπκέλσο, ε πεξηνρή BAH ζεσξείηαη φηη ζπλδέεη ηε κεζπιίσζε κε ηελ αληηγξαθή θαη κεηαγξαθή ηνπ DNA (Callebaut et al., 1999). Δπηπιένλ, ε δεχηεξε πεξηνρή BAH ζηηο πξσηεΐλεο ΜΔΣ1 ηεο νξχδεο πεξηιακβάλεη κηα ππνζεηηθή αθνινπζία-ζήκα ππξεληθνχ εληνπηζκνχ (Teerawanichpan et al., 2004). Απηά ηα ζηνηρεία καο νδεγνχλ ζηε δηαηχπσζε ηεο πξφηαζεο φηη ε πεξηνρή BAH ησλ CMTs πηζαλά λα εκπιέθεηαη ζηε δέζκεπζε ησλ πξσηετλψλ METI θαη CMT3 ζηε δηράια ηεο αληηγξαθήο ηνπ DNA γηα ηε κεζπιίσζε ησλ θαηαινίπσλ θπηνζίλεο ζηηο πεξηνρέο CpG θαη CpNpG, αληίζηνηρα, ζηνπο λενζπληηζέκελνπο θιψλνπο DNA θαηά ηε δηάξθεηα ηεο αληηγξαθήο. Καη απηφλ ηνλ ηξφπν, εμαζθαιίδεηαη ε δηαηήξεζε ηεο κεζπιησηηθήο θαηάζηαζεο θαηά ηελ θπηηαξηθή δηαίξεζε. Οηθνγέλεηα ησλ DRMs Ζ νηθνγέλεηα (DRM, Domains Rearranged Methyltransferases) απνηειείηαη απφ κέιε ηα νπνία νκνηάδνπλ πεξηζζφηεξν κε ηηο κεζπινκεηαθνξάζεο Dnmt3 ησλ ζειαζηηθψλ απ' φηη κε ηηο θπηηθέο DNA C5-MTs (Cao et al., 2000). Δλ αληηζέζεη κε ηηο Dnmt3, νη πξσηεΐλεο DRM ραξαθηεξίδνληαη απφ αλαδηάηαμε ησλ θαηαιπηηθψλ ηνπο κνηίβσλ, έηζη ψζηε ηα κνηίβα VI-X πξνεγνχληαη ησλ κνηίβσλ I-V. Δληνχηνηο, παξά ηελ αλαδηάηαμε

60 59 ησλ κνηίβσλ, ε ηξηζδηάζηαηε δνκή θαζψο θαη ε θαηαιπηηθή δξάζε ησλ πξσηετλψλ DRM δηαηεξείηαη (Cao et al., 2000). Οη πξσηεΐλεο DRM έρνπλ βξεζεί απνθιεηζηηθά ζηα θπηά. Οη αξρέηππεο πξσηεΐλεο AtDRM1 θαη AtDRM2 είλαη ππεχζπλεο γηα ηελ de novo κεζπιίσζε ησλ θαηαινίπσλ θπηνζίλεο ζε φιεο ηηο γλσζηέο αθνινπζίεο-ζηφρνπο (CpG, CpNpG, θαη CpNpN), ρξεζηκνπνηψληαο ην κεραληζκφ ηεο θαηεπζπλφκελεο απφ RNA κεζπιίσζεο ηνπ DNA (Δηθφλα 15). ηα θπηά έρεη δεηρζεί φηη κηθξά κνλφθισλα RNAs (sirna) κε νκνηφηεηα ζε αθνινπζίεο ηνπ ππνθηλεηή επάγνπλ κεζπιίσζε ζηηο αληίζηνηρεο θπηνζίλεο θαη θαηά ζπλέπεηα ηελ απελεξγνπνίεζε ησλ νκφινγσλ γνληδίσλ (Matzke and Birchler, 2005; Wassenegger et al., 1994) (Δηθφλα 15). Οη DRMs έρνπλ εμειηρζεί πηζαλφλ γηα ηε κεζπιίσζε κε-cpg αθνινπζηψλ, νη νπνίεο βξίζθνληαη απνθιεηζηηθά ζηα θπηά. Γελεηηθέο κειέηεο έρνπλ δείμεη φηη ε κεζπιίσζε ησλ κε-cpg αθνινπζηψλ ξπζκίδεηαη απφ έλα βηνινγηθφ κνλνπάηη δηαθνξεηηθφ απφ απηφ πνπ ξπζκίδεη ηε κεζπιίσζε ζηα δηλνπθιενηίδηα CpG (Gruenbaum et al., 1981). ηελ πεξίπησζε ηεο κεζπιίσζεο ησλ CpG αθνινπζηψλ, κεηά ηελ αληηγξαθή ηνπ DNA νη κεζπιησκέλεο θπηνζίλεο ζηελ πξνυπάξρνπζα αιπζίδα DNA ρξεζηκνπνηνχληαη σο κήηξεο γηα ηε κεζπιίσζε ησλ αληίζηνηρσλ κε-κεζπιησκέλσλ θπηνζηλψλ ζηε ζπγαηξηθή αιπζίδα DNA (Hermann et al., 2004). ηελ πεξίπησζε κεζπιίσζεο κε-cpg αθνινπζηψλ, φκσο, ε κεζπιίσζε ησλ αλίζηνηρσλ θπηνζηλψλ ζηε ζπγαηξηθή αιπζίδα ηνπ DNA εμαξηάηαη απφ ηε δξάζε ησλ de novo DNA κεζπινκεηαζθνξαζψλ (Chen and Li, 2004; Gruenbaum et al., 1981). Πεηξακαηηθέο κειέηεο έρνπλ δείμεη φηη νη πξσηεΐλεο DRM1/2 θαη CMT3 ζπλεξγάδνληαη γηα ηε δηαηήξεζε ηεο κεζπιησηηθήο θαηάζηαζεο ζηηο ηξηλνπθιενηηδηθέο αθνινπζίεο CpNpG θαη CpNpN (Cao and Jacobsen, 2002a; b) (Δηθφλα 15). ηελ Ν- ηειηθή πεξηνρή ησλ DRM δηαθξίλνληαη ηξεηο δνκηθέο πεξηνρέο αιιειεπίδξαζεο κε ηελ νπβηθνπτηίλε (UBA, UBiquitin Associated domain), νη νπνίεο εηθάδεηαη φηη αιιειεπηδξνχλ κε ηηο πξσηεΐλεο (Mueller and Feigon, 2002). πλεπψο, κπνξνχκε λα ππνζέζνπκε φηη νη DRMs έιθνληαη ζε ζπγθεθξηκέλεο αθνινπζίεο ηνπ DNA θαηφπηλ αιιειεπίδξαζεο ησλ πεξηνρψλ UBA κε πξσηεΐλεο ηεο ρξσκαηίλεο.

61 60 DRM1/2 De novo μεθσλίωση sirnas m CpG m CpNpG m CpNpN Διατήρηση μεθσλιωτικής κατάστασης MET1 CMT3 ET1 DRM1/2 Δηθόλα 15: Πξνηεηλόκελνο κεραληζκόο δξάζεο ησλ θπηηθώλ DNA κεζπινκεηαθνξάζσλ. Σα sirnas επηθέξνπλ de novo κεζπιίσζε ζηηο αθνινπζίεο CpG, CpNpG θαη CpNpN, ε νπνία εμαξηάηαη απφ ηηο πξσηεΐλεο DRM1 θαη DRM2. Οη πξσηεΐλεο DRMs θαη CMT3 ζπλεξγάδνληαη γηα ηε δηαηήξεζε ηεο κεζπιησηηθήο θαηάζηαζεο ζηηο ηξηλνπθιενηηδηθέο αθνινπζίεο CpNpG θαη CpNpN. Ζ πξσηεΐλε ΜΔΣ1 είλαη ππεχζπλε γηα ηε δηαηήξεζε ηεο κεζπιησηηθήο θαηάζηαζεο ζηηο δηλνπθιενηηδηθέο αθνινπζίεο CpG.

62 61 Οηθνγέλεηα ησλ DNA Μεζπινκεηαθνξαζώλ 2 Σα κέιε ηεο νηθνγέλεηαο απηήο νκνηάδνπλ κε ηηο πξνθαξπσηηθέο DNA κεζπινκεηαθνξάζεο εθφζνλ δελ πεξηιακβάλνπλ ηελ Ν-ηειηθή πεξηνρή πνπ δηαθξίλεηαη ζηηο άιιεο DNA κεζπινκεηαθνξάζεο (Chen and Li, 2004; Goll and Bestor, 2005). Οη πξνθαξπσηηθέο DNA κεζπινκεηαθνξάζεο κεζπιηψλνπλ ην DNA ηνπ μεληζηή νχησο ψζηε λα κελ ππφθεηηαη ζε πέςε (Noyer-Weidner and Trautner, 1993). Ζ επηθξαηνχζα άπνςε είλαη φηη νη επθαξπσηηθέο DNA κεζπινκεηαθνξάζεο πξνήιζαλ απφ ηηο αληίζηνηρεο πξνθαξπσηηθέο κε νξηδφληηα κεηαθνξά γελεηηθνχ πιηθνχ (Chen and Li, 2004). Ωζηφζν, δελ έρεη δεηρζεί φηη ηα έλδπκα Dnmt2 κεζπιηψλνπλ ππνζηξψκαηα DNA ζε ηθαλνπνηεηηθφ βαζκφ (Goll and Bestor, 2005). Δπηπιένλ, πεηξακαηηθή κειέηε έρεη δείμεη φηη θαηάινηπα ηεο θπηνζίλεο ζηε C5 ζέζε ζην trna Asp ησλ νξγαληζκψλ Α. thaliana, D. melanogaster, θαη Μ. musculus κεζπιηψλνληαη ζε ηθαλνπνηεηηθφ βαζκφ απφ ηελ αλζξψπηλε πξσηεΐλε DNMT2 (Goll et al., 2006). Απηή ε παξαηήξεζε καο νδεγεί ζην ζπκπέξαζκα φηη νη «ζχγρξνλεο» Dnmt2, θαζψο επίζεο θαη νη ππφινηπεο DNA κεζπινκεηαθνξάζεο ελδέρεηαη λα έρνπλ πξνέιζεη απφ «αξρέγνλεο» επθαξπσηηθέο RNA κεζπινκεηαθνξάζεο, νη νπνίεο θαηαιχνπλ ηελ αληίδξαζε κεηαθνξάο κηαο κεζπινκάδαο ζηε C5 ζέζε ησλ θπηνζηλψλ ζην RNA (Reid et al., 1999).

63 62 ΜΔΘΟΓΟΛΟΓΗΑ Ολνκαηνινγία ησλ Φπηηθώλ DNA C5-MTs Πξνθεηκέλνπ λα απνθεπρζεί νπνηαδήπνηε ζχγρπζε, ηα νλφκαηα πνπ απνδφζεθαλ ζηηο θπηηθέο πξσηετλεο DNA C5-MTs πνπ εμεηάζζεθαλ ζηελ παξνχζα κειέηε είλαη ηα νλφκαηα πνπ αλαθέξνληαη ζηηο πξσηνγελείο βηβιηνγξαθηθέο αλαθνξέο. Σν γξάκκα L (Like) ρξεζηκνπνηήζεθε σο επίζεκα ζηηο πεξηπηψζεηο πνπ δελ ππήξρε ζαθήο νλνκαηνινγία γηα ηηο θπηηθέο πξσηεΐλεο DNA C5-MTs ζηε βάζε δεδνκέλσλ GenBank. Αλαδήηεζε Οκόινγσλ Φπηηθώλ Πξσηετλώλ DNA C5-MTs ζηηο Γεκόζηεο Βάζεηο Γεδνκέλσλ Οη ραξαθηεξηζκέλεο πξσηετληθέο αθνινπζίεο ρξεζηκνπνηήζεθαλ σο «αληρλεπηέο» γηα ηελ αλαδήηεζε νκφινγσλ θπηηθψλ DNA C5-MTs ζηηο δεκφζηεο βάζεηο δεδνκέλσλ κε ρξήζε ηνπ πξνγξάκκαηνο BLASTp θαη tblastn. Οη ππνςήθηεο αθνινπζίεο ρξεζηκνπνηήζεθαλ ζε επαλαιεπηηθέο αλαδεηήζεηο. Ζ δηαδηθαζία απηή νινθιεξψζεθε φηαλ δελ ήηαλ δπλαηή ε πεξαηηέξσ ηαπηνπνίεζε θαηλνθαλψλ αθνινπζηψλ. Ζ θαηαιπηηθή πεξηνρή ησλ DNA C5-MTs (αξηζκφο θαηαρψξεζεο ζηε δεπηεξνγελή βάζε δεδνκέλσλ PFAM: PF00145) ζηηο θαηλνθαλείο αθνινπζίεο εληνπίζζεθε κε ηε κεραλή αλαδήηεζεο πνπ δηαηίζεηαη ζηε δεπηεξνγελή πξσηετληθή βάζε δεδνκέλσλ. Πνιιαπιή Γξακκηθή ηνίρηζε Αθνινπζηώλ Οη ακηλνμηθέο αθνινπζίεο ησλ θαηαιπηηθψλ πεξηνρψλ ησλ πξσηετλψλ DNA C5-MTs πνπ αλαθέξνληαη ζηνλ Πίλαθαο 4 ζηνηρίζεθαλ κε ρξήζε ηνπ ππνινγηζηηθνχ πξνγξάκκαηνο CLUSTALW. Σα κνηίβα ησλ πξσηετληθψλ αθνινπζηψλ DRM επαλαδηαηάρζεθαλ πξνο

64 63 βειηηζηνπνίεζε ηεο ζηνίρηζεο. Δπίζεο, ε πεξηνρή CD ησλ ρξσκνκεζπινκεηαθνξαζψλ δελ ζπκπεξηιήθζεθε γηα ηελ απνθπγή πνηλψλ εηζαγσγήο θελψλ. Φπινγελεηηθή Αλάιπζε Πξνθεηκέλνπ λα κειεηεζνχλ νη εμειηθηηθέο ζρέζεηο ησλ θπηηθψλ DNA C5-MTs πξσηετλψλ πξαγκαηνπνηήζεθε θπινγελεηηθή αλάιπζε. Πξνο απηή ηελ θαηεχζπλζε, θαηαζθεπάζζεθαλ θπινγελεηηθά δέλδξα κε ηηο κεζφδνπο «Έλσζεο Γεηηφλσλ», «Μέγηζηεο Φεηδσιφηεηαο» θαη «Μέγηζηεο Πηζαλνθάλεηαο» ηξνθνδνηνχκελα κε ηελ αλσηέξσ πνιιαπιή ζηνίρηζε. Σν ππνινγηζηηθφ παθέην πξνγξακκάησλ MEGA ρξεζηκνπνηήζεθε γηα ηηο κεζφδνπο Έλσζεο Γεηηφλσλ θαη Μέγηζηεο Φεηδσιφηεηαο θαη ην ππνινγηζηηθφ πξφγξακκα PhyML γηα ηε κέζνδν Μέγηζηεο Πηζαλνθάλεηαο. Ο ξπζκφο αληηθαηάζηαζεο ελφο ακηλνμένο απφ έλα άιιν ππνινγίζζεθε κε ην πξφηππν αληηθαηάζηαζεο JTT. Ζ ζεκαληηθφηεηα ηεο ηνπνινγίαο ησλ δέλδξσλ εθηηκήζεθε κε bootstrapping (100 ςεπδν-ζχλνια). Σα θπινγελεηηθά δέλδξα απεηθνλίζζεθαλ κε ην πξφγξακκα NJPLOT. Λνγόηππα Αθνινπζηώλ Οη ακηλνμηθέο αθνινπζίεο ησλ έμη θαηαιπηηθψλ κνηίβσλ ησλ θπηηθψλ πξσηετλψλ DNA C5-MTs ζηνηρίζεθαλ κε ην πξφγξακκα CLUSTALW θαη έγηλε κε απηνκαηνπνηεκέλε επεμεξγαζία. Οη αθνινπζίεο κε πνζνζηφ ηαπηφζεκσλ ακηλνμηθψλ θαηαινίπσλ κηθξφηεξν απφ 80% ηξνθνδφηεζαλ ην ππνινγηζηηθφ πξφγξακκα Weblogo γηα ηε δεκηνπξγία ινγφηππσλ.

65 64 ΑΠΟΣΔΛΔΜΑΣΑ ΚΑΗ ΤΕΖΣΖΖ Λνγόηππα Αθνινπζίαο ησλ Καηαιπηηθώλ Μνηίβσλ ησλ Φπηηθώλ DNA C5-MTs Λνγφηππα αθνινπζίαο δεκηνπξγήζεθαλ πξνθεηκέλνπ λα πξνζδηνξηζζεί ε ζπλαηλεηηθή αθνινπζία ησλ έμη πιένλ ζπληεξεκέλσλ θαηαιπηηθψλ κνηίβσλ πνπ απαληψληαη ζηηο θπηηθέο πξσηεΐλεο DNA C5-MTs. Ζ θπζηεΐλε ηνπ ελεξγνχ θέληξνπ ηνπ έλδπκνπ δηαθξίλεηαη ζην κνηίβν IV (Δηθφλα 16). Σν κνηίβν VI πεξηιακβάλεη ην ζπληεξεκέλν αζπαξαγηληθφ νμχ, ην νπνίν δηαδξακαηίδεη ζεκαληηθφ ξφιν ζηε δξάζε ησλ DNA C5-MTs (Δηθφλα 16). Δλδέρεηαη απηά ηα έμη πξσηετληθά κνηίβα λα ρξεζηκεχζνπλ σο νδεγνί γηα ηελ ηαπηνπνίεζε λέσλ θπηηθψλ DNA C5-MTs (Pavlopoulou and Kossida, 2007). Μνηίβν I * Μνηίβν IV Μνηίβν VI Μνηίβν VIII Μνηίβν IX Μνηίβν X Δηθόλα 16: Λνγόηππν αθνινπζίαο ησλ έμη ζπληεξεκέλσλ θαηαιπηηθώλ κνηίβσλ ησλ θπηηθώλ πξσηετληθώλ αθνινπζηώλ DNA C5-MTs. Ζ θαηαιπηηθή θπζηεΐλε ζπκβνιίδεηαη κε αζηεξίζθν θαη ην ζπληεξεκέλν γινπηακηληθφ νμχ κε θνπθθίδα.

66 65 Φπινγελεηηθή Αλάιπζε ησλ Φπηηθώλ DNA C5-MTs πλνιηθά, ηα ηξία θπινγελεηηθά δέλδξα είλαη ζπκβαηά (Δηθφλεο 17, 18 θαη 19). Σν δέλδξν πνπ θαηαζθεπάζζεθε κε ηε κέζνδν ηεο Μέγηζηεο Πηζαλνθάλεηαο (Δηθφλα 19) είλαη ην αληηπξνζσπεπηηθφηεξν κεηαμχ ησλ ηξηψλ δέλδξσλ. Σέζζεξηο θιάδνη πνπ αληηζηνηρνχλ ζηηο ηέζζεξηο νηθνγέλεηεο θπηηθψλ DNA κεζπινκεηαθνξάζσλ δηαθξίλνληαη ζηα δέλδξα κε πςειέο ηηκέο bootstrap (Δηθφλεο 17, 18 θαη 19). Ζ νηθνγέλεηα Dnmt2 εκθαλίδεηαη σο ε «αξραηφηεξε» νηθνγέλεηα θπηηθψλ DNA C5-ΜΣο (Δηθφλα 19). Με βάζε ηε θπινγελεηηθή αλάιπζε, ε νηθνγέλεηα CMT πηζαλά έρεη εμειηρζεί απφ ηε ζρεηηθά πην ζπγγελή νηθνγέλεηα MET1 (Δηθφλα 17, 18 θαη 19). Αληηπξφζσπνη ηεο νηθνγέλεηαο DRM πξνθαλψο έρνπλ εμειηρζεί πην πξφζθαηα ζπγθξηηηθά κε ηηο άιιεο θπηηθέο νηθνγέλεηεο (Δηθφλα 19). Καη ζηηο ηέζζεξηο νηθνγέλεηεο, νη DNA C5-MTs ησλ κνλνθνηπιήδνλσλ ζρεκαηίδνπλ μερσξηζηνχο θιάδνπο κε ηηκέο bootstrap πνπ θπκαίλνληαη απφ 74 έσο 99 (Δηθφλα 19), νδεγψληαο ζην ζπκπέξαζκα φηη νη επηκέξνπο νηθνγέλεηεο πξνέθπςαλ απφ κηα ζεηξά εμειηθηηθψλ γεγνλφησλ ηα νπνία πηζαλφλ έιαβαλ ρψξα κεηά ηνλ δηαρσξηζκφ κνλνθνηπιήδνλσλ-δηθνηπιήδνλσλ. Οη πξσηεΐλεο AtMET1, AtΜΔΣ2a, AtΜΔΣ2b θαη AtΜΔΣ3 απνηεινχλ πξνθαλψο πξντφληα δηαδνρηθψλ δηπιαζηαζκψλ ελφο πξνγνληθνχ γνληδίνπ (Genger et al., 1999) (Δηθφλα 17, 18 θαη 19). Γπν νκφινγεο πξσηεΐλεο ΜΔΣ1 έρνπλ ηαπηνπνηεζεί ζηελ φξπδα, ε OsMET1-1 θαη ε OsMET1-2 (Teerawanichpan et al., 2004). Δλ ηνχηνηο, ε OsMET1-2 παξνπζηάδεη ην κεγαιχηεξν βαζκφ νκνηφηεηαο κε ηελ AtMET1 θαη νη δπν ηνπο ζρεκαηίδνπλ έλαλ αξθεηά ππνζηεξηγκέλν θιάδν κε ηηκή bootstrap 100 (Δηθφλα 19). Ζ πξψηε πηζαλή εμήγεζε είλαη φηη νη πξσηεΐλεο OsMET1-1 θαη OsMET1-2 είλαη πξντφληα ελφο πξψηκνπ γνληδηαθνχ δηπιαζηαζκνχ θαη έρνπλ δηαθνξνπνηεζεί αξθεηά θαηά ηε δηάξθεηα ηεο εμέιημεο. Ζ δεχηεξε πηζαλή εμήγεζε είλαη φηη νη δπν πξσηεΐλεο δελ απέθιηλαλ απφ έλα θνηλφ πξνγνληθφ γνλίδην αιιά εμειίρζεθαλ αλεμάξηεηα ζην γνληδίσκα ηνπ ξπδηνχ. Γπν ππνζεηηθέο νκφινγεο πξσηεΐλεο ΜΔΣ1 ηαπηνπνηήζεθαλ ζην θαξφην (DcMET1 θαη DcMET2) (Bernacchia et al., 1998) θαη ηελ Brassica rapa (BrMET1a θαη BrMET1b) (Fujimoto et al., 2006). Με βάζε ηε θπινγελεηηθή αλάιπζε (Δηθφλα 17 θαη 19), ηα γνλίδηα DcMET1/2 θαη BrMET1a/b πξνθαλψο απνηεινχλ πξντφληα πξφζθαησλ γνληδηαθψλ δηπιαζηαζκψλ. Μηα νκφινγε πξσηετληθή αθνινπζία MET1 βξέζεθε ζην γνληδίσκα ηνπ αξαβφζηηνπ (Δηθφλεο 17, 18

67 66 θαη 19). Λακβάλνληαο ππφςηλ φηη ν αξαβφζηηνο είλαη έλαο αξραίνο ηεηξαπινεηδήο νξγαληζκφο, κηα πηζαλή εμήγεζε είλαη φηη έλα δεχηεξν γνλίδην ΜΔΤ1 ππήξρε ζην γνληδίσκα ηνπ αξαβφζηηνπ ην νπνίν απαιείθζεθε θαηά ηε δηάξθεηα ηεο εμέιημεο. Οη πξσηεΐλεο MET1 ησλ θπηψλ ηεο ηάμεο Brassicaceae, A.thaliana θαη B.rapa ζρεκαηίδνπλ έλαλ μερσξηζηφ θιάδν (Δηθφλεο 17, 18 θαη 19), νδεγψληαο ζην ζπκπέξαζκα φηη ηα κέιε ηεο νηθνγέλεηαο ΜΔΣ1 απνηεινχλ πξντφληα κηαο ζεηξάο γνληδηαθψλ δηπιαζηαζκψλ πνπ έπνληαη ηεο εηδνγέλεζεο ησλ θπηψλ. Όπσο θαίλεηαη ζηελ Δηθφλα 19, νη θπθψδεηο DNA C5-MTs, VcMet1 θαη CrMET1, νη νπνίεο ζπληζηνχλ ππννηθνγέλεηα ησλ MET1, έρνπλ εμειηρζεί κάιινλ πξφζθαηα. Ακθφηεξεο νη αθνινπζίεο VcMet1 θαη CrMET1, ζρεηίδνληαη πεξηζζφηεξν κε ηελ νκφινγε κπνεηδή πξσηεΐλε (MmDnmt1) παξά κε ηα αλζνθφξα θπηά (Δηθφλα 19). Απηή ε «δσψδεο» θχζε ηεο VcMet1 εμεγείηαη κεξηθψο απφ ην γεγνλφο φηη δελ αληρλεχζεθαλ ζην θχθνο Volvox carteri m 5 C θαηάινηπα ζε ηξηλνπθιενηίδηα GpNpC ή CpNpN, φπσο ζηελ πεξίπησζε ησλ θπηψλ αλη' απηνχ ε κεζπιίσζε είλαη πεξηνξηζκέλε θπξίσο ζε δηλνπθιενηίδηα CpG, φπσο ζηελ πεξίπησζε ηνπ γνληδηψκαηνο ησλ δψσλ (Babinger et al., 2007). Όζνλ αθνξά ηελ πξσηεΐλε CrMET1, έρεη απνδεηρζεί φηη είλαη ππεχζπλε γηα ηε κεζπιίσζε ηνπ DNA ησλ ρισξνπιαζηψλ (Nishiyama et al., 2002). Ζ CrMET1 δελ παξνπζηάδεη θακία νκνηφηεηα κε ηηο πξσηεΐλεο ΜET1 ζηελ Ν-ηειηθή πεξηνρή, πέξαλ απφ κηα ζεκαηνδνηηθή αιιεινπρία γηα ππνθπηηαξηθφ εληνπηζκφ ζηνλ ρισξνπιάζηε (CLS). Δπηπιένλ, κηα πεξηνρή πινχζηα ζε ζξενλίλε δηαθξίλεηαη κεηαμχ ησλ κνηίβσλ VI θαη VIII (Δηθφλα 14). Σν έλδπκν CrMET1 πηζαλφλ επηηειεί πνηθίιεο ιεηηνπξγίεο, δεδνκέλνπ φηη έρεη δεηρζεί λα κεζπιηψλεη θπηνζίλεο ζε δηαθνξεηηθέο αθνινπζίεο-ζηφρνπο (Πίλαθαο 4). Μηα ακηλνμηθή αθνινπζία ηαπηνπνηήζεθε in silico ζην γνληδίσκα ηεο Chlamydomonas reinhardtii, ε νπνία παξνπζηάδεη 96% νκνηφηεηα κε ηελ αθνινπζία CrMET1 ζηελ C- ηειηθή θαηαιπηηθή πεξηνρή (Δηθφλα 19).

68 Δηθόλα 17: Φπινγελεηηθό δέλδξν ησλ θπηηθώλ DNA C5-MTs πξσηετληθώλ αθνινπζηώλ θαηαζθεπαζκέλν κε ηε κέζνδν ηεο Έλσζεο Γεηηόλσλ. Σα νλφκαηα ησλ θπηηθψλ πξσηετλψλ DNA C5-MTs αλαθέξνληαη ζηνλ Πίλαθαο 4. Σν κήθνο ηνπ βξαρίνλα ηνπ δέλδξνπ αληηθαηνπηξίδεη ηελ εμειηθηηθή απφζηαζε. Οη ηηκέο bootstrap (>40) αλαγξάθνληαη ζηνπο θφκβνπο ηνπ δέλδξνπ. Ζ θιίκαθα άλσ δεμηά ζπκβνιίδεη ην ξπζκφ αληηθαηάζηαζεο ησλ ακηλνμέσλ ζε θάζε ζέζε. Ζ πξνθαξπσηηθή DNA C5-MT πξσηετληθή αθνινπζία HhaI ρξεζηκνπνηήζεθε σο αθνινπζία αλαθνξάο. 67

69 68 Ζ δεχηεξε επδηάθξηηε θπινγελεηηθή νκάδα (Δηθφλεο 17, 18 θαη 19) αληηζηνηρεί ζηελ νηθνγέλεηα ησλ θπηηθψλ ρξσκνκεζπινκεηαθνξαζψλ. Όπσο θαίλεηαη ζην θπινγελεηηθφ δέληξν ηεο Δηθφλα 19, νη πξσηεΐλεο ZMET2 θαη ZMET5, νη νπνίεο ηαπηνπνηήζεθαλ ζηνλ αξαβφζηην (Papa et al., 2001), ζρεκαηίδνπλ έλαλ επδηάθξηην θιάδν κε ηηκή bootstrap 100 (Δηθφλα 19). Σα αληίζηνηρα γνλίδηα ZMET2 θαη ZMET5 είλαη πξνθαλψο παξάινγα, απνηέιεζκα ηεο ηεηξαπινεηδνχο θχζεο ηνπ αξαβφζηηνπ παξά απνηέιεζκα δηαδνρηθψλ γνληδηαθψλ δηπιαζηαζκψλ. ην θπινγελεηηθφ δέλδξν (Δηθφλα 19) νη CMTs ηεο A.thaliana δελ ζρεκαηίδνπλ αλεμάξηεην θιάδν, ζε αληηδηαζηνιή κε ηηο αληίζηνηρεο πξσηεΐλεο MET1. Μηα πηζαλή εμήγεζε είλαη φηη νη γνληδηαθνί δηπιαζηαζκνί ζηελ νηθνγέλεηα CMT πξνεγήζεθαλ ηεο εηδνγέλεζεο ησλ θπηψλ. Όηαλ νη γλσζηέο ακηλνμηθέο αθνινπζίεο CMT ρξεζηκνπνηήζεθαλ γηα αλαδήηεζε ζηηο δεκφζηεο βάζεηο δεδνκέλσλ, δελ εληνπίζζεθε νκφινγε αθνινπζία CMT ζην γνληδίσκα ηνπ Volvox carteri. Ζ χπαξμε ελφο αληηγξάθνπ CMT ζην γνληδίσκα ηνπ Volvox carteri πηζαλφλ δελ είλαη απαξαίηεηε, εθφζνλ ην V. carteri ζηεξείηαη κεζπιίσζεο ζηελ ηξηλνπθιενηηδηθή αθνινπζία CpNpG. Δπίζεο, θακία νκφινγε ακηλνμηθή αθνινπζία CMT δελ βξέζεθε ζηα γνληδηψκαηα ησλ Chlamydomonas reinhardtii θαη Pisum sativum. Οη πξσηεΐλεο MET1 απηψλ ησλ δπν νξγαληζκψλ έρνπλ δεηρζεί φηη εκπιέθνληαη ζηε κεζπιίσζε θαηαινίπσλ θπηνζίλεο ζηηο αθνινπζίεο CpNpG θαη CpG (Πίλαθαο 4), θαζηζηψληαο έηζη κε αλαγθαία ηελ παξνπζία ελφο νξζφινγνπ CMT ζην γνληδίσκα ησλ νξγαληζκψλ απηψλ. ε πξνεγνχκελε κειέηε είρε πξνηαζεί φηη ε δηπιή εηδηθφηεηα ηνπ έλδπκνπ PsMET απνδίδεηαη ζηελ παξνπζία δπν επδηάθξηησλ TRDs. Γεδνκέλνπ φηη ε ακηλνμηθή αθνινπζία TRD ηεο CrMET1 είλαη κεγαιχηεξε ζε κήθνο απφ ηελ αληίζηνηρε ησλ ππφινηπσλ θπηηθψλ DNA C5-MTs, κπνξνχκε λα εμάγνπκε ην ζπκπέξαζκα φηη δχλαηαη λα ππάξρνπλ πεξηζζφηεξν απφ έλα δηαδνρηθά TRDs ζηελ αθνινπζία ηεο CrMET1 ζηα νπνία νθείιεηαη θαη ε πνιιαπιή εηδηθφηεηα ηεο CrMET1. Δπηπιένλ, κπνξνχκε λα ππνζέζνπκε φηη νη METs εκπιέθνληαλ ζηε κεζπιίσζε ακθφηεξσλ CpG θαη CpNpG αθνινπζηψλ. Δλα πηζαλφ ζελάξην είλαη φηη κεηά απφ ηελ εκθάληζε ησλ «ρηκαηξηθψλ» CMTs, νη METs ελδερνκέλσο πεξηφξηζαλ ηελ πξνηίκεζή ηνπο γηα κεζπιίσζε ζηηο CpG αθνινπζίεο-ζηφρνπο. Δπηπιένλ, ην έλδπκν AtMETI έρεη δεηρζεί φηη κεζπιηψλεη CpNpG αθνινπζίεο, φκσο ζε πεξηνξηζκέλν βαζκφ (Πίλαθαο 4). Ζ παξαηήξεζε απηή καο νδεγεί ζηε δηαηχπσζε ηεο ππφζεζεο φηη ε κεζπιίσζε ησλ αθνινπζηψλ CpNpG απφ ηελ

70 69 AtMET1 είλαη πηζαλφλ θαηάινηπν κηαο αξραίαο ελδπκηθήο δξάζεο ησλ πξσηετλψλ MET1. Ο ηξίηνο επδηάθξηηνο θιάδνο ζηα αλαθαηαζθεπαζκέλα δέλδξα (Δηθφλεο 17, 18 θαη 19) αληηζηνηρεί ζηελ νηθνγέλεηα DRM ησλ θπηηθψλ DNA C5-MTs. Τπνζεηηθέο ακηλνμηθέο αθνινπζίεο DRM έρνπλ πξνζδηνξηζζεί ζηελ Arabidopsis thaliana, ηνλ αξαβφζηην, ηνλ θαπλφ, ηελ φξπδα, ην θξηζάξη, θαη ηελ Medicago truncatula. Ζ δηάηαμε ησλ θαηαιπηηθψλ κνηίβσλ παξακέλεη ε ίδηα ζε φια ηα είδε θπηψλ, πξνηείλνληαο φηη ε αλαδηάηαμε ησλ ζπληεξεκέλσλ κνηίβσλ έιαβε ρψξα πξηλ απφ ηελ απφθιηζε κνλνθνηπιήδνλσλδηθνηπιήδνλσλ θπηψλ. Οη πξσηεΐλεο DRM παξνπζηάδνπλ πςειφ βαζκφ νκνηφηεηαο, νδεγψληαο ζηελ δηαηχπσζε ηεο ππφζεζεο φηη απνηεινχλ πξντφληα πξφζθαηνπ γνληδηαθνχ δηπιαζηαζκνχ. Οη πξσηεΐλεο DRM1/2 θαη MtDRML1/2 πνπ θσδηθνπνηνχληαη ζηα γνληδηψκαηα ησλ νξγαληζκψλ A. thaliana θαη Μ. truncatula αληίζηνηρα, είλαη πηζαλφλ πξντφληα ελφο πξφζθαηνπ γνληδηαθνχ δηπιαζηαζκνχ (Δηθφλεο 17, 18 θαη 19). Οξζφινγα ησλ DRM δελ αληρλεχζεθαλ ζηα γνληδηψκαηα ησλ νξγαληζκψλ C. reinhardtii θαη V. carteri. Δχινγε είλαη ε ππφζεζε φηη ηα δπν έλδπκα ΜΔΣ1 ησλ θπθψλ, γηα ηα νπνία έρεη δεηρζεί φηη έρνπλ θαη δξάζε de novo κεζπιίσζεο, ελδέρεηαη λα αληηθαηέζηεζαλ ηε δξάζε ησλ DRMs ζηα θχθε θαη φηη δξνχλ σο de novo DNA C5-MTs. Δπηπιένλ, ε CrMET1 δελ πεξηιακβάλεη ηεn πεξηνρή BAH (ραξαθηεξηζηηθφ ησλ DNA κεζπινκεηαθνξαζψλ δηαηήξεζεο ηεο κεζπιησηηθήο θαηάζηαζεο) πξνζθέξνληαο ην πιενλέθηεκα ζην έλδπκν CrMET1 γηα κεζπιίσζε δηαθνξεηηθψλ αθνινπζηψλ-ζηφρσλ. Σξεηο πξσηεΐλεο DRM κε άγλσζηε ιεηηνπξγία, ε ZmDMT106, ε OsDMT106 θαη ε AtDRML, ζρεκαηίδνπλ έλα μερσξηζηφ θαη αξθεηά ππνζηεξηγκέλν θιάδν ζηα θπινγελεηηθά δέλδξα (Δηθφλεο 17, 18 θαη 19). Δπηπιένλ, αλαδήηεζε ζηε βάζε δεδνκέλσλ Pfam απεθάιπςε φηη νη πξσηεΐλεο απηέο δελ πεξηιακβάλνπλ ηελ πεξηνρή UBA, πνπ είλαη ραξαθηεξηζηηθή ησλ πξσηετλψλ DRM. Ζ ηέηαξηε κνλνθπιεηηθή νκάδα (Δηθφλα 17, 18 θαη 19) αληηζηνηρεί ζηελ νηθνγέλεηα Dnmt2 ησλ θπηηθψλ DNA C5-MTs. Σα θπηά θσδηθνπνηνχλ πξσηεΐλεο Dnmt2, νη νπνίεο εκθαλίδνπλ πςειφ βαζκφ νκνηφηεηαο κε ηηο DNA κεζπινκεηαθνξάζεο ηνπ πνληηθνχ, ηνπ βαθηεξίνπ θαη ηνπ δπκνκχθεηα ηεο ίδηαο νηθνγέλεηαο. Όπσο απνηππψλεηαη ζηελ Δηθφλα 19, νη θπηηθέο πξσηεΐλεο Dnmt2 ζρεκαηίδνπλ κηα μερσξηζηή κνλνθπιεηηθή νκάδα,

71 70 νδεγψληαο ζηε δηαηχπσζε ηεο ππφζεζεο φηη νη θπηηθέο πξσηεΐλεο Dnmt2 έρνπλ πηζαλφλ εμειηρζεί κεηά απφ ηελ εκθάληζε ησλ θπηψλ (Pavlopoulou and Kossida, 2007). Δηθόλα 18: Φπινγελεηηθό δέλδξν ησλ θπηηθώλ DNA C5-MTs πξσηετληθώλ αθνινπζηώλ θαηαζθεπαζκέλν κε ηε κέζνδν ηεο Μέγηζηεο Φεηδσιόηεηαο. Σα κήθε ησλ βξαρηφλσλ ηνπ δέλδξνπ δελ αληηθαηνπηξίδνπλ εμειηθηηθή απφζηαζε.

72 Δηθόλα 19: Φπινγελεηηθό δέλδξν ησλ θπηηθώλ πξσηετληθώλ αθνινπζηώλ DNA C5- MTs θαηαζθεπαζκέλν κε ηε κέζνδν ηεο Μέγηζηεο Πηζαλνθάλεηαο. 71

73 72 Φπινγελεηηθή Αλάιπζε - Αλάιπζε ησλ Αθνινπζηώλ TRD Ζ πεξηνρή αλαγλψξηζεο ηεο αθνινπζίαο-ζηφρνπ (TRD) δηαθξίλεηαη αλάκεζα ζηα θαηαιπηηθά κνηίβα VIII θαη IX (Kumar et al., 1994) (Δηθφλα 14). Ζ TRD πεξηέρεη ζπληεξεκέλα ακηλνμηθά θαηάινηπα πνπ ελδερνκέλσο ζπκβάιινπλ ζηελ αλαγλψξηζε αθνινπζηψλ-ζηφρσλ θαηφπηλ αιιειεπίδξαζήο ηνπο κε βάζεηο ηεο αθνινπζίαο-ζηφρνπ (Szegedi and Gumport, 2000). ηελ παξνχζα κειέηε (Pavlopoulou and Kossida, 2007), πξνθεηκέλνπ λα εθηηκεζεί ν βαζκφο ζπληήξεζεο ησλ ακηλνμηθψλ αθνινπζηψλ TRD ησλ θπηηθψλ DNA C5-MTs, θαηαζθεπάζζεθε θπινγελεηηθφ δέλδξν βαζηζκέλν απνθιεηζηηθά ζηηο ακηλνμηθέο αθνινπζίεο πνπ αληηζηνηρνχλ ζηηο TRDs ησλ ηεζζάξσλ νηθνγελεηψλ ησλ θπηηθψλ DNA C5-MTs (Δηθφλα 20). Οη αθνινπζίεο TRD παξνπζηάδνπλ κεγάιε εηεξνγέλεηα ζην κήθνο θαη ηε ζχζηαζε ησλ ακηλνμέσλ κεηαμχ ησλ νηθνγελεηψλ ησλ θπηηθψλ DNA C5-MTs (Δηθφλα 20). Οη ακηλνμηθέο αθνινπζίεο TRD ησλ νηθνγελεηψλ CMT θαη ΜΔΣ παξνπζηάδνπλ κεγάιε νκνηφηεηα. Οη αθνινπζίεο TRD ησλ κειψλ ηεο νηθνγέλεηαο DRM είλαη κηθξφηεξεο ζε κήθνο θαη ζρεκαηίδνπλ έλα επδηάθξηην θιάδν ζην δέλδξν (Δηθφλα 20). Οη αθνινπζίεο TRD ηεο νηθνγέλεηαο Dnmt2 είλαη πξνθαλψο νη πεξηζζφηεξν δηαθνξνπνηεκέλεο, ζρεκαηίδνληαο έλαλ μερσξηζηφ θιάδν κε ηηκή bootstrap 100. Τπνζέηνπκε φηη ε απφθιηζε απηή απεηθνλίδεη ηηο δηαθνξέο ζηηο αθνινπζίεο αλαγλψξηζεο-ζηφρσλ ηεο νηθνγέλεηαο Dnmt2 (πηζαλφλ ππνζηξψκαηα RNA). Ζ αθνινπζία TRD ηνπ PsMET παξνπζίαδεη ζεκαληηθή νκνηφηεηα κε ηηο TRD αθνινπζίεο ησλ άιισλ ΜΔΣ1 πξσηετλψλ (Δηθφλα 20). Απηή ε ππφζεζε έξρεηαη ζε αληίζεζε κε πξνεγνχκελε πξφηαζε, ε νπνία πξφηεηλαη ηελ παξνπζία δχν δηαδνρηθψλ TRDs (Pradhan and Adams, 1995). Μηα ζχγθξηζε κεηαμχ ησλ δπν αλαθαηαζθεπαζκέλσλ δέλδξσλ (Δηθφλεο 19 θαη 20) απνθάιπςε φηη νη εμειηθηηθέο ζρέζεηο ησλ αθνινπζηψλ TRD ησλ θπηηθψλ DNA C5-MTs είλαη πην «επδηάθξηηεο» κεηαμχ ησλ ηεζζάξσλ θπηηθψλ νηθνγελεηψλ παξά ζηηο επηκέξνπο νηθνγέλεηεο. Γηα παξάδεηγκα, νη αθνινπζίεο TRD ησλ δπν πξσηετλψλ ΜΔΣ1 ηνπ θχθνπο Chlamydomonas reinhardtii, νη νπνίεο έρνπλ εμαηξεηηθά κεγάιν κήθνο, ζρεκαηίδνπλ έλα μερσξηζηφ0ππν-δέλδξν0(δηθφλα020).

74 Δηθόλα 20: Φπινγελεηηθό δέλδξν ακηλνμηθώλ αθνινπζηώλ TRD ησλ θπηηθώλ DNA C5-MTs θαηαζθεπαζκέλν κε ηε κέζνδν ηεο Μέγηζηεο Πηζαλνθάλεηαο. 73

75 74 ε πξνεγνχκελε πεηξακαηηθή κειέηε, είραλ ζηνηρηζεί νη ακηλνμηθέο αθνινπζίεο ησλ TRDs ησλ επθαξπσηηθψλ θαη ησλ βαθηεξηαθψλ DNA κεζπινκεηαθνξαζψλ (Vilkaitis et al., 2000). Σαπηνπνηήζεθε κηα ζπλαηλεηηθή δηπεπηηδηθή αθνινπζία T(L,V,I), πνπ βξίζθεηαη ακηλνμέα αλνδηθά ηνπ ζπληεξεκέλνπ κνηίβνπ IX. Δίρε πξνηαζεί φηη ε ζπληεξεκέλε ζξενλίλε δηαδξακαηίδεη ζεκαληηθφ ξφιν ζηελ αληηζηξνθή ηεο βάζεοζηφρνπ ζηελ θαηαιπηηθή πεξηνρή ησλ DNA κεζπινκεηαθνξαζψλ. Δπίζεο, ζηελ ίδηα κειέηε, εληνπίζηεθε ε ζπλαηλεηηθή αθνινπζία: (YFW)x(RK)x 5 P(STCA)PT(L V,I)(TASV)x 5 16 H(PYFWL) (Vilkaitis et al., 2000). ηελ παξνχζα κειέηε (Pavlopoulou and Kossida, 2007), ε πξναλαθεξζείζα ζπλαηλεηηθή αθνινπζία ρξεζηκνπνηήζεθε σο πξφηππν γηα ηελ γξακκηθή ζχγθξηζε ησλ αθνινπζηψλ TRD ησλ θπηηθψλ DNA C5-MTs. Σα ζπληεξεκέλα δηπεπηίδηα πνπ εληνπίζζεθαλ κε νπηηθή εμέηαζε αλαγξάθνληαη κε καχξε ζθίαζε (Δηθφλα 21). Σα δηπεπηίδηα πνπ πεξηιακβάλνληαη ζηε ζπλαηλεηηθή αθνινπζία αιιά δελ είλαη πηζαλά T(L,V,I)s ππνδεηθλχνληαη κε έληνλε γξαθή (Δηθφλα 21). Μφλν δχν «πξαγκαηηθά» δηπεπηίδηα πξνζδηνξίζηεθαλ ζηηο πεξηνρέο TRD ηεο νηθνγέλεηαο METI, ζηελ CrMET1 θαη ζηελ CrMETL. Δπίζεο, νη ζπλαηλεηηθέο αθνινπζίεο ησλ πεξηνρψλ TRD ησλ δχν ελδχκσλ ηνπ θχθνπο Chlamydomonas reinhardtii δηαθέξνπλ απφ ηηο ππφινηπεο ησλ πξσηετλψλ ΜΔΣ1 (Δηθφλα 21). Σνηνπηνηξφπσο, ζπκθσλνχλ κε ηα απνηειέζκαηα ηεο θπινγελεηηθήο αλάιπζεο. Δπηπιένλ, ε νηθνγέλεηα MET1 παξνπζηάδεη ζεκαληηθή δηαθνξνπνίεζε φζνλ αθνξά ην ζπλαηλεηηθφ δηπεπηίδην, ελ αληηζέζεη κε ηηο ππφινηπεο ηξεηο νηθνγέλεηεο φπνπ ην δηπεπηίδην είλαη ζπληεξεκέλν (Δηθφλα 21). Δπίζεο, ζηελ παξνχζα εξγαζία (Pavlopoulou and Kossida, 2007), πξνζδηνξίζζεθε κε νπηηθή εμέηαζε ην δηπεπηίδην TI ζηηο αθνινπζίεο ησλ TRDs ησλ θπηηθψλ πξσηετλψλ DRM, ην νπνίν εληνπίδεηαη 14 λνπθιενηίδηα θαζνδηθά ηνπ ζπληεξεκέλνπ κνηίβνπ VIII ζην Ν-ηειηθφ άθξν αληί ηνπ C-ηειηθνχ άθξνπ ηεο πεξηνρήο (Δηθφλα 21). Δληνχηνηο, ην δηπεπηίδην ΣΗ είλαη ζπληεξεκέλν ζηηο νκφινγεο πξσηεΐλεο Dnmt3a θαη Dnmt3b ησλ ζειαζηηθψλ, εληνπηδφκελν 14 λνπθιενηίδηα αλνδηθά ηνπ θαηαιπηηθνχ κνηίβνπ IX, θαη ηα ακηλνμηθά θαηάινηπα ζπληεξνχληαη εθαηέξσζελ ηνπ δηπεπηηδίνπ ζηε ζπλαηλεηηθή αθνινπζία (Δηθφλα 21).

76 75 MET AtMETI AtMETIIa AtMETIIb AtMETIII BrMET1a BrMET1b CrMET1 CrMETL DcMET1 DcMET2 LesMET OsMET1-1 OsMET1-2 PpMETI PsMET PtMETL VcMet1 ZmMET1 CMT AaCMT AtCMTI AtCMTII AtCMTIII BrCMT HvCMT1 NtCMT OsCMTL OsMET2a PtCMTL ZMET2 ZMET5 DRM MmDnmt3a MmDnmt3b AtDRM1 AtDRM2 AtDRML HvDnmt3-1 MtDRML1 MtDRML2 NtDRM1 OsDMT106 OsZmet3 ZmDMT106 Zmet3 Dnmt2 AtDnmt2 CrDnmt2L OsDnmt2L ZMET4 KGLYGRLDWQGNFPTSVTDPQPMGKVGMCFHPEQ KGLYGRLDWQGNLPISITDPQPMGKVGMCFHPEQ KGLYGRLDWQGNLPISITDPQPMGKVGMCFHPEQ KGLYGRLDWHGNLPTCITNLQPMGLVGMCFHPDQ KGLFGRLDWEGNFPTSITDPQPMGKVGMCFHPDQ KGLFGRLDWEGNFPTCVTKPGPMGMVGKCFHPDQ RSGMYGRLCHTSYFRTATTKVGVDGWSLHPDLDQ RSGMYGRLCHTSYFRTATTKVGVDGWSLHPDLDQ KGLFGRLDWEGSFPTSITDPQPMGKVGMCFHPDQ KGLFGRLDWEGNFPTSITDPQPMGKVGMCFHPDQ KGLFGRLDWDGNFPTSITDPQPMGKVGMCFHPDQ KGLYGRLDWEGNFPTSVTDPQPMGKVGMCFHPEQ KGLYGRLDWEGNFPTSVTDPQPMGKVGMCFHPDQ KGLYGRLDWQGNFPTSVTDPQPMGKVGMCFHLEQ KGLFGRLDWQGNFPTSITDPQPMGKVGMCFHPDQ KGLFGRLDWEGNFPTSITDPQPMGKVGMCFHPEQ RGLYGRLDPYGHFPTATTEPNPMGKVGQVFHPDQ KGLYGRLDWEGNFPTSVTDPQPMGKVGMCFHPDQ KSKKPFGRLWWDEIVNTVVTRAEPHNQCVIHPMQ KSKKPFGRLWGDEIVNTVVTRAEPHNQCVIHPMQ KSKRPFARLWWDETVPTVLTVPTCHSQALLHPEQ KSCKPFGRLWWDEIVPTVVTRAEPHNQVIIHPEQ KSKKPFGRLWWDETVPTVIGRAEPHNHVIIHPNQ RSPKPFGRLWWDETVPTVVTRAEPHNQIILHPNQ TSTKPFGRLWWDEIVPTVVTRAEPHNQVILHPEQ KSLRPFGRVWWDEVVGTVLTVPNARMQALIHPAQ KSTKPFGRLWWDETVPTVVTRAEPHNQIILHPSQ SSSKPFARLWWDETVPTVVTRAEPHNQAIMHPEQ KSLKPFGRLWWDETVPTVVTRAEPHNQVIIHPTQ KSLKPFGRLWWDETVPTVVTRAEPHNQVILHPTQ LEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFM LEFSRTAKLKKVQTITTKSNSIRQGKNQLFPVVM IQNRFQIQPPQHNTIQEAFPLTKRWWPSWDGRTK INNRFQIQPPPKYTIHDAFPLSKRWWPEWDKRTK TVNRFNTLPNPRLTIQDAMPHMRSWWPQWDIRKH IENRFPVLPLPPKTIFEAFPHYEKWWPSWDPRRQ IANRFPLLPLPPRTILDAFPPLRRWWPSWDPRKN IVNRFPLLPLPPRTIHDAFPLLRRWWPTWDPRTK VENRFPLFPLAPRTIHEALPLSKKWWPSWDPRTK TEGRRNLVPRSPMTIEEAFPFTRQCWPSWDTRKQ IENRSPVLPMPPKTISEAFPNTKRWWPSWDPRRQ VEKRSVVVPKSPMTIEEALPFTRQWWPSWDTRKH LENRSPLLPIPPKTISEAFPRTKRWWPSWDPRRQ NAMDIVYPDSKRCCCFTKSYYRYVKGTGSLLATV RVLDVVTPTATYSNCFTKHYADNALGAGSVLATE SAMDIVCPESKRCCCFTKSYYRYVKGTGSLLATS NAMDIVYPEFKRCCCFTKSYYRYVKGTGSLLATS Δηθόλα 21: ηνίρηζε ησλ ακηλνμηθώλ αθνινπζηώλ TRD ησλ θπηηθώλ DNA C5-MTs. Σα ζπληεξεκέλα δηπεπηίδηα αλαγξάθνληαη κε καχξε ζθίαζε. Σα δηπεπηίδηα πνπ πεξηιακβάλνληαη ζηε ζπλαηλεηηθή αθνινπζία αιιά δελ είλαη πηζαλά δηπεπηίδηα ππνδεηθλχνληαη κε έληνλε βαζπθφθθηλε γξαθή. Σα ζπληεξεκέλα ακηλνμηθά θαηάινηπα ζηε ζπλαηλεηηθή αθνινπζία αλαγξάθνληαη κε γθξη ζθίαζε. Οη πξσηεΐλεο ησλ ζειαζηηθψλ ππνδεηθλχνληαη κε έληνλε γξαθή.

77 ΜΔΡΟ II: ΔΤΚΑΡΤΧΣΗΚΔ RNA ΜΔΘΤΛΟΜΔΣΑΦΟΡΑΔ 76

78 77 ΔΗΑΓΧΓΖ Ζ πξνζζήθε κηαο κεζπινκάδαο ζηε ζέζε C5 ηεο θπηνζίλεο απνηειεί θνηλή κεηακεηαγξαθηθή ρεκηθή ηξνπνπνίεζε ηνπ RNA (Rozenski et al., 1999), ε νπνία ιακβάλεη ρψξα θπξίσο ζην ξηβνζσκηθφ RNA (rrna) θαη ζην κεηαθνξηθφ RNA (trna) θαη έρεη δηαδξακαηίζεη ζεκαληηθφ ξφιν ζηε κεηάβαζε απφ ηνλ «θφζκν ηνπ RNA» ζηνλ «θφζκν ηνπ DNA» (Martinez Gimenez et al., 1998). Ζ αληίδξαζε κεηαθνξάο κηαο κεζπινκάδαο ζηελ C5 ζέζε ησλ θπηνζηλψλ θαηαιχεηαη απφ ηα έλδπκα RNA κεζπινκεηαθνξάζεο (νη νπνίεο ζην εμήο ζα αλαθέξνληαη σο RCMTs). Οη RCMTs απαξηίδνληαη απφ ηε ζπληεξεκέλε θπξίσο θαηαιπηηθή πεξηνρή, κήθνπο πεξίπνπ 300 ακηλνμηθψλ θαηαινίπσλ. H θαηαιπηηθή πεξηνρή πεξηιακβάλεη έμη ζπληεξεκέλα πξσηετληθά κνηίβα, πέληε (X, I, IV, VI, VIII) εθ ησλ νπνίσλ βξίζθνληαη θαη ζηηο DNA κεζπινκεηαθνξάζεο (Posfai et al., 1989) (Δηθφλα 22). Δληνχηνηο, απηά ηα πέληε κνηίβα είλαη αλαδηαηεηαγκέλα έηζη ψζηε ην κνηίβν X λα πξνεγείηαη ησλ κνηίβσλ I-VIII. Οη RCMTs απνηεινχληαη επίζεο απφ ηηο κεζπληεξεκέλεο Ν- θαη C- ηειηθέο πεξηνρέο, νη νπνίεο πνηθίιινπλ ζε κήθνο θαη ζε αθνινπζία (Reid et al., 1999) (Δηθφλα 22). N-ηειηθή πεξηνρή Καηαιπηηθή πεξηνρή C-ηειηθή πεξηνρή * * N1 X I IV VI VIII Δηθόλα 22: ρεκαηηθή αλαπαξάζηαζε ηεο πξσηνηαγνύο δνκήο ησλ πξσηετλώλ RCMT. Σα πξσηετληθά κνηίβα φπνπ βξίζθνληαη νη δπν θαηαιπηηθέο θπζηεΐλεο ππνδεηθλχνληαη κε αζηεξίζθνπο. Ο θαηαιπηηθφο κεραληζκφο ησλ RCMTs πεξηιακβάλεη δέζκεπζε κε νκνηνπνιηθφ δεζκφ ηεο ζεηνινκάδαο ηεο θπζηεΐλεο ηνπ κνηίβνπ VI. Δπνκέλσο, ηα ειεθηξφληα κεηαθέξνληαη

79 78 ζηε ζέζε 5 κε δεκηνπξγία θαξβαληφληνο (Δηθφλα 23). Δλ ζπλερεία, ην θαξβαληφλ απηφ πξνζβάιιεη ηε κεζπινκάδα ηνπ ζπκπαξάγνληα AdoMet. Μεηά ηελ πξνζζήθε ηεο κεζπινκάδαο ε θπζηεΐλε ηνπ κνηίβνπ IV δξα σο βάζε θαηά ηε β-απφζπαζε ελφο πξσηνλίνπ ζηε ζέζε 5. Ο δηπιφο δεζκφο κεηαμχ ησλ ζέζεσλ 5 θαη 6 επαλαζρεκαηίδεηαη θαη ην έλδπκν απειεπζεξψλεηαη (King and Redman, 2002) (Δηθφλα 20). Δλ αληηζέζεη πξνο ηηο DNA κεζπινκεηαθνξάζεο (DNMTs) φπνπ ε θπζηεΐλε ηνπ κνηίβνπ IV είλαη ην θχξην θαηαιπηηθφ ππξελφθηιν, ζηηο RCMTs ην ππξελφθηιν είλαη ε θπζηεΐλε ηνπ κνηίβνπ VI φπσο θαη ζηηο RNA κεζπινκεηαθνξάζεο πνπ θαηαιχνπλ ηε κεηαθνξά κηαο κεζπινκάδαο ζηε ζέζε C5 ηεο νπξηδίλεο (πνπ νλνκάδνληαη RUMTs) (Liu and Santi, 2000). Δηθόλα 23: Καηαιπηηθόο κεραληζκόο ηεο δξάζεο ησλ RCMTs. Ζ αληίδξαζε αξρίδεη κε ππξελφθηιε πξνζβνιή ηεο ζεηνινκάδαο ηεο θπζηεΐλεο ηνπ κνηίβνπ VI ζηε ζέζε 6 ηεο θπηνζίλεο-ζηφρνπ. Καηφπηλ κεηαθνξάο ηεο κεζπινκάδαο ζηε ζέζε 5, ε θπζηεΐλε ηνπ κνηίβνπ IV δξα σο βάζε θαηά ηελ β-απφζπαζε ελφο πξσηνλίνπ ζηε ζέζε 5. Ζ αληίδξαζε νινθιεξψλεηαη κε επαλαζρεκαηηζκφ ηνπ δηπινχ δεζκνχ κεηαμχ ησλ ζέζεσλ 5 θαη 6 θαη απειεπζέξσζε ηνπ έλδπκνπ (Σξνπνπνηεκέλν απφ(foster et al., 2003).

80 79 χκθσλα κε ηελ πην πξφζθαηε ζεσξία (Bujnicki et al., 2004), νη RCMTs νκνηάδνπλ πξνο ακθφηεξεο ηηο DNMTs θαη ηηο RCMTs. Οη RCMTs έρνπλ πηζαλφλ πξνθχςεη απφ ηηο RUMTs κε απφθηεζε κηαο θπζηεΐλεο ζην κνηίβν IV. Ζ θπζηεΐλε απηή έγηλε ην θχξην θαηαιπηηθφ ακηλνμχ ζηηο DNMTs, θαη ε αξρηθή θπζηεΐλε ηνπ κνηίβνπ VI απαιείθζεθε (Δηθφλα 24). Δπνκέλσο, ε νηθνγέλεηα ησλ έλδπκσλ RCMT απνηειεί εμειηθηηθφ ελδηάκεζν ησλ νηθνγελεηψλ RUMT θαη DNMT (Bujnicki et al., 2004). Τπνζεηηθέο RCMTs έρνπλ ηαπηνπνηεζεί ζε αξραηνβαθηήξηα, επβαθηήξηα θαη επθαξπσηηθνχο νξγαληζκνχο (Reid et al., 1999). Ζ πξψηε πξσηεΐλε RCMT, ε FMU, απνκνλψζεθε απφ ην βαθηήξην Escherichia coli. Ζ FMU θαηαιχεη ηελ αληίδξαζε κεηαθνξάο κηαο κεζπινκάδαο ζηε ζέζε C967 ζην 6S rrna (Gu et al., 1999; Tscherne et al., 1999). χκθσλα κε ηνπο εξεπλεηέο Reid θαη ζπλεξγάηεο (1999), νη RCMTs ηαμηλνκνχληαη ζε νθηψ ππννηθνγέλεηεο (RCMT1-RCMT8), εθ ησλ νπνίσλ πέληε έρνπλ βξεζεί απνθιεηζηηθά ζε πξνθαξπσηηθνχο νξγαληζκνχο (RCMT1, RCMT3-RCMT6) θαη ηξεηο ππννηθνγέλεηεο (RCMT2, RCMT7, RCMT8) έρνπλ ηαπηνπνηεζεί απνθιεηζηηθά ζε επθαξπσηηθνχο νξγαληζκνχο. Οη επθαξπσηηθέο ππννηθνγέλεηεο νλνκάδνληαη NOP2, NCL1, θαη YNL022C κε βάζε ηηο πξσηφηππεο πξσηεΐλεο πνπ απνκνλψζεθαλ απφ ην δπκνκχθεηα Saccharomyces cerevisiae (Reid et al., 1999). Ζ πξσηεΐλε NOP2 εληνπίδεηαη ζηνλ ππξελίζθν ηνπ θπηηάξνπ θαη είλαη απαξαίηεηε γηα ηελ επεμεξγαζία ησλ πξφδξνκσλ κνξίσλ rrna θαη ηελ αλαζχζηαζε ηεο ξηβνζσκηθήο ππνκνλάδαο 60S απφ ηηο ζπζηαηηθέο ηεο πξσηεΐλεο (Hong et al., 1997). Δπίζεο, ε NOP2 είλαη απαξαίηεηε γηα ηελ αλάπηπμε θαη επηβίσζε ησλ θπηηάξσλ (de Beus et al., 1994). Μεγάιεο ζε κήθνο N- θαη C- ηειηθέο πεξηνρέο δηαθξίλνληαη ζηε NOP2. Δπίζεο, ε πξσηεΐλε P120, πνπ απνηειεί ην νξζφινγν ηεο NOP2 ζηνλ άλζξσπν θαη έρεη πξνηαζεί σο rrna κεζπινκεηαθνξάζε (Koonin, 1994), πεξηιακβάλεη ζεκαηνδνηηθέο αθνινπζίεο γηα ππνθπηηαξηθφ εληνπηζκφ ζηνλ ππξήλα θαη ηνλ ππξελίζθν ζηελ θαξβνμπηειηθή πεξηνρή (Valdez et al., 1994). Δπίζεο, ε P120 αληηπξνζσπεχεη ζεκαληηθφ κνξηαθφ βηνδείθηε θαξθίλνπ, γηαηί ππεξεθθξάδεηαη ζε θαθνήζεηο φγθνπο (Perlaky et al., 1996; Sato et al., 1999). Ζ πξσηεΐλε NCLI εληνπίζζεθε ζηνλ ππξήλα ηνπ θπηηάξνπ, φπνπ ιακβάλεη ρψξα ην κάηηζκα θαη ε επεμεξγαζία ηνπ trna (Wu et al., 1998). Σν έλδπκν NCLI παξνπζηάδεη πνιιαπιή εηδηθφηεηα, εθφζνλ θαηαιχεη ηε κεηαθνξά κηαο κεζπινκάδαο ζε ηέζζεξηο δηαθνξεηηθέο ζέζεηο (C34, C40, C49, C49) ηνπ

81 80 πξφδξνκνπ θαη ψξηκνπ trna (Motorin and Grosjean, 1999). Ζ πξσηεΐλε MISU/NSUN2 (αλζξψπηλν νξζφινγν ηεο NCL1) έρεη δεηρζεί φηη εκπιέθεηαη ζηελ επαγσγή ηεο έθθξαζεο ηνπ νγθνγνληδίνπ Myc (Frye and Watt, 2006). Ζ αθξηβήο βηνρεκηθή δξάζε ηεο πξσηεΐλεο YNL022C δελ έρεη πξνζδηνξηζζεί. Δληνχηνηο, ε πξσηεΐλε YNL022C εληνπίδεηαη ζηνλ ππξεληθφ θάθειν (Brachat et al., 2000) ππνδεηθλχνληαο πηζαλφ ξφιν ηεο YNL022C ζηελ επεμεξγαζία ηνπ trna. Δηθόλα 24: Πξνηεηλόκελν κνληέιν ηεο εμέιημεο ησλ πξσηετλώλ RCMT από ηηο πξσηεΐλεο RUMT. Oη RCMTs πηζαλφλ πξνήιζαλ απφ ηηο RUMTs κε ηελ απφθηεζε κηαο θπζηεΐλεο ζην κνηίβν IV (Tξνπνπνηεκέλν απφ (Bujnicki et al., 2004)

82 81 ΜΔΘΟΓΟΛΟΓΗΑ Αλαδήηεζε Οκόινγσλ Πξσηετλώλ RCMTs ζηηο Γεκόζηεο Βάζεηο Γεδνκέλσλ Οη ραξαθηεξηζκέλεο πξσηετληθέο αθνινπζίεο RCMT ρξεζηκνπνηήζεθαλ σο «αληρλεπηέο» γηα ηελ αλαδήηεζε νκφινγσλ RCMTs ζηηο δεκφζηεο βάζεηο δεδνκέλσλ κε ηε ρξήζε ηνπ ακθίδξνκνπ πξνγξάκκαηνο BLASTp θαη tblastn. Οη θαηλνθαλείο αθνινπζίεο ρξεζηκνπνηήζεθαλ ζε πεξαηηέξσ επαλαιεπηηθέο αλαδεηήζεηο. Ζ δηαδηθαζία απηή νινθιεξψζεθε φηαλ δε κπνξνχζαλ λα βξεζνχλ επηπιένλ θαηλνθαλείο αθνινπζίεο. Ζ θαηαιπηηθή πεξηνρή ησλ RCMTs (αξηζκφο θαηαρψξεζεο ζηε βάζε δεδνκέλσλ PFAM: PF01189) ζηηο θαηλνθαλείο αθνινπζίεο εληνπίζζεθε κέζσ ηεο κεραλήο αλαδήηεζεο πνπ δηαηίζεηαη ζηε δεπηεξνγελή πξσηετληθή βάζε δεδνκέλσλ PFAM. Φπινγελεηηθή Αλάιπζε Οη ακηλνμηθέο αθνινπζίεο ησλ RCMTs ζηνηρήζεθαλ κε ηε ρξήζε ηνπ ππνινγηζηηθνχ πξνγξάκκαηνο CLUSTALW. Πξνθεηκέλνπ λα κειεηεζνχλ νη εμειηθηηθέο ζρέζεηο ησλ πξσηετλψλ RCMT πξαγκαηνπνηήζεθε θπινγελεηηθή αλάιπζε. Πξνο απηή ηελ θαηεχζπλζε, θαηαζθεπάζζεθαλ θπινγελεηηθά δέλδξα κε ηηο κεζφδνπο Έλσζεο Γεηηφλσλ θαη Μέγηζηεο Πηζαλνθάλεηαο ηξνθνδνηνχκελα κε πνιιαπιέο ζηνηρίζεηο. Σν ππνινγηζηηθφ παθέην πξνγξακκάησλ MEGA ρξεζηκνπνηήζεθε γηα ηε κέζνδν Έλσζεο Γεηηφλσλ θαη ην ππνινγηζηηθφ πξφγξακκα PhyML γηα ηε κέζνδν Μέγηζηεο Πηζαλνθάλεηαο. Ο ξπζκφο αληηθαηάζηαζεο ελφο ακηλνμένο απφ έλα άιιν ππνινγίζζεθε κε ην πξφηππν αληηθαηάζηαζεο JTT. Ζ ζεκαληηθφηεηα ηεο ηνπνινγίαο ησλ δέλδξσλ εθηηκήζεθε κε bootstrapping (500 ςεπδν-ζχλνια). Σα θπινγελεηηθά δέλδξα απεηθνλίζζεθαλ κε ην πξφγξακκα NJPLOT.

83 82 Λνγόηππα Αθνινπζηώλ Οη ακηλνμηθέο αθνινπζίεο ησλ έμη θαηαιπηηθψλ κνηίβσλ ησλ πξσηετλψλ RCMT ζηνηρίζεθαλ κε ρξήζε ηνπ πξνγξάκκαηνο CLUSTALW θαη αθνινχζεζε κε απηνκαηνπνηεκέλε επεμεξγαζία. Οη αθνινπζίεο κε πνζνζηφ ηαπηφζεκσλ ακηλνμηθψλ θαηαινίπσλ κηθξφηεξν απφ 90% ηξνθνδφηεζαλ ην ππνινγηζηηθφ πξφγξακκα Weblogo γηα ηε δεκηνπξγία ινγνηχπσλ. Καηαζθεπή Πξσηετληθώλ Απνηππσκάησλ RCMT Ζ κέζνδνο πνπ πεξηγξάθεηαη ζην Κεθάιαην Δηζαγσγε: Δξγαιεία Πιεξνθνξηθήο κε ηίηιν «Μέζνδνο Kαηαζθεπήο Πξσηετληθψλ Απνηππσκάησλ» (ζειίδα 23) εθαξκφζζεθε γηα ηελ θαηαζθεπή απνηππσκάησλ απφ ηελ νηθνγέλεηα (θαη ηηο επηκέξνπο ππννηθνγέλεηεο) ησλ RNA κεζπινκεηαθνξαζψλ: FMU, NOP2, ΝCL1 θαη RCMT9. Μνξηαθή Απεηθόληζε Γηα ηελ απεηθφληζε ηεο ηξηηνηαγνχο δνκήο ηεο πξσηεΐλεο FMU ηνπ βαθηεξίνπ Escherichia coli ρξεζηκνπνηήζεθε ην πξφγξακκα κνξηαθήο απεηθφληζεο RasMol. Οξγάλσζε ησλ Γνληδίσλ RCMT Ζ δνκή ησλ νκφινγσλ γνληδίσλ RCMT αλαιχζεθε κέζσ ηεο ηαπηνπνίεζεο ησλ ζέζεσλ καηίζκαηνο ζηα εμψληα πνπ θσδηθνπνηνχλ ηελ θαηαιπηηθή πεξηνρή ησλ νκφινγσλ πξσηετλψλ RCMT. Γηα ηνλ ζθνπφ απηφ, νη ακηλνμηθέο αθνινπζίεο ηεο θαηαιπηηθήο πεξηνρήο ησλ πξσηετλψλ Fmu, nop2 θαη nsun5 απφ ηα θπηά Arabidopsis thaliana θαη Oryza sativa (φξπδα) ρξεζηκνπνηήζεθαλ σο «αληρλεπηέο» ζε αλαιχζεηο tblastn ζηα αληίζηνηρα γνληδηψκαηα ησλ δπν θπηψλ πξνθεηκέλνπ λα βξεζνχλ ηα δηαδνρηθά θσδηθεχνληα εμψληα.

84 83 ΑΠΟΣΔΛΔΜΑΣΑ Φπινγελεηηθή Αλάιπζε ησλ Οκόινγσλ Πξσηετλώλ RCMT ηελ παξνχζα κειέηε (Pavlopoulou and Kossida, 2009) ηαπηνπνηήζεθαλ ζπλνιηθά 301 θαηλνθαλείο νκφινγεο πξσηεΐλεο RCMT. Καηαζθεπάζζεθε θπινγελεηηθφ δέλδξν κε ηε κέζνδν ηεο Έλσζεο Γεηηφλσλ ηξνθνδνηνχκελν κε ηελ πνιιαπιή ζηνίρηζε ησλ 301 ακηλνμηθψλ αθνινπζηψλ. ην δέλδξν (πνπ παξνπζηάδεηαη ζηελ Δηθφλα 25) δηαθξίλνληαη πέληε θιάδνη, πξνηείλνληαο ηελ ηαμηλφκεζε ησλ ππνζεηηθψλ πξσηετλψλ RCMT ζε πέληε θπινγελεηηθέο νκάδεο. ηελ παξνχζα κειέηε, ηαπηνπνηήζεθαλ πέξαλ απφ ηηο ηξεηο ήδε γλσζηέο ππννηθνγέλεηεο (NOP2, NCL1 θαη YNL022C), κηα θαηλνθαλήο ππννηθνγέλεηα, ε νπνία νλνκάζζεθε RCMT9. Δπθαξπσηηθά νκφινγα RCMT βξέζεθαλ, επίζεο, ζηελ πξνθαξπσηηθή ππννηθνγέλεηα FMU (Δηθφλα 25), ε νπνία εζεσξείην φηη απαληάηαη απνθιεηζηηθά ζε πξνθαξπσηηθνχο νξγαληζκνχο. Δηθόλα 25: Φπινγελεηηθό δέλδξν ησλ πξσηετληθώλ αθνινπζηώλ RCMT θαηαζθεπαζκέλν κε ηε κέζνδν ηεο Έλσζεο Γεηηόλσλ. Ζ θιίκαθα άλσ δεμηά ζπκβνιίδεη ηνλ ξπζκφ αληηθαηάζηαζεο ακηλνμέσλ ζε θάζε ζέζε.

85 84 Γείγκα 122 πξσηετληθψλ αθνινπζηψλ RCMT, νη νπνίεο αληηπξνζσπεχνπλ ηηο θπξηφηεξεο επθαξπσηηθέο ηαμηλνκηθέο νκάδεο (ζχκθσλα κε ηελ ηαμηλνκηθή βάζε δεδνκέλσλ ηνπ NCBI) επηιέρζεθε γηα πεξαηηέξσ θπινγελεηηθή αλάιπζε κε ηε κέζνδν ηεο Μέγηζηεο Πηζαλνθάλεηαο. Οη αξηζκνί θαηαρψξεζεο ησλ πξσηετληθψλ απηψλ αθνινπζηψλ ζηηο δεκφζηεο βάζεηο δεδνκέλσλ αλαθέξνληαη ζην Παξάξηεκα 1. Σέζζεξηο αληηπξνζσπεπηηθέο πξσηεΐλεο RCMT απφ ηηο πξνθαξπσηηθέο ππννηθνγέλεηεο RCMT1 θαη RCMT 3-5 ζπκπεξηιήθζεθαλ, επίζεο, ζηε θπινγελεηηθή αλάιπζε. Ζ πξνθαξπσηηθή πξσηεΐλε RumA απφ ην βαθηήξην E. coli, ε νπνία θαηαιχεη ηε κεηαθνξά κηαο κεζπινκάδαο ζηε ζέζε C1939 ηεο νπξηδίλεο ζην 23S rrna παξάγνληαο θαηάινηπα 5- κεζπινπξηδίλεο (m 5 U), ρξεζηκνπνηήζεθε σο αθνινπζία αλαθνξάο. ην θπινγελεηθφ δέλδξν (Δηθφλα 26) δηαθξίλνληαη πέληε θιάδνη, νη νπνίνη αληηζηνηρνχλ ζηηο πέληε επθαξπσηηθέο ππννηθνγέλεηεο RCMT. Γπν θπηηθέο πξσηεΐλεο RCMT αληρλεχζεθαλ ζηελ ππννηθνγέλεηα FMU (Δηθφλα 26), κέιε ηεο νπνίαο κέρξη ζηηγκήο έρνπλ ηαπηνπνηεζεί κφλν ζηα επβαθηήξηα (Reid et al., 1999). Δπηπιένλ, έρεη δεηρζεί φηη ηα επβαθηήξηα απνηεινχλ θνηλά παζνγφλα ησλ θπηψλ (Alfano and Collmer, 1996), νδεγψληαο ζηε δηαηχπσζε ηεο ππφζεζεο φηη νη θπηηθέο πξσηεΐλεο FMU πηζαλφλ απέθηεζαλ ην γνλίδην FMU απφ έλα επβαθηήξην κε νξηδφληηα κεηαθνξά γελεηηθνχ πιηθνχ. Δπηπξνζζέησο, νη πξσηετληθέο αθνινπζίεο RCMT9 αληρλεχζεθαλ απνθιεηζηηθά ζε επθαξπσηηθνχο νξγαληζκνχο: θπηά, κπθεηφδσα, θπςειηδσηά θαη επγιελφδσα (Πίλαθαο 5). Πίλαθαο 5: Φπινγελεηηθή θαηαλνκή ησλ πξσηετλώλ RCMT Σαμηλνκία RCMT1 (FMU) RCMT2 (NOP2) RCMT7 (NCL1) RCMT8 (YNL022C) RCMT9 Total RCMTs 1 Μεηάδσα 1.1 Υνξδσηά Θειαζηηθά Homo sapiens (Άλζξσπνο) Mus musculus (Μπο)

86 Πηελά Gallus gallus (Κνηφπνπιν) Ακθίβηα Xenopus tropicalis (Βάηξαρνο) Αθηηλνπηεξύγηνη Danio rerio (Ηρζχο) Κεθαινρνξδσηά Branchiostoma floridae (Ακθίνμνο) Οπξνρνξδσηά Ciona intestinalis Νεκαηόδσα Caenorhabditis elegans Δρηλνδέξκαηα Strongylocentrotus purpuratus (Αρηλόο) Κληδάξηα Nematostella vectensis (Θαιάζζηα Αλεκψλε) 1.5. Αλλέιηδα Helobdella robusta (Βδέιια) Μαιάθηα

87 86 Lottia gigantea (Κνριίαο) Αξζξόπνδα Drosophila melanogaster (Μχγα) Φπηά Arabidopsis thaliana Oryza sativa (Όξπδα) Zea mays (Αξαβφζηηνο) Sorghum bicolor (φξγν) Chlamydomonas reinhardtii 1 Μ 1, 1 Μ 1 Μ 1 Μ Μύθεηεο 3.1 Γηθάξπα Αζθνκύθεηεο Saccharomyces cerevisiae (Επκνκχθεηαο) Schizosaccharomyces pombe Βαζηδηνκύθεηεο Cryptococcus neoformans Μηθξνζπνξίδηα

88 87 Encephalitozoon cuniculi 3.3 Fungi incertae sedis Rhizopus oryzae Κπςειηδσηά Cryptosporidium parvum Paramecium tetraurelia Plasmodium falciparum Tetrahymena thermophila Theileria parva Toxoplasma gondii Υναλνκαζηηγσηά Monosiga brevicollis 1 1 Μ Κξππηόθπηα Guillardia theta Γηπινκνλάδεο Giardia lamblia Δληεξνακνηβάδεο Entamoeba histolytica Δπγιελόδσα Trypanosoma cruzi Heterolobosea Naegleria gruberi Μπθεηόδσα Dictyostelium discoideum 12. Parabasalidae

89 88 Trichomonas vaginalis Stamenopiles Phytophthora sojae Thalassiosira pseudonana 14. Ρνδόθπηα Cyanidioschyzon merolae Μ: Μεξηθή αθνινπζία Τπνζεηηθέο πξσηεΐλεο RCMT ηαπηνπνηήζεθαλ in silico ζηηο θπξηφηεξεο επθαξπσηηθέο ηαμηλνκηθέο νκάδεο (Πίλαθαο 5). Ζ NOP2 παξνπζηάδεηαη σο ε κεγαιχηεξε ππννηθνγέλεηα RCMT κε ηελ επξχηεξε θπινγελεηηθή θαηαλνκή (Πίλαθαο 5). Δίλαη αμηνζεκείσην φηη νκφινγεο πξσηετληθέο αθνινπζίεο RCMT αληρλεχζεθαλ ζηνπο επθαξπσηηθνχο παξαζηηηθνχο νξγαληζκνχο Theileria parva, Trypanosoma cruzi, Plasmodium falciparum, Entamoeba histolytica, θαη Toxoplasma gondii (Πίλαθαο 5). Σα παξάζηηα απηά πηζαλφλ απέθηεζαλ έλδπκα RCMT απφ ηνπο νξγαληζκνχο-μεληζηέο θαη ην δηαηήξεζαλ ζηηο επφκελεο γελεέο, ππνδεηθλχνληαο φηη νη RCMTs πηζαλφλ δηαδξακαηίδνπλ ζεκαληηθφ ξφιν ζηνλ κεηαβνιηζκφ ησλ πξναλαθεξζέλησλ παξαζηηηθψλ νξγαληζκψλ.

90 89

91 90 Δηθόλα 26: Φπινγελεηηθό δέλδξν ησλ πξσηετληθώλ αθνινπζηώλ RCMT θαηαζθεπαζκέλν κε ηε κέζνδν ηεο Μέγηζηεο Πηζαλόηεηαο. Σν κήθνο ηνπ βξαρίνλα ηνπ δέλδξνπ αληηθαηνπηξίδεη ηελ εμειηθηηθή απφζηαζε. Οη ηηκέο bootstrap (>50) αλαγξάθνληαη ζηνπο θφκβνπο ηνπ δέλδξνπ. Ζ θιίκαθα άλσ αξηζηεξά ζπκβνιίδεη ηνλ ξπζκφ αληηθαηάζηαζεο ακηλνμέσλ ζε θάζε ζέζε. Οη πξσηφηππεο αθνινπζίεο RCMT είλαη ππνγξακκηζκέλεο. Oη πξσηετληθέο αθνινπζίεο RCMT ησλ πξνθαξπσηηθψλ νξγαληζκψλ ζεκεηψλνληαη κε κπιε γξαθή. Ζ πξνθαξπσηηθή πξσηετληθή αθνινπζία RumA ρξεζηκνπνηήζεθε σο αθνινπζία αλαθνξάο. Λνγόηππα Αθνινπζίαο ησλ Καηαιπηηθώλ Μνηίβσλ RCMT Λνγφηππα αθνινπζίαο δεκηνπξγήζεθαλ πξνθεηκέλνπ λα πξνζδηνξηζζεί ε ζπλαηλεηηθή αθνινπζία ησλ έμη πιένλ ζπληεξεκέλσλ θαηαιπηηθψλ κνηίβσλ πνπ απαληψληαη ζηηο RCMTs. Σν κνηίβν Ν1 (Δηθφλα 27) δελ απαληάηαη ζε φιεο ηηο ππννηθνγέλεηεο RCMT (Reid et al., 1999). ηα κνηίβα IV θαη VI δηαθξίλνληαη νη θπζηεΐλεο (Δηθφλα 27 θαη Δηθφλα 28), νη νπνίεο εκπιέθνληαη ζηελ θαηαιπηηθή δξάζε ησλ RCMTs. Δπίζεο, ηα ζπληεξεκέλα ακηλνμηθά θαηάινηπα ιπζίλε θαη αζπαξαγηληθφ νμχ, ηα νπνία

92 91 δηαδξακαηίδνπλ ζεκαληηθφ ξφιν ζηε δξαζηηθφηεηα ησλ RCMTs (Bujnicki et al., 2004), δηαθξίλνληαη ζηα κνηίβα I θαη IV (Δηθφλα 27 θαη Δηθφλα 28), αληίζηνηρα. Δπηπξνζζέησο, κέιε ηεο ππννηθνγέλεηαο YNL022C παξνπζηάδνπλ κηα δηαθνξνπνίεζε ζην ζπληεξεκέλν δηπεπηίδην PC ζην κνηίβν IV (Δηθφλα 27, PSC). Δλδέρεηαη ηα έμη απηά κνηίβα λα ρξεζηκεχζνπλ σο νδεγνί γηα ηελ ηαπηνπνίεζε λέσλ πξσηετληθψλ αθνινπζηψλ RCMT. Δηθόλα 27: Λνγόηππα αθνινπζίαο ησλ έμη ζπληεξεκέλσλ θαηαιπηηθώλ κνηίβσλ ησλ πξσηετληθώλ αθνινπζηώλ RCMTs. Οη θαηαιπηηθέο θπζηεΐλεο ππνδεηθλχνληαη κε αζηεξίζθνπο θαη ηα ζπληεξεκέλα ακηλνμέα κε θνπθθίδεο.

93 92 Δηθόλα 28: Σξηζδηάζηαηε δνκή ηεο πξσηεΐλεο FMU. Ζ θξπζηαιιηθή δνκή πξνζδηνξίζζεθε κε πεξίζιαζε αθηίλσλ Υ ζε δηαθξηηηθή ηθαλφηεηα ίζε κε 2.10 Å (αξηζκφο θαηαρψξεζεο ζηε βάζε PDB: 1SQF). Γηαθξίλνληαη νη θαηαιπηηθέο θπζηεΐλεο θαη ηα δχν ζπληεξεκέλα ακηλνμηθά θαηάινηπα. Λνγόηππα Αθνινπζίαο ησλ Πξσηετληθώλ Απνηππσκάησλ RCMT Καηαζθεπάζζεθαλ πέληε απνηππψκαηα, εθ ησλ νπνίσλ ην έλα αληηζηνηρεί ζηελ νηθνγέλεηα RCMT θαη ηα ηέζζεξα ζηηο ππννηθνγέλεηεο FMU, NOP2, NCL1, RCMT9. Σα νλφκαηα ησλ απνηππσκάησλ, ν αξηζκφο ησλ κνηίβσλ πνπ απαξηίδνπλ ην θάζε απνηχπσκα θαη ν αξηζκφο ππνβνιήο ηνπ απνηππψκαηνο ζηε βάζε δεδνκέλσλ PRINTS αλαθέξνληαη ζηνλ Πίλαθα 6. Σα πέληε κνηίβα πνπ απαξηίδνπλ ην απνηχπσκα ηεο νηθνγέλεηαο RCMT αληηζηνηρνχλ ζηα κνηίβα X, I, IV, VI θαη VIII, ηα νπνία απεηθνλίδνληαη ζηελ Δηθφλα 27. Σν απνηχπσκα ηεο ππννηθνγέλεηαο FMU θαηαζθεπάζζεθε απφ θπηηθέο πξσηετληθέο αθνινπζίεο. Σα απνηππψκαηα ησλ ηεζζάξσλ RCMT κνηίβσλ απεηθνλίδνληαη ζηελ Δηθφλα 29. Σα κνηίβα απηά ρξεζηκεχνπλ σο νδεγνί γηα ηελ ηαπηνπνίεζε θαηλνθαλψλ πξσηετληθψλ αθνινπζηψλ πνπ αλήθνπλ ζηελ νηθνγέλεηα RCMT θαη ηηο ηέζζεξηο ππννηθνγέλεηεο.

94 93 Πίλαθαο 6: Πξσηετληθά απνηππώκαηα ηεο νηθνγέλεηαο RCMT θαη ησλ ηεζζάξσλ ππννηθνγελεηώλ RCMT. Οηθνγέλεηα/ Τπννηθνγέλεηα Όλνκα απνηππώκαηνο Αξηζκόο Μνηίβσλ Αξηζκόο ππνβνιήο RCMT RCMTFAMILY 5 PR02008 FMU RCMTFMUVIRPL 4 PR02009 NOP2 RCMTNOP2 3 PR02012 NCL1 RCMTNCL1 3 PR02011 RCMT9 RCMT9 3 PR02010 α) N-ηειηθή πεξηνρή Μνηίβν 1 Μνηίβν 2 Μνηίβν 3 Καηαιπηηθή πεξηνρή Μνηίβν 4

95 94 β) N-ηειηθή πεξηνρή Μνηίβν 1 Μνηίβν 2 C-ηειηθή πεξηνρή Μνηίβν 3 γ) N-ηειηθή πεξηνρή Καηαιπηηθή πεξηνρή Μνηίβν 1 Μνηίβν 2 C-ηειηθή πεξηνρή Μνηίβν 3

96 95 δ) N-ηειηθή πεξηνρή Μνηίβν 1 Μνηίβν 2 Καηαιπηηθή πεξηνρή Μνηίβν 3 Δηθόλα 29: Λνγόηππα ησλ κνηίβσλ πνπ απαξηίδνπλ ηα απνηππώκαηα ησλ ππννηθνγελεηώλ: (α) FMU, (β) NOP2, (γ) NCL1 θαη (δ) RCMT9. ην επάλσ κέξνο αλαγξάθεηαη ε πεξηνρή ζηελ νπνία εληνπίδνληαη ηα κνηίβα. Αλάιπζε ηεο Γνκήο ησλ Γνληδίσλ RCMT Όπσο παξνπζηάδεηαη ζηελ Δηθφλα 30, νη ζέζεηο καηίζκαηνο είλαη δηαηεξεκέλεο ζηηο πξσηεΐλεο ηεο ίδηαο ππννηθνγέλεηαο (Fmu, nop2 θαη nsun5). Αληίζεηα, νη ζέζεηο καηίζκαηνο ζηηο πξσηεΐλεο ηνπ ίδηνπ νξγαληζκνχ αιιά δηαθνξεηηθψλ ππννηθνγελεηψλ δελ είλαη ζπληεξεκέλεο (Pavlopoulou and Kossida, 2009). Arabidopsis Fmu LMIWNNNDPGFSLRANTGRDITRADLVERLNSLKVPHELSLHLEEFVRIK 50 Όρσζα Fmu LMKWNNSDPHFSIRVNTANGYTRADLIDRLESLQVHYEKS-TMDEFVRIQ 49 Arabidopsis nop2a LIEAFEKQRPTSIRTNTLKTR-RRDLADVLLNRGVNLDPLSKWSKVGLVI 49 Όρσζα nop2a LLESFEKRPPECLRTNTLKTR-RRDLAAALIPRGFNLDPIGKWSKVGLVV 49 Arabidopsis nsun5 ---LTGHLKPRYVRVNTLKMDVDSAVQELEKHYTVQKDET----VPDLLV 43 Όρσζα nsun PKPRFLRVNTLRTSTDSVIEELNKIHKVDKDEL----VPDLLV 39

97 96 Arabidopsis Fmu TGLQTVVQAG-LLKEGICSVQDESAGLIVSVVKPQPGERIMDACAAPGGK 99 Όρσζα Fmu EGMQTVLQAG-LLKEGMCAVQDESAGLVVSVVDPQPGETIIDCCAAPGGK 98 Arabidopsis nop2a YDSQVPIGATPEYLAGYYMLQGASSFLPVMALAPRENERIVDVAAAPGGK 99 Όρσζα nop2a YDSTISAGATVEYMAGHYMKQGASSFLPVMALAPQEKERIVDMAAAPGGK 99 Arabidopsis nsun5 LPPGSDLHAHRLVANGRIFLQGKASSMVAAALQPQAGWEVLDACSAPGNK 93 Όρσζα nsun5 LPPGTDLHNHHLVSEGKVFLQGKASCMVAVALCPEPGWKVIDACAAPGNK 89 Arabidopsis Fmu TLFMASCLKGQGMIYAMDVNEGRLRILGETAKSHQVDGLITTIHSDLRVF 149 Όρσζα Fmu TLFMAARLSGQGKIWALDINKGRLRILMEAAKLHNLDAMISDIHADLRLY 148 Arabidopsis nop2a TTYIAALMKNTGLIYANEMKVPRLKSLTANLHRMGVTNTIVCNYDGRELP 149 Όρσζα nop2a TTYIGALMKNTGIIYANEFNEKRLHGLLGNIHRMGVTNTIVCNYDGKELP 149 Arabidopsis nsun5 TIHLAALMEGQGKIIACELNEERVKRLEHTIKLSGASNIEVCHGDFLGLN 143 Όρσζα nsun5 TVHLAALMNGEGSITACELNKERTKTLQNTIRRSGANNIETINGDFLDID 139 Arabidopsis Fmu -AETNEVQYDKVLLDAPCSGLGVLSKRADLRWN RKLEDML 188 Όρσζα Fmu -AKETTATFDKVLLDAPCSGLGVLSKRADLRWN RQFEDLE 187 Arabidopsis nop2a -KVLGQNTVDRVLLDAPCSGTGIISKDESVKIT KTMDEIK 188 Όρσζα nop2a -KVLGMNSVDRVLLDAPCTGTGTIWKDPQIKTS KGIEDIR 188 Arabidopsis nsun5 PKDPSFAKIRAILLDPSCSGSGTITDRLDHLLPSHSEDN-NMNYDSMRLH 192 Όρσζα nsun5 SNDPSYAEVRAILLDPSCSGSGISTERLDHLLPSHSRGNQDDASTSSRIR 189 Arabidopsis Fmu ELTKLQDELLDSASKLVKH----GGVLVYSTCSIDPEENEGRVEAFLLRH 234 Όρσζα Fmu ELMCLQDELLDSASMLVKP----GGILVYSTCSIDPEENEHRIAAFVQRH 233 Arabidopsis nop2a KFAHLQKQLLLAAIDMVDANSKTGGYIVYSTCSIMVTENEAVIDYALKKR 238 Όρσζα nop2a DCAFVQKQLLLAAIDLVDANSKTGGYIVYSTCSLMIPENEAVVDYALKKR 238 Arabidopsis nsun5 KLAVFQKKALAHALSFPKVER-----VVYSTCSIYQIENEDVVSSVLPLA 237 Όρσζα nsun5 KLSAFQRKALSHALSFPSVER-----VVYSTCSIHQAENEDVVSSVLPLA 234 Arabidopsis Fmu PEFTIDPVTSFVPSSFVTSQGFFLSN PVKHSLDGAFAARLV 275 Όρσζα Fmu PDFVLQSVHGYVPAEFVTDEGFYSSS PTKHSIDGAFAARLV 274 Arabidopsis nop2a DVKLVTCGLDFGRKGFTRFREHRFQPSLDKTRRFYPHVHNMDGFFVAKLK 288 Όρσζα nop2a NVKLVPCGLDFGRPGFIRFREHRFHTSLDKTRRFYPHVNNMDGFFVAKLK 288 Arabidopsis nsun5 SSLGFKLATPFPQWQRRGLPVFAGSEHLLR----MDPVEDKEGFFIALFV 283 Όρσζα nsun5 SSLGFELATPFPQWRRRGLPVFEGSEHLLR----TDPEDGLEGFFISLFV 280 Δηθόλα 30: Οξγάλσζε ησλ γνληδίσλ RCMT. Πνιιαπιή γξακκηθή ζηνίρηζε ησλ ακηλνμηθψλ αθνινπζηψλ πνπ αληηζηνηρνχλ ζηελ θαηαιπηηθή πεξηνρή ησλ πξσηετλψλ Fmu, nop2 θαη nsun5 ησλ θπηψλ Arabidopsis thaliana θαη Oryza sativa (φξπδα) κε ρξήζε ηνπ πξνγξάκκαηνο CLUSTALW (Thompson et al., 1994). Οη ζέζεηο καηίζκαηνο αλαγξάθνληαη ζην ηέινο ησλ αληίζηνηρσλ εμσλίσλ κε καχξε ζθίαζε. Οη αξηζκνί αλαθέξνληαη ζηηο ζέζεηο ησλ ακηλνμέσλ ζε ζρέζε κε ηε ζέζε έλαξμεο ηεο θαηαιπηηθήο πεξηνρήο.

98 97 ΤΕΖΣΖΖ ηελ παξνχζα κειέηε (Pavlopoulou and Kossida, 2009), ηαπηνπνηήζεθαλ πέληε επθαξπσηηθέο ππννηθνγέλεηεο RCMT (FMU, NOP2, NCL1, YNLO22C θαη RCMT9), εθ ησλ νπνίσλ νη ηέζζεξηο αληρλεχζεθαλ απνθιεηζηηθά ζε επθαξπσηηθνχο νξγαληζκνχο (Δηθφλα 25 θαη 26). Οη νκφινγεο πξσηετληθέο αθνινπζίεο RCMT ησλ επθαξπσηηθψλ θαη πξνθαξπσηηθψλ νξγαληζκψλ ζπληζηνχλ αλεμάξηεηνπο, αξθεηά ππνζηεξηγκέλνπο θιάδνπο ζην θπινγελεηηθφ δέλδξν πνπ παξνπζηάδεηαη ζηελ Δηθφλα 26, ππνδεηθλχνληαο φηη ηα εμειηθηηθά γεγνλφηα απφ ηα νπνία πξνέθπςε ν ηειεπηαίνο θνηλφο πξφγνλνο ηεο νηθνγέλεηαο RCMT πηζαλφλ έιαβαλ ρψξα πξηλ ηελ απφθιηζε ησλ επθαξπσηηθψλ απφ ηνπο πξνθαξπσηηθνχο νξγαληζκνχο. Αλ θαη έγηλαλ δηεμνδηθέο αλαδεηήζεηο ζηηο δεκφζηεο βάζεηο δεδνκέλσλ, δελ βξέζεθαλ επθαξπσηηθά νξζφινγα ζηηο πξνθαξπσηηθέο ππννηθνγέλεηεο αιιά νχηε θαη πξνθαξπσηηθά νξζφινγα ζηηο επθαξπσηηθέο ππννηθνγέλεηεο, πιελ ηεο ππννηθνγέλεηαο FMU (Δηθφλα 25 θαη 26), ε νπνία κέρξη ζηηγκήο εζεσξείην φηη είλαη απνθιεηζηηθά πξνθαξπσηηθή. Οη θπηηθέο πξσηεΐλεο FMU έρνπλ δηαηεξήζεη ηηο ζέζεηο καηίζκαηνο ζηα αληίζηνηρα γνλίδηα (Δηθφλα 30), ππνζηεξίδνληαο ηελ ππφζεζε φηη ηα θπηηθά γνλίδηα FMU έρνπλ πηζαλφλ εμειηρζεί απφ έλα πξνθαξπσηηθφ γνλίδην FMU κε νξηδφληηα κεηαθνξά γελεηηθνχ πιηθνχ. Δπηπιένλ, ε ππννηθνγέλεηα NOP2 παξνπζηάδεη κεγαιχηεξε νκνηφηεηα κε ηελ FMU (Δηθφλα 26). Γεδνκέλνπ φηη ηα ραξαθηεξηζκέλα κέιε θαη ησλ δπν ππννηθνγελεηψλ έρνπλ δεηρζεί φηη κεζπιηψλνπλ ππνζηξψκαηα rrna, κπνξνχκε λα δηαηππψζνπκε ηελ ππφζεζε φηη νη θπινγελεηηθέο ζρέζεηο ησλ RCMTs αληηθαηνπηξίδνπλ ηα ππνζηξψκαηα πνπ κεζπιηψλνπλ (π.ρ. rrna, trna). Σα RCMT παξάινγα ηεο νξχδεο θαη ηεο Arabidopsis thaliana ζηνπο θιάδνπο NOP2 θαη NCL1 (Δηθφλα 26) πηζαλφλ απνηεινχλ πξντφληα πξφζθαηνπ γνληδηαθνχ δηπιαζηαζκνχ. Ωζηφζν, έλα κφλν αληίγξαθν YNL022C αληρλεχζεθε ζην γνληδίσκα ησλ Oryza sativa (φξπδα) θαη Arabidopsis thaliana (Δηθφλα 26), ππνδεηθλχνληαο φηη νη γνληδηαθνί δηπιαζηαζκνί έιαβαλ ρψξα ζε κηθξφηεξν βαζκφ ζηελ ππννηθνγέλεηα YNL022C. ε φιεο ηηο επθαξπσηηθέο ππννηθνγέλεηεο, ηα RCMT νκφινγα ησλ κνλνθνηπιήδνλσλ (φξπδα, αξαβφζηηνο, Sorghum bicolor) θαη δηθνηπιήδνλσλ (A.

99 98 thaliana) θπηψλ ζρεκαηίδνπλ μερσξηζηέο θπινγελεηηθέο νκάδεο (Δηθφλα 26), νδεγψληαο ζην ζπκπέξαζκα φηη νη επηκέξνπο ππννηθνγέλεηεο RCMT πξνέθπςαλ απφ κηα ζεηξά εμειηθηηθψλ γεγνλφησλ ηα νπνία πηζαλφλ έιαβαλ ρψξα κεηά απφ ην δηαρσξηζκφ κνλνθνηπιήδνλσλ - δηθνηπιήδνλσλ. ηελ ππννηθνγέλεηα NCL1 (Δηθφλα 26), ελ αληηζέζεη κε ηηο ππννηθνγέλεηεο NOP2 θαη YNL022C, ε ηνπνινγία ησλ θιάδσλ πνπ αληηζηνηρνχλ ζηα κεηάδσα, θπηά θαη κχθεηεο είλαη ζπκβαηή κε ηελ ηνπνινγία ζην Δμειηθηηθφ Γέλδξν (Tree of Life), ζχκθσλα κε ην νπνίν νη κχθεηεο ζρεηίδνληαη πεξηζζφηεξν κε ηα κεηάδσα παξά κε ηα θπηά. Με βάζε ηελ παξαηήξεζε απηή, κπνξνχκε λα ππνζέζνπκε φηη ε εμέιημε ηεο ππννηθνγέλεηαο NCL1 πξνεγείηαη ηεο απφθιηζεο ησλ θπηψλ απφ ηνπο κχθεηεο θαη ηα κεηάδσα, ελψ ε εμέιημε ηεο NOP2 θαη ηεο YNL022C έπεηαη ηεο απφθιηζεο απηήο. Οκφινγεο πξσηεΐλεο RCMT9 αληρλεχζεθαλ ζηα θπηά θαη ηα πξψηηζηα (Πίλαθαο 6), νξγαληζκνί πνπ εμειίρζεθαλ λσξίηεξα ζπγθξηηηθά κε ηα νπηζζφθνληα (κχθεηεο/κεηάδσα). Μπνξνχκε λα δηαηππψζνπκε δπν ππνζέζεηο βάζεη ηεο παξαηήξεζεο απηήο: (1) έλα γνλίδην RCMT9 ππήξρε ζην γνληδίσκα ησλ νπηζζφθνλησλ, ην νπνίν απαιείθζεθε θαηά ηε δηάξθεηα ηεο εμέιημεο θαη (2) νη δηαθνξέο ζηε θπζηνινγία ησλ νπηζζφθνλησλ είραλ σο απνηέιεζκα ηελ απαινηθή ηνπ RCMT9. εκεησηένλ, ηα βιεθαξηδνθφξα θπςειηδσηά, T. thermophila θαη P.tetraurelia, ζρεκαηίδνπλ έλα μερσξηζηφ θιάδν ζηνλ θιάδν πνπ αληηζηνηρεί ζηελ ππννηθνγέλεηα RCMT9, αλεμάξηεην απφ ην επίζεο θπςειηδσηφ, T. parva (Δηθφλα 26). H δηαθνξά απηή, πηζαλφλ, νθείιεηαη ζην γεγνλφο φηη ηα βιεθαξηδνθφξα θπςειηδσηά εμειίζζνληαη κε βξαδχηεξν ξπζκφ. Δπνκέλσο, εμειηθηηθά ζρεηίδνληαη πεξηζζφηεξν κε ηα θπηά πνπ επίζεο εμειίζζνληαη κε αξγφ ξπζκφ. Δπηπιένλ, ε T. parva ζρεηίδεηαη πεξηζζφηεξν κε ην ηαρέσο εμειηζζφκελν επγιελφδσν T. cruzi (Δηθφλα 26). Σν κηθξνζπνξίδην Encephalitozoon cuniculi θαίλεηαη λα ζρεηίδεηαη, ζε φιεο ηηο ππννηθνγέλεηεο, πεξηζζφηεξν κε ηνπο παξαζηηηθνχο νξγαληζκνχο παξά κε ηνπο κχθεηεο (Δηθφλα 26). Σν γεγνλφο απηφ πηζαλφλ νθείιεηαη ζηελ παξαζηηηθή θχζε ηνπ E. cuniculi. Δπηπξνζζέησο, ζηνλ θιάδν NOP2, ην ρναλνκαζηηγσηφ Monosiga brevicolis παξνπζηάδεη κεγαιχηεξν πνζνζηφ νκνηφηεηαο κε ην κεηάδσν C. elegans. Μηα πηζαλή εμήγεζε είλαη φηη ηα ρναλνκαζηηγσηά είλαη νη πην ζπγγελείο κνλνθχηηαξνη νξγαληζκνί ησλ κεηάδσσλ.

100 99 ΤΠΟΛΟΓΗΣΗΚΟ ΠΡΟΓΡΑΜΜΑ RCMTHMM Απφ έλα αξρηθφ ζχλνιν δεδνκέλσλ απνηεινχκελν απφ ηηο 117 αληηπξνζσπεπηηθέο επθαξπσηηθέο ακηλνμηθέο αθνινπζίεο RCMT (Πίλαθαο 5) θαηαζθεπάζζεθε έλα πξφηππν HMM. Ζ δηαδηθαζία δεκηνπξγίαο HMM πεξηγξάθεηαη αλαιπηηθά παξαθάησ. Λφγσ ηεο δηαθνξάο ηνπ κήθνπο ησλ αθνινπζηψλ RCMΣ, κφλνλ ε θαηαιπηηθή πεξηνρή ησλ RCMTs ρξεζηκνπνηήζεθε ζηελ αλάιπζε. Πξνθεηκέλνπ λα επηιερζεί έλα αληηπξνζσπεπηηθφ ζχλνιν δεδνκέλσλ, νη 117 ακηλνμηθέο αθνινπζίεο ησλ θαηαιπηηθψλ πεξηνρψλ ησλ RCMTs ζηνηρίζεθαλ αλά δεχγε κε ην πξφγξακκα CLUSTALW (Thompson et al., 1994). Οη αθνινπζίεο κε πνζνζηφ ηαπηφζεκσλ ακηλνμηθψλ θαηαινίπσλ κεγαιχηεξν απφ 50% δελ ζπκπεξηιήθζεθαλ ζηελ αλάιπζε. Καηά απηφλ ηνλ ηξφπν, δεκηνπξγήζεθε έλα ζχλνιν δεδνκέλσλ απνηεινχκελν απφ 41 αθνινπζίεο. Δλ ζπλερεία, ν αθνινπζίεο απηέο ζηνηρίζεθαλ κε ρξήζε ηνπ πξνγξάκκαηνο CLUSTALW (Thompson et al., 1994). Ζ πνιιαπιή απηή ζηνίρηζε ρξεζηκνπνηήζεθε σο αξρείν εηζαγσγήο ζην πξφγξακκα hmmbuild πνπ πεξηιακβάλεηαη ζην ππνινγηζηηθφ παθέην HMMER (http://hmmer.wustl.edu;(eddy, 1998) γηα ηε δεκηνπξγία HMM. Υξεζηκνπνηήζεθε ην πξφγξακκα hmmsearch πνπ επίζεο πεξηιακβάλεηαη ζην ππνινγηζηηθφ παθέην HMMER πξνθεηκέλνπ λα ζπγθξηζεί κηα αθνινπζία επεξψηεζεο έλαληη ηνπ HMM πνπ δεκηνπξγήζακε. Ζ εγθπξφηεηα ηνπ HMM αμηνινγήζεθε κε έλα ζχλνιν δεδνκέλσλ απνηεινχκελν απφ 114 πξσηεΐλεο ραξαθηεξηζκέλεο θαη θαηαρσξεκέλεο ζηηο δεκφζηεο ΒΓ, νη νπνίεο παξνπζηάδνπλ πςειφ βαζκφ νκνηφηεηαο κε ηηο RCMTs (π.ρ. DNMTs, RUMTs). Οη αθνινπζίεο απηέο πξνβιέθζεθαλ σο κε-rcmt αθνινπζίεο κε 100% αθξίβεηα. Βάζεη ησλ παξαπάλσ απνηειεζκάησλ, θαζνξίζηεθε σο θαηψθιη ηεο Δ-value ε ηηκή 4e-15. Σν ηξνπνπνηεκέλν πξφγξακκα hmmsearch ελζσκαηψζεθε ζην πξφγξακκα RCMTHMM ην νπνίν είλαη ειεχζεξα δηαζέζηκν ζηε δηεχζπλζε URL: Γηα ηε δεκηνπξγία ηεο παξαπάλσ ηζηνζειίδαο ρξεζηκνπνηήζεθε ε γιψζζα ζήκαλζεο XHTML (extensible HyperText Markup Language). Ζ γιψζζα PHP ρξεζηκνπνηήζεθε γηα ηε δεκηνπξγία ελφο δπλακηθνχ θψδηθα XHTML (Δηθφλα 31). Υξεζηκνπνηήζεθε ν δηαθνκηζηήο Apache. Ο ρξήζηεο εηζάγεη ζηε θφξκα ππνβνιήο κηα πξσηετληθή αθνινπζία ζε κνξθή αξρείνπ FASTA (Δηθφλα 32). Όηαλ ν ρξήζηεο παηήζεη ην θνπκπί ππνβνιήο «Predict» μεθηλάεη ε

101 100 δηαδηθαζία εθηέιεζεο ηνπ πξνγξάκκαηνο. Σν απνηέιεζκα (δειαδή, εάλ ε αθνινπζία επεξψηεζεο είλαη ή δελ είλαη RCMT πξσηετληθή αθνινπζία) παξνπζηάδεηαη ζε δηαθνξεηηθφ παξάζπξν (Δηθφλα 33). <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/tr/xhtml/dtd/xhtml1-transitional.dtd> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <meta http-equiv="content-type" content="text/html; charset=utf-8" /> <title>rcmthmm</title> <style type="text/css"> body (Frye and Watt, DEBDD6) h1 {font-family: "Verdana", "Helvetica", "Arial", sans-serif; fontweight: bold; font-size: 35px;} h2 {font-family: "Verdana", "Helvetica", "Arial", sans-serif; fontweight: bold; font-size: 20px;} h3 {font-family: "Verdana", "Helvetica", "Arial", sans-serif; fontweight: bold; font-size: 18px;} p {font-family: "Verdana", "Helvetica", "Arial", sans-serif; fontsize: 15px; text-align: justify;} a:visited {color: #008080} a:hover {color: #008080} img {color:#000000; border:solid;} </style> </head> <body> <table width="100%" height="100%" border="0" cellpadding="0" cellspacing="0"> <tr > <td > <h1>rcmthmm</h1> <p>the RCMTHMM method discriminates the eukaryotic <b>rcmts</b> (RNA (cytosine-5)-methyltransferases) from the other proteins based on a hidden Markov model.</p> </td><td> <img src="rcmthmm.gif" align="center" alt="rcmt catalyzes the transfer of a mehtyl group to the fifth carbon of a pyrimidine base in RNA" /> </td> </tr> <tr><td> <hr /> </td></tr> <tr><td >

102 101 <?php $quantity = $_POST['seqpaste']; $thefile = "query.fa"; $openedfile = fopen($thefile, "w"); fwrite($openedfile, $quantity); fclose($openedfile); exec('./src/hmmsearch rcmt.hmm query.fa'); /* edo tha kaleitai to programma kai tha apothikeuetai to evalue sto evalue.txt*/ sleep(3); $thefile = "evalue.txt"; $variable = file_get_contents($thefile); if($variable < 4E-15){ print '<p> <font size="30" color="green"><b>your protein is a RCMT protein</b></font></p>'; }else{ print '<p><font size="30" color="red"><b>your protein is NOT a RCMT protein</b></font></p>'; }?> </td> </tr> <tr><td> <hr /> </td></tr> <tr ><td > <h3>reference</h3> <p>pavlopoulou A., Kossida S. (2009). "Phylogenetic analysis of the eukaryotic RNA (cytosine-5)-methyltransferases." <i>genomics,</i> <b>93:</b> <a href="http://www.ncbi.nlm.nih.gov/pubmed/ ?itool=entrezsystem2. PEntrez.Pubmed.Pubmed_ResultsPanel.Pubmed_RVDocSum&ordinalpos=1">PubMe d</a></p> </td></tr></table> </body> </html> Δηθόλα 31: Πεγαίνο θώδηθαο ηεο ζειίδαο PHP

103 102 Δηθόλα 32: Σν θύξην παξάζπξν ηεο δηεπαθήο ηνπ πξνγξάκκαηνο RCMTHMM. Δηθόλα 33: Υαξαθηεξηζηηθό παξάδεηγκα αξρείνπ εμόδνπ ηνπ πξνγξάκκαηνο RCMTHMM.

104 103 ΜΔΡΟ ΗΗΗ: ΠΔΠΣΗΓΑΔ ΤΓΓΔΝΔΗ ΣΖ ΚΑΛΛΗΚΡΔΨΝΖ

105 104 ΔΗΑΓΧΓΖ Οη πεπηηδάζεο ζπγγελείο ηεο θαιιηθξεΐλεο (KLKs) ζπληζηνχλ κηα ππννηθνγέλεηα ησλ ζεξηλνπξσηετλαζψλ κε πξνβιεπφκελε ελδπκηθή δξάζε ηχπνπ ζξπςίλεο ή ρπκνζξπςίλεο, θαη έρνπλ αληρλεπζεί ζε πνηθίινπο ηζηνχο θαη βηνινγηθά πγξά (Borgoño and Diamandis, 2004). Οη ηζηηθέο KLKs ραξηνγξαθνχληαη σο ζπζηάδα κε δηαθνπηφκελσλ γνληδίσλ ζην αλζξψπηλν ρξσκφζσκα 19q , ε νπνία απνηειείηαη απφ 15 γνλίδηα θαη έλα ςεπδνγνλίδην (ς1) (Δηθφλα 34Α). Σα γνλίδηα πνπ θσδηθνπνηνχλ ηηο ηζηηθέο KLKs έρνπλ ηελ ίδηα δνκή θαη απαξηίδνληαη απφ πέληε θσδηθεχνληα εμψληα, έλα ή πεξηζζφηεξα κε κεηαθξαδφκελα εμψληα ζηελ 5 ή 3 κε κεηαθξαδφκελε πεξηνρή ηνπ γνληδίνπ. Δπίζεο, ηα κεγέζε ησλ εμσλίσλ είλαη παξφκνηα θαη νη θάζεηο ησλ εζσλίσλ είλαη απφιπηα ζπληεξεκέλεο κεηαμχ ησλ γνληδίσλ (Δηθφλα 34Β) (Borgoño and Diamandis, 2004). Ζ νηθνγέλεηα ησλ αλζξσπίλσλ θαιιηθξετλψλ απνηειείηαη απφ ηηο επνλνκαδφκελεο «θιαζζηθέο» θαη «κε θιαζζηθέο» KLKs. ηηο «θιαζζηθέο» KLKs ππάγνληαη νη πξσηεΐλεο KLK1 (pancreatic/renal kallkrein), KLK2 (glandular kallikrein 2) θαη KLK3 ή εηδηθφ πξνζηαηηθφ αληηγφλν (PSA, Prostate-Specific Antigen) (Yousef and Diamandis, 2001). ηηο «κε θιαζζηθέο» KLKs ππάγνληαη νη πξσηεΐλεο KLK4-KLK15 (Borgoño and Diamandis, 2004; Lundwall et al., 2006). Όιεο νη αλζξψπηλεο KLKs παξνπζηάδνπλ ζεκαληηθφ πνζνζηφ νκνηφηεηαο ζηελ ακηλνμηθή αθνινπζία (40-80%). Οη KLKs ζπληίζεληαη σο πξν-πξν-έλδπκα (κήθνπο κεηαμχ 244 θαη 293 ακηλνμηθψλ θαηαινίπσλ) (Δηθφλα 34Γ). Απνκάθξπλζε ηνπ ζεκαηνδνηηθνχ πεπηηδίνπ νδεγεί ζηελ έθθξηζε ηνπ αλελεξγνχ πξν-έλδπκνπ (δπκνγφλνπ). Δλ ζπλερεία, ε πξσηενιπηηθή απνκάθξπλζε ηνπ πξνπεπηηδίνπ έρεη σο απνηέιεζκα ηελ ελεξγνπνίεζε ηνπ δπκνγφλνπ θαη ηελ παξαγσγή ψξηκνπ (ελεξγνχ) ελδχκνπ (Borgoño and Diamandis, 2004; Lundwall and Brattsand, 2008; Sotiropoulou et al., 2009) (Δηθφλα 34Γ). Ζ θαηαιπηηθή ηξηάδα His 57, Asp 102 θαη Ser 195 (αξίζκεζε κε βάζε ηε ρπκνζξπςίλε), ε νπνία είλαη απαξαίηεηε γηα ηελ ελδπκηθή δξάζε ησλ ζεξηλνπξσηετλαζψλ, είλαη δηαηεξεκέλε ζηηο θαιιηθξεΐλεο. Σν ακηλνμχ Gly 193, ραξαθηεξηζηηθφ ησλ ελδχκσλ κε δξάζε ηχπνπ ζξπςίλεο, είλαη επίζεο δηαηεξεκέλν (Borgoño and Diamandis, 2004; Schmidt et al., 2004). Δληνχηνηο, ην γνλίδην πνπ θσδηθνπνηεί ηελ πιάζκα KLK ( KLKB1 ή παξάγνληαο Fletcher) δελ εληνπίδεηαη ζηε ζπζηάδα ηζηηθψλ KLKs, αιιά

106 105 ραξηνγξαθείηαη ζην αλζξψπηλν ρξσκφζσκα 4q35 θαη απνηειείηαη απφ 15 εμψληα (Yousef and Diamandis, 2001). Έθθξαζε ησλ KLKs έρεη παξαηεξεζεί ζε δηάθνξα φξγαλα, φπσο ην πάγθξεαο, ε θαξδηά, ν ιάξπγγαο, ην θεληξηθφ λεπξηθφ ζχζηεκα, ν ζπξενεηδήο, ν καζηφο, νη σνζήθεο, ν πξνζηάηεο, ππνδεηθλχνληαο φηη νη θαιιηθξεΐλεο ζπκκεηέρνπλ ζε ζεκαληηθέο βηνινγηθέο δηεξγαζίεο (Lawrence et al., 2010; Shaw and Diamandis, 2007). Αξθεηά δεδνκέλα ζπλεγνξνχλ γηα ηε ζπκκεηνρή ησλ θαιιηθξετλψλ ζε πξσηενιπηηθνχο θαηαξξάθηεο, πξνηείλνληαο εκπινθή ησλ θαιιηθξετλψλ ζε (παζν)θπζηνινγηθέο δηεξγαζίεο (Lundwall and Brattsand, 2008; Pampalakis and Sotiropoulou, 2007). Έλαο ηέηνηνο θαηαξξάθηεο, ν νπνίνο πεξηιακβάλεη ηηο θαιιηθξεΐλεο KLK5, KLK7 θαη KLK14, έρεη πεξηγξαθεί ζην δέξκα θαη ζπκκεηέρεη ζηε ξχζκηζε ηεο θπζηνινγηθήο απνθνιίδσζεο ηνπ δέξκαηνο αιιά θαη ζε άιιεο δεξκαηνπάζεηεο πνπ ραξαθηεξίδνληαη απφ απμεκέλε απνθνιίδσζε (Caubet et al., 2004; Descargues et al., 2005; Egelrud et al., 2005; Komatsu et al., 2002). Έλαο άιινο θαηαξξάθηεο, πνπ πεξηιακβάλεη ηηο θαιιηθξεΐλεο KLK2, KLK3 θαη KLK5, εκπιέθεηαη ζηε πγξνπνίεζε ηνπ ζπέξκαηνο θαη ζηνλ θαξθίλν ηνπ πξνζηάηε (Lundwall and Brattsand, 2008; Pampalakis and Sotiropoulou, 2007). Αξθεηά δεδνκέλα ππνδεηθλχνπλ φηη νη θαιιηθξεΐλεο ζπκκεηέρνπλ ζε δηαδνρηθά ζηάδηα γέλεζεο θαη εμέιημεο θαξθίλνπ θαη, επηπξνζζέησο, απνηεινχλ ζεκαληηθνχο θαξθηληθνχο δείθηεο (Borgoño and Diamandis, 2004; Borgoño et al., 2004). Γηα παξάδεηγκαο, ην PSA απνηειεί κνξηαθφ δείθηε γηα ηε δηάγλσζε, πξφγλσζε θαη ζηαδηνπνίεζε θαξθίλνπ ηνπ πξνζηάηε (Lilja et al., 2008). Πξνεγνχκελεο κειέηεο ζρεηηθά κε ηελ εμειηθηηθή ηζηνξία ησλ θαιιηθξετλψλ επηθεληξψζεθαλ ζε θαιιηθξετληθά γνλίδηα ζπγθεθξηκέλσλ νξγαληζκψλ, φπσο ηνπ πνληηθνχ (Olsson and Lundwall, 2002), ηνπ αξνπξαίνπ (Olsson et al., 2004), ηνπ ρνίξνπ (Fernando et al., 2007), θαζψο επίζεο θαη ζε κεκνλσκέλα γνλίδηα ηνπ ρηκπαηδή, ηνπ γνξίιια (Karr et al., 1995), ηνπ ίππνπ (Carvalho et al., 2002), ηεο γάηαο (Fujimori et al., 1986) θαη ηνπ ζθχινπ (Chapdelaine et al., 1991). ε πξνεγνχκελε θπινγελεηηθή αλάιπζε (Elliott et al., 2006) είρε πξνηαζεί φηη ν ηειεπηαίνο θνηλφο πξφγνλνο ησλ θαιιηθξετλψλ εκθαλίζζεθε πξηλ απφ ηε δηαθνξνπνίεζε ησλ πιαθνπληνθφξσλ απφ ηα καξζηπνθφξα (δειαδή, πξηλ απφ πεξίπνπ εθαηνκκχξηα ρξφληα). ηελ παξνχζα κειέηε, ε ζπζζψξεπζε κηαο πιεζψξαο γνληδησκαηηθψλ αθνινπζηψλ ζηηο

107 106 δεκφζηεο βάζεηο δεδνκέλσλ θαζψο θαη ε δηαζεζηκφηεηα βηνυπνινγηζηηθψλ κεζφδσλ θαηέζηεζαλ δπλαηή ηελ ηαπηνπνίεζε θαηλνθαλψλ αθνινπζηψλ KLK ζε πνηθίινπο νξγαληζκνχο θαη ηε δηεμαγσγή δηεμνδηθήο θπινγελεηηθήο αλάιπζεο ηεο νηθνγέλεηαο ησλ θαιιηθξετλψλ. ηε ζπλέρεηα απηήο ηεο εξγαζίαο ηα γνλίδηα KLK θαη νη θσδηθνπνηνχκελεο πξσηεΐλεο (KLK) αλαθέξνληαη ζχκθσλα κε ηε δηεζλψο θαζηεξσκέλε πξνηεηλφκελε νλνκαηνινγία (Lundwall et al., 2006). A) B) Γ) Δηθόλα 34: πζηάδα ησλ θαιιηθξετληθώλ γνληδίσλ ηνπ αλζξώπνπ. Α, Ζ ζπζηάδα ησλ γνληδίσλ KLK ηνπ αλζξψπνπ ραξηνγξαθείηαη ζην γελεηηθφ ηφπν 19q13.4 θαη πεξηιακβάλεη 15 γνλίδηα θαη έλα ςεπδνγνλίδην (ς1) δηεπζεηεκέλα ελ ζεηξά ρσξίο ηελ παξεκβνιή κε θαιιηθξετληθψλ γνληδίσλ. Σα γνλίδηα ζπκβνιίδνληαη κε ηξίγσλα θαη νη θνξπθέο ησλ ηξηγψλσλ ππνδεηθλχνπλ ηελ θαηεχζπλζε ηεο κεηαγξαθήο. Β, ρεκαηηθή αλαπαξάζηαζε ηεο δνκήο ησλ γνληδίσλ KLK. Οη ζπληεξεκέλεο θάζεηο ησλ εζσλίσλ ζπκβνιίδνληαη σο I, II θαη 0. Σα ακηλνμέα ηεο θαηαιπηηθήο ηξηάδαο ζπκβνιίδνληαη σο H, D θαη S. Γ, ρεκαηηθή πεξηγξαθή ηεο δνκήο ησλ θαιιηθξετληθψλ πξσηετλψλ.

108 107 ΜΔΘΟΓΟΛΟΓΗΑ Αλαδήηεζε Οκόινγσλ Πξσηετλώλ KLK ζηηο Γεκόζηεο Βάζεηο Γεδνκέλσλ Οκφινγεο πξσηετληθέο αθνινπζίεο KLK αλαθηήζεθαλ απφ ηηο δεκφζηεο βάζεηο δεδνκέλσλ κε ηε ρξήζε ηνπ πξνγξάκκαηνο BLAST θαη «ιέμεηο-θιεηδηά». Σα νλφκαηα θαη/ή ν αξηζκφο θαηαρψξεζεο ησλ ραξαθηεξηζκέλσλ θαιιηθξετλψλ, φπσο νη KLKs ηνπ αλζξψπνπ, ηνπ πνληηθνχ, ηνπ αξνπξαίνπ, θαζψο επίζεο θαη ε KLK3 ηνπ ίππνπ θαη ηνπ ζθχινπ, ρξεζηκνπνηήζεθαλ γηα ηελ αλάθηεζε ησλ αληίζηνηρσλ πξσηετληθψλ αθνινπζηψλ. Δλ ζπλερεία, νη αθνινπζίεο απηέο ρξεζηκνπνηήζεθαλ σο «ηρλεζέηεο» γηα ηελ αλαδήηεζε νκφινγσλ KLKs ζηηο δεκφζηεο βάζεηο δεδνκέλσλ: UniProt, GenBank θαη Ensembl, κε ρξήζε ηνπ ακθίδξνκνπ BLASTp θαη tblastn (ζέηνληαο σο νπδφ ηεο E- value ηελ ηηκή 1.0Δ-90). Οη θαηλνθαλείο αθνινπζίεο ρξεζηκνπνηήζεθαλ ζε πεξαηηέξσ επαλαιεπηηθέο αλαδεηήζεηο. Ζ δηαδηθαζία απηή νινθιεξψζεθε φηαλ δε κπνξνχζαλ λα βξεζνχλ επηπιένλ θαηλνθαλείο αθνινπζίεο KLK. Αλάιπζε ηεο Πξσηνηαγνύο Γνκήο ησλ Πξσηετλώλ KLK Ζ θπξίσο θαηαιπηηθή πεξηνρή ηεο ζξπςίλεο (πνπ είλαη ην αξρέηππν κφξην γηα ηηο ζεξηλνπξσηετλάζεο) ζηηο θαηλνθαλείο αθνινπζίεο KLK εληνπίζζεθε κέζσ ησλ κεραλψλ αλαδήηεζεο: PFAM, SMART, CD-Search θαη ScanProsite, νη νπνίεο δηαηίζεληαη ζηηο αληίζηνηρεο δεπηεξνγελείο πξσηετληθέο βάζεηο δεδνκέλσλ. Δπηπιένλ, κε ηε κεραλήο αλαδήηεζεο FingerPRINTScan, εληνπίζζεθαλ ηξία πξσηετληθά κνηίβα ραξαθηεξηζηηθά ησλ ζξπςίλσλ, ηα νπνία είλαη απνζεθεπκέλα ζηε δεπηεξνγελή πξσηετληθή ΒΓ PRINTS. Οη αθνινπζίεο ησλ ηξηψλ απηψλ ζπληεξεκέλσλ κνηίβσλ, νη νπνίεο εμήρζεζαλ απφ ηηο νκφινγεο πξσηετληθέο αθνινπζίεο KLK ηνπ αλζξψπνπ (Homo sapiens), ηνπ δίδειθπ (Monodelphis domestica), ηνπ πιαηχπνδα (Ornithorhynchus anatinus), ηεο ζαχξαο (Anolis carolinensis) θαη ηνπ βαηξάρνπ (Xenopus tropicalis), ηξνθνδφηεζαλ ην ππνινγηζηηθφ πξφγξακκα Weblogo γηα ηε δεκηνπξγία ινγνηχπσλ.

109 108 Πξόβιεςε ηεο Γεπηεξνηαγνύο Γνκήο ησλ Πξσηετλώλ KLK Ζ δεπηεξνηαγήο πξσηετληθή δνκή ησλ ππνςήθησλ ακηλνμηθψλ αθνινπζηψλ KLK πξνβιέθζεθε βάζεη ηνπ ζπλαηλεηηθνχ απνηέιεζκαηνο ησλ ππνινγηζηηθψλ πξνγξακκάησλ PSIPRED, Jpred3, Porter SSpro θαη CDM. Αληηπξνζσπεπηηθέο θαηλνθαλείο πξσηετληθέο αθνινπζίεο KLK ζηνηρίζεθαλ κε ηξείο αθνινπζίεο KLK γλσζηήο ηξηηνηαγνχο δνκήο κε ρξήζε ηνπ πξνγξάκκαηνο PROMALS3D. Οη γλσζηέο KLKs θαη νη αξηζκνί θαηαρψξεζεο ζηε βάζε δεδνκέλσλ PDB ήηαλ: KLK1 (1SPG) (Laxmikanthan et al., 2005), KLK5 (2PSY) (Debela et al., 2007) θαη KLK6 (1GVL) (Gomis-Ruth et al., 2002). Αλάιπζε ηεο Σξηηνηαγνύο Γνκήο ησλ Πξσηετλώλ KLK Πξνθεηκέλνπ λα εθηηκεζεί ε ζπληήξεζε ησλ ακηλνμηθψλ θαηαινίπσλ ησλ θαηλνθαλψλ KLKs, ρξεζηκνπνηήζεθε ην πξφγξακκα ConSurf (Landau et al., 2005). Ζ πνιιαπιή γξακκηθή ζηνίρηζε ησλ αθνινπζηψλ KLK (εμαηξνπκέλσλ ησλ κεξηθψλ αθνινπζηψλ θαη ησλ αθνινπζηψλ ηνπ πιαηχπνδα) πνπ αλαιχζεθαλ ζηελ παξνχζα κειέηε ηξνθνδφηεζε ην ConSurf. Ο βαζκφο ζπληήξεζεο ησλ ακηλνμέσλ απεηθνλίζζεθε ζηελ πξνζδηνξηζκέλε ηξηηνηαγή δνκή ηνπ δπκνγφλνπ θαιιηθξεΐλεο 6 (pro-klk6) ηνπ αλζξψπνπ (αξηζκφο θαηαρψξεζεο ζηε βάζε δεδνκέλσλ PDB: 1GVL). H απεηθφληζε ηεο ηξηζδηάζηαηεο πξσηετληθήο δνκήο έγηλε κε ρξήζε ηνπ πξνγξάκκαηνο κνξηαθήο απεηθφληζεο PyMol. Φπινγελεηηθή Αλάιπζε Οη ακηλνμηθέο αθνινπζίεο ησλ KLKs ζηνηρίζεθαλ ρξεζηκνπνηψληαο ην ππνινγηζηηθφ πξφγξακκα MUSCLE. Πξνθεηκέλνπ λα κειεηεζνχλ νη εμειηθηηθέο ζρέζεηο ησλ νκφινγσλ πξσηετλψλ KLK, δηεμήρζε θπινγελεηηθή αλάιπζε. Πξνο απηήλ ηελ θαηεχζπλζε, θαηαζθεπάζζεθαλ θπινγελεηηθά δέλδξα κε ηε κέζνδν ηεο Μέγηζηεο Πηζαλνθάλεηαο ηξνθνδνηνχκελα κε πνιιαπιέο ζηνηρίζεηο. Σα δέλδξα αλαθαηαζθεπάζζεθαλ κε ρξήζε ηνπ πξνγξάκκαηνο PhyML. Ο ξπζκφο αληηθαηάζηαζεο ελφο ακηλνμένο απφ έλα άιιν

110 109 ππνινγίζζεθε κε ην πξφηππν αληηθαηάζηαζεο LG. Ζ ζεκαληηθφηεηα ηεο ηνπνινγίαο ησλ δέλδξσλ εθηηκήζεθε κε bootstrapping (500 ςεπδν-ζχλνια). Ζ γξαθηθή αλαπαξάζηαζε ησλ θπινγελεηηθψλ δέλδξσλ έγηλε κε ην πξφγξακκα Dendroscope. πληαηληθή Αλάιπζε ησλ Γνληδίσλ KLK Οη ρξσκνζσκηθέο πεξηνρέο ζηηο νπνίεο εληνπίδνληαη ηα γνλίδηα πνπ θσδηθνπνηνχλ ηηο πξσηεΐλεο KLK πξνζδηνξίζζεθαλ κε ρξήζε ηνπ πξνγξάκκαηνο Ensembl GeneView (Hubbard et al., 2009) θαη NCBI MapViewer (Wolfsberg, 2007). Οξγάλσζε ησλ Γνληδίσλ KLK Ζ δνκή ησλ νκφινγσλ γνληδίσλ KLK αλαιχζεθε κέζσ ηεο ηαπηνπνίεζεο ησλ ζέζεσλ καηίζκαηνο ζηα εμψληα πνπ θσδηθνπνηνχλ ηελ θαηαιπηηθή πεξηνρή ηεο ζξπςίλεο ησλ νκφινγσλ πξσηετλψλ KLK. Οη ζέζεηο καηίζκαηνο ηαπηνπνηήζεθαλ κε ην πξφγξακκα ENSEMBL. Δπηπιένλ, έγηλε επαιήζεπζε ησλ ζέζεσλ καηίζκαηνο ρξεζηκνπνηψληαο ηηο ακηλνμηθέο αθνινπζίεο ηεο θαηαιπηηθήο πεξηνρήο ησλ πξσηετλψλ KLK σο «ηρλεζέηεο» ζε αλαιχζεηο tblastn ζηα αληίζηνηρα γνληδηψκαηα. Καηά απηφλ ηνλ ηξφπν, βξέζεθαλ ηα δηαδνρηθά θσδηθεχνληα εμψληα. Δπίζεο, αλαιχζεθε ε δνκή ησλ γνληδίσλ πνπ θσδηθνπνηνχλ ηηο ζεξηλνπξσηετλάζεο ζξπςίλε, ρπκνζξπςίλε, ηνμίλε ηχπνπ KLK (Giovanni-De-Simone et al., 1997), ην πιαζκηλνγφλν (PLG) (Forsgren et al., 1987) θαη ηελ αδηςίλε ή παξάγνληαο D ηνπ ζπκπιεξψκαηνο (CFD) (Rosen et al., 1989). Αλάιπζε ηνπ Ρπζκνύ Μεηαβνιήο ησλ Ακηλνμέσλ Πξνθεηκέλνπ λα γίλεη επαιήζεπζε ησλ απνηειεζκάησλ ησλ θπινγελεηηθψλ αλαιχζεσλ, εμεηάζζεθε ν ξπζκφο κεηαβνιήο ησλ ακηλνμηθψλ θαηαινίπσλ κε ρξήζε ηνπ πξνγξάκκαηνο0πνπ0δηαηίζεηαη0ζηελ0ηζηνζειίδα: (Knudsen and Miyamoto, 2001).

111 110 ΑΠΟΣΔΛΔΜΑΣΑ Σαπηνπνίεζε Οκόινγσλ Πξσηετλώλ KLK ηελ παξνχζα κειέηε, ηαπηνπνηήζεθαλ ζπλνιηθά 260 νκφινγεο πξσηεΐλεο KLK, ε θαηαλνκή ησλ νπνίσλ ζηηο θπξηφηεξεο επθαξπσηηθέο ηαμηλνκηθέο νκάδεο (ζχκθσλα κε ηελ ηαμηλνκηθή βάζε δεδνκέλσλ ηνπ NCBI) είλαη ε εμήο: πξσηεχνληα (78), ηξσθηηθά (57), ζαξθνβφξα (24), εληνκνβφξα (9), πεξηζζνδάθηπια (12), αξηηνδάθηπια (23), ρεηξφπηεξα (12), αθξνζεξία (15), μέλαξζξα (5), κεηαζεξία (14), πξσηνζεξία (5), ιεπηδνζαχξηα (3), πηελά (2), ακθίβηα (1), ηρζχεο (0), αζθίδηα (0) θαη έληνκα (0). Οη αξηζκνί θαηαρψξεζεο ησλ θαηλνθαλψλ αθνινπζηψλ αλαγξάθνληαη ζηνλ πίλαθα ηνπ Παξαξηήκαηνο 2. Ζ ακηλνμηθή αθνινπζία ηεο θαηαιπηηθήο πεξηνρήο ησλ 260 θαηλνθαλψλ νκφινγσλ πξσηετλψλ KLK ρξεζηκνπνηήζεθε γηα ηελ θαηαζθεπή ελφο θπινγελεηηθνχ δέλδξνπ κε ηε κέζνδν ηεο Μέγηζηεο Πηζαλνθάλεηαο (Δηθφλα 35). Ζ πξφζθαηε νινθιήξσζε ηεο αιιεινχρεζεο ηνπ γνληδηψκαηνο ηνπ ζπίλνπ (Warren et al., 2010) θαη ηνπ πιαηχπνδα (Warren et al., 2008) θαηέζηεζε εθηθηή ηελ ηαπηνπνίεζε θαηλνθαλψλ πξσηετληθψλ αθνινπζηψλ KLK ζε απηνχο ηνπο νξγαληζκνχο, δπν εθ ησλ νπνίσλ δελ είλαη πιήξεηο ιφγσ ηνπ φηη δελ έρεη νινθιεξσζεί ε αιιεινχρεζε ζε απηή ηελ ρξσκνζσκηθή πεξηνρή (Παξάξηεκα 2). Οη κεξηθέο απηέο αθνινπζίεο δελ ζπκπεξηιήθζεθαλ ζηελ θπινγελεηηθή αλάιπζε. ην θπινγελεηηθφ δέλδξν πνπ παξνπζηάδεηαη ζηελ Δηθφλα 35, δηαθξίλνληαη 15 θπινγελεηηθέο νκάδεο, νη νπνίεο αληηζηνηρνχλ ζηα 15 κέιε ηεο νηθνγέλεηαο ησλ αλζξσπίλσλ θαιιηθξετλψλ (KLK1- KLK 15). Δλ ζπλερεία, έλα δείγκα 114 πξσηετληθψλ αθνινπζηψλ KLK επηιέρζεθε γηα πεξαηηέξσ θπινγελεηηθή αλάιπζε ρξεζηκνπνηψληαο ηε κέζνδν ηεο Μέγηζηεο Πηζαλνθάλεηαο (Δηθφλα 36). Δλ γέλεη, ην δέλδξν είλαη θαιά ππνζηεξηγκέλν (δειαδή, κε πςειέο ηηκέο bootstrap). Οη ακηλνμηθέο αθνινπζίεο ησλ ζξπςίλσλ ρξεζηκνπνηήζεθαλ σο αθνινπζίεο αλαθνξάο. εκεησηένλ, πέξαλ ησλ 15 ήδε γλσζηψλ θαιιηθξετληθψλ αθνινπζηψλ, ηξεηο θαηλνθαλείο νκφινγεο KLKs αληρλεχζεθαλ ζηε ζαχξα, νη νπνίεο ζρεκαηίδνπλ αλεμάξηεηνπο, αξθεηά ππνζηεξηγκέλνπο θιάδνπο θαη ζηα δχν δέλδξα, θαη σο εθ ηνχηνπ νλνκάζζεθαλ «νξθαλέο KLKs» (Δηθφλα 35 θαη 36). Αμηνπνηήζακε ην γεγνλφο νηη νη KLKs ραξηνγξαθνχληαη σο ζπζηάδα γνληδίσλ ζηνλ ίδην

112 111 γελεηηθφ ηφπν ζηνλ άλζξσπν θαη ζηνλ πνληηθφ, θαη σο ζπζηάδα ηα αλαδεηήζακε θαη ζηνπο ππφινηπνπο νξγαληζκνχο. Όπσο θαίλεηαη ζηελ Δηθφλα 37, ηα γνλίδηα KLK ζπλεληνπίδνληαη σο ζπζηάδα κε θπκαηλφκελν αξηζκφ γνληδίσλ ζηνπο δηαθφξνπο νξγαληζκνχο θαη ζηελ πεξίπησζε ηνπ βαηξάρνπ αληρλεχζεθε έλα κφλν γνλίδην. Ζ θαηεχζπλζε ηεο κεηαγξαθήο ησλ γνληδίσλ απηψλ είλαη επίζεο δηαηεξεκέλε (Δηθφλα 37). Δπηπξνζζέησο, νη ζέζεηο καηίζκαηνο ζηηο πξσηετληθέο αθνινπζίεο KLK φισλ ησλ νξγαληζκψλ είλαη δηαηεξεκέλεο, ελψ ηα ακηλνμηθά θαηάινηπα πνπ απνηεινχλ ηελ θαηαιπηηθή ηξηάδα βξίζθνληαη ζε ίδηεο ή παξφκνηεο ζέζεηο ζηα εμψληα (Παξάξηεκα 3). Δηθόλα 35: Φπινγελεηηθό δέλδξν ησλ πξσηετληθώλ αθνινπζηώλ KLK θαηαζθεπαζκέλν κε ηε κέζνδν ηεο Μέγηζηεο Πηζαλόηεηαο. Σα κήθε ησλ βξαρηφλσλ ηνπ δέλδξνπ αληηθαηνπηξίδνπλ ηελ εμειηθηηθή απφζηαζε. Ζ θιίκαθα άλσ δεμηά ζπκβνιίδεη ηνλ ξπζκφ αληηθαηάζηαζεο ησλ ακηλνμηθψλ θαηαινίπσλ αλά ζέζε. Οη ζξπςίλεο ρξεζηκνπνηήζεθαλ σο αθνινπζίεο αλαθνξάο (Pavlopoulou et al., 2010).

113 112

114 113 Δηθόλα 36: Φπινγελεηηθό δέλδξν αληηπξνζσπεπηηθώλ πξσηετληθώλ αθνινπζηώλ KLK θαηαζθεπαζκέλν κε ηε κέζνδν ηεο Μέγηζηεο Πηζαλόηεηαο. Σν κήθνο ηνπ βξαρίνλα ηνπ δέλδξνπ αληηθαηνπηξίδεη εμειηθηηθή απφζηαζε. Οη ηηκέο bootstrap (>50) αλαγξάθνληαη ζηνπο θφκβνπο ηνπ δέλδξνπ. Ζ θιίκαθα άλσ αξηζηεξά ζπκβνιίδεη ηνλ ξπζκφ αληηθαηάζηαζεο ησλ ακηλνμέσλ ζε θάζε ζέζε. Οη ζξπςίλεο ρξεζηκνπνηήζεθαλ σο αθνινπζίεο αλαθνξάο (Pavlopoulou et al., 2010).

115 114 Γηαηήξεζε Γνκηθώλ Υαξαθηεξηζηηθώλ ησλ KLKs ζηηο Οξζόινγεο Πξσηεΐλεο KLK Όπσο θαίλεηαη ζηελ Δηθφλα 38, ηα ακηλνμηθά θαηάινηπα ηεο θαηαιπηηθήο ηξηάδαο είλαη δηαηεξεκέλα ζηηο νξζφινγεο πξσηεΐλεο KLK ησλ δηαθφξσλ νξγαληζκψλ. Δληνχηνηο, ε γιπθίλε ζην κνηίβν 3 δελ είλαη ζπληεξεκέλε (Δηθφλα 38). H δηαθνξά απηή νθείιεηαη ζην γεγνλφο φηη ε γιπθίλε έρεη αληηθαηαζηαζεί κε ζεξίλε (Gly193Ser) ζηηο νξζφινγεο πξσηεΐλεο KLK10 (Schmidt et al., 2004). Ζ πξσηεΐλε KLK10 ηνπ πιαηχπνδα φκσο απνηειεί εμαίξεζε, εθφζνλ ε γιπθίλε είλαη ζπληεξεκέλε. Μηα πηζαλή εμήγεζε είλαη φηη ε κεηάιιαμε απηή (Gly193Ser) έιαβε ρψξα κεηά απφ ηε δηαθνξνπνίεζε ησλ σνηφθσλ ζειαζηηθψλ (πιαηχπνδα) απφ ηα ππφινηπα ζειαζηηθά, πηζαλφλ γηα λα απνθηήζεη ε πξσηεΐλε KLK10 ζπγθεθξηκέλε ελδπκηθή δξαζηηθφηεηα θαη εμεηδηθεπκέλε βηνινγηθή ιεηηνπξγία. Μάιηζηα, ζε κηα πξφζθαηε κειέηε, ε KLK10 δελ παξνπζίαζε ελδπκηθή δξαζηηθφηεηα έλαληη ζπλζεηηθψλ ππνζηξσκάησλ, νδεγψληαο ζηε δηαηχπσζε δπν ππνζέζεσλ, ε κηα είλαη φηη ην έλδπκν KLK10 είλαη αλελεξγφ θαη ε άιιε φηη ε ελδπκηθή ηνπ δξαζηηθφηεηα πεξηνξίδεηαη έλαληη ελφο ζπγθεθξηκέλνπ, κέρξη ζηηγκήο αγλψζηνπ, ππνζηξψκαηνο (Yoon et al., 2009). Αλαθνξηθά κε ηε δεχηεξε ππφζεζε, έρεη δεηρζεί φηη ε KLK13 ηνπ πνληηθνχ, παξφιν πνπ θέξεη ηε κεηάιιαμε Gly193Asp, έρεη ελδπκηθή δξαζηηθφηεηα (Kim et al., 1991). Δληνχηνηο, ε κεηάιιαμε Asp102Ala (αξίζκεζε κε βάζε ηε ρπκνζξπςίλε) ζηελ KLK2 ηνπ πηζήθνπ (Macaca mulatta) θαζηζηά ην έλδπκν αλελεξγφ εθφζνλ ην ακηλνμχ Asp102 βξίζθεηαη ζηελ θαηαιπηηθή ηξηάδα KLK2 (Lovgren et al., 1997). Δπηπξνζζέησο, φπσο θαίλεηαη ζηελ Δηθφλα 39Α, ζε επίπεδν δεπηεξνηαγνχο δνκήο, ηα δνκηθά ραξαθηεξηζηηθά ησλ θαιιηθξετλψλ είλαη ζπληεξεκέλα ζηηο νξζφινγεο πξσηεΐλεο ησλ εμειηθηηθά πξψηκσλ νξγαληζκψλ φπσο ηνπ πιαηχπνδα, ηεο ζαχξαο θαη ηνπ βαηξάρνπ. Δπίζεο, αλαιχζακε ηελ πεηξακαηηθά πξνζδηνξηζκέλε ηξηζδηάζηαηε δνκή ηνπ δπκνγφλνπ ηεο KLK6 (Δηθφλα 39Β) ηνπ αλζξψπνπ θαη, φπσο απεηθνλίδεηαη ζηελ Δηθφλα 39Β, ηα ακηλνμέα πνπ ζπλδένληαη άξξεθηα κε ηελ θαηαιπηηθή δξάζε ησλ θαιιηθξετλψλ είλαη ζπληεξεκέλα. Δπνκέλσο, πξνβιέπεηαη φηη ζα είλαη ελεξγά έλδπκα.

116 115

117 116 Δηθόλα 37: πζηάδα ησλ γνληδίσλ KLK. Απεηθνλίδνληαη ε θαηεχζπλζε ηεο κεηαγξαθήο, θαζψο θαη ε ζρεηηθή ζέζε θαη ην κέγεζνο ησλ γνληδίσλ KLK. Σα γνλίδηα πνπ θσδηθνπνηνχλ ηηο πξσηεΐλεο KLK ζπκβνιίδνληαη κε γθξί ηξίγσλα ελψ ηα ςεπδνγνλίδηα KLK αλαπαξηζηάλνληαη κε πεξίγξακκα ηξηγψλσλ. Σα γνλίδηα KLK2, KLK2-ps θαη KLK3 αλαγξάθνληαη κε θφθθηλν ρξψκα. Σν θιαδφγξακκα ζηα αξηζηεξά ζπκβνιίδεη ηηο εμειηθηηθέο ζρέζεηο ησλ νξγαληζκψλ (ζχκθσλα κε ηελ ηαμηλνκηθή βάζε δεδνκέλσλ NCBI). Chr: ρξσκφζσκα, Scf: scaffold. Δηθόλα 38: Λνγόηππα αθνινπζίαο ησλ ηξηώλ ζπληεξεκέλσλ θαηαιπηηθώλ κνηίβσλ ησλ πξσηετληθώλ αθνινπζηώλ KLK. Σα ακηλνμέα ηεο θαηαιπηηθήο ηξηάδαο ππνδεηθλχνληαη κε αζηεξίζθνπο θαη ην ζπληεξεκέλν ακηλνμηθφ θαηάινηπν γιπθίλε ππνδεηθλχεηαη κε θνπθθίδα.

118 117 πζηάδα ησλ Γνληδίσλ KLK Ζ ξαγδαία αχμεζε ησλ αιιεινπρηψλ γλσζηψλ γνληδησκάησλ, αιιά θαη γνληδησκάησλ πνπ απνθξππηνγξαθήζεθαλ πξφζθαηα, φπσο ηνπ θαγθνπξφ (Macropus eugenii), ηνπ πιαηχπνδα (Ornithorhynchus anatinus), ηεο ζαχξαο (Anolis carolinensis) θαη ηνπ ζπίλνπ (Taeniopygia gullata) θαηέζηεζε δπλαηή ηε κειέηε ηεο εμειηθηηθήο ηζηνξίαο ηεο νηθνγέλεηαο ησλ γνλίδησλ ησλ θαιιηθξετλψλ ζε πνηθίινπο νξγαληζκνχο. Όπσο παξνπζηάδεηαη ζηελ Δηθφλα 37 θαη αλαθέξζεθε αλσηέξσ, νη πξσηετλάζεο KLK θσδηθνπνηνχληαη απφ ζπζηάδεο γνληδίσλ πνπ βξίζθνληαη ζε κηα εληαία ρξσκνζσκηθή πεξηνρή, ρσξίο παξεκβνιή κε θαιιηθξετληθψλ γνληδίσλ. Δλ αληηζέζεη κε ηελ νηθνγέλεηα ησλ γνληδίσλ KLK, άιιεο νηθνγέλεηεο πνπ επίζεο απνηεινχληαη απφ κεγάιν αξηζκφ γνληδίσλ, ηα παξάινγα γνλίδηα εληνπίδνληαη ζε δηαθνξεηηθέο ρξσκνζσκηθέο πεξηνρέο (Puente and López-Otín, 2004). Δληνχηνηο, έλεθα ηνπ γεγνλφηνο φηη ε αιιεινχρεζε αξθεηψλ γνληδησκάησλ δελ έρεη νινθιεξσζεί (Warren et al., 2008), ηα γνλίδηα ησλ θαιιηθξετλψλ κεξηθψλ νξγαληζκψλ είλαη «δηαζθνξπηζκέλα» ζε δηαθνξεηηθέο ρξσκνζσκηθέο πεξηνρέο (Δηθφλα 37). Γηα ηνλ ιφγν απηφ, έλα γνλίδην KLK ζεσξείηαη φηη δελ ππάξρεη ζην γνληδίσκα ελφο νξγαληζκνχ ζε πεξίπησζε πνπ ην γνλίδην απηφ δελ έρεη αληρλεπζεί θαη ηαπηφρξνλα ηα γνλίδηα πνπ βξίζθνληαη εθαηέξσζελ ηνπ γνληδίνπ απηνχ ζηελ πξσηνηππηθή ζπζηάδα ησλ γνληδίσλ KLK ηνπ αλζξψπνπ έρνπλ αληρλεπζεί ζηνλ ίδην γελεηηθφ ηφπν. Σα δπν κπνεηδή ςεπδνγνλίδηα KLK2 (KK2-ps) (Olsson et al., 2004) ζπκπεξηιήθζεθαλ ζηελ αλάιπζε πξνθεηκέλνπ λα αλαδηαηππσζεί ε εμειηθηηθή ηζηνξία ησλ θαιιηθξετλψλ. Φπινγελεηηθή Αλάιπζε ησλ Οκόινγσλ Πξσηετλώλ KLK Σα δπν θπινγελεηηθά δέλδξα πνπ θαηαζθεπάζζεθαλ κε ηε κέζνδν ηεο Μέγηζηεο Πηζαλνθάλεηαο είλαη ζπκβαηά, κε παξφκνηα ηνπνινγία (Δηθφλα 35 θαη 36). ηελ παξνχζα εξγαζία, πέξαλ ησλ 15 ήδε γλσζηψλ κειψλ ηεο νηθνγέλεηαο KLK, ηξεηο «νξθαλέο KLKs» ηαπηνπνηήζεθαλ ζηε ζαχξα (Δηθφλα 35 θαη 36). Οη «νξθαλέο KLKs» βξίζθνληαη ζηε βάζε ηνπ θπινγελεηηθνχ δέλδξνπ ππνδεηθλχνληαο φηη απηά είλαη ηα κέιε

119 118 ηεο νηθνγέλεηαο KLK ηα νπνία εκθαλίζζεθαλ πξψηα («πξψην-klks») (Δηθφλα 36). Σξία είδε δεδνκέλσλ ζπλεγνξνχλ ζην γεγνλφο φηη νη «νξθαλέο KLKs» είλαη πξαγκαηηθέο θαιιηθξεΐλεο: (α) ζε αλάιπζε κε ακθίδξνκν BLAST ρξεζηκνπνηψληαο σο αθνινπζίεο επεξψηεζεο ηηο ηξεηο νξθαλέο KLKs ηεο ζαχξαο, νη αθνινπζίεο πνπ πξνέθπςαλ κε ηελ πςειφηεξε βαζκνινγία ήηαλ πξαγκαηηθέο θαιιηθξεΐλεο, (β) νκφινγν ηεο ζξπςίλεο έρεη ηαπηνπνηεζεί ζηε ζαχξα θαη (γ) ηα γνλίδηα KLK ηεο ζαχξαο είλαη δηεπζεηεκέλα ελ ζεηξά (Δηθφλα 37). Οη θαιιηθξεΐλεο KLK6, KLK14 θαη KLK15 αληρλεχζεθαλ γηα πξψηε θνξά ζηα πξσηνζεξία (Δηθφλα 37). Δπηπιένλ, ε KLK15 βξίζθεηαη ζε φινπο ηνπο νξγαληζκνχο, απφ ηα πξσηνζεξία κέρξη ηνλ άλζξσπν (Δηθφλα 37). Ζ KLK1 αληρλεχζεθε γηα πξψηε θνξά ζηα ακθίβηα, σο bona fide θαιιηθξεΐλε θαη εκθαλίδεηαη μαλά ζηα αθξνζεξία, ελψ ε KLK2 αληρλεχζεθε πξψηα ζηα ιαπξαζηαζεξία. Πξνηείλνπκε φηη ην γνλίδην KLK2 απνηειεί πξντφλ δηπιαζηαζκνχ/αληηζηξνθήο ηνπ γνληδίνπ KLK1 ζε έλα πξψηκν ιαπξαζηαζεξίν. Σα παξαπάλσ απνηειέζκαηα ζπκθσλνχλ κε κειέηεο ζρεηηθά κε ηελ εμέιημε ησλ επζεξίσλ. Αλαθνξηθά κε απηέο ηηο ππνζέζεηο, ηα μέλαξζξα θαη ηα αθξνζεξία είλαη ζπγγεληθέο ηαμηλνκηθέο νκάδεο - φπνπ ηα μέλαξζξα είλαη αξραηφηεξα - εθ ησλ νπνίσλ πξνέθπςαλ ηα ιαπξαζηαζεξία θαη νη αξρνληνγιίξεο (Hallstrom et al., 2007; Nikolaev et al., 2007). Ζ παξνπζία ηεο πξσηεΐλεο KLK2 ζηα ζαξθνβφξα, εληνκνβφξα θαη πεξηζζνδάθηπια, θαζψο θαη ε απνπζία ηεο ζηα αξηηνδάθηπια θαη ηα ρεηξφπηεξα (Δηθφλα 37) ππνδεηθλχεη φηη έλα γνλίδην KLK2 πηζαλφλ ππήξρε ζε απηνχο ηνπο νξγαληζκνχο ην νπνίν είηε δηαγξάθεθε είηε εκθαλίζζεθε κεηαγελέζηεξα ζηελ πνξεία ηεο εμέιημεο ζηα ιαπξαζηαζεξία. Δπνκέλσο, ζηα κπνεηδή (πνληίθη θαη αξνπξαίν) ππήξρε πηζαλφλ έλα ελεξγφ γνλίδην KLK2 ην νπνίν απελεξγνπνηήζεθε θαηά ηε δηάξθεηα ηεο εμέιημεο κε ζπλνδφ απνηέιεζκα ηελ εκθάληζε ηνπ ςεπδνγνληδίνπ KLK2 (Δηθφλα 37). Δπηπιένλ, ην γνλίδην KLK2 έρεη πηζαλφλ απελεξγνπνηεζεί ζην γνληδίσκα ηνπ γνξίιια εθφζνλ ην γνλίδην δελ αληρλεχζεθε ζηελ παξνχζα κειέηε θαη απνηειείηαη κφλνλ απφ δπν εμψληα (I θαη V) (Clark and Swanson, 2005). εηξά δηπιαζηαζκψλ ηνπ γνληδίνπ KLK1 είρε σο απνηέιεζκα ηελ εκθάληζε 13 παξάινγσλ γνληδίσλ ηνπ KLK1 ζην γνληδίσκα ηνπ πνληηθνχ θαη 9 KLK1 ζην γνληδίσκα ηνπ αξνπξαίνπ (Δηθφλα 37). Ζ απελεξγνπνίεζε ηνπ KLK2 θαζψο θαη κηα ζεηξά δηπιαζηαζκψλ ηνπ γνληδίνπ KLK1 πξνθαλψο έπνληαη ηεο δηαθνξνπνίεζεο ησλ κπνεηδψλ απφ ησλ ππνινίπσλ ηξσθηηθψλ,

120 119 φπσο ν δηπνδφκπο, εθφζνλ ππάξρεη έλα ελεξγφ έλδπκν KLK2 θαη δηπιαζηαζκφο ηνπ γνληδίνπ KLK1 δελ έιαβε ρψξα ζην γνληδίσκα ηνπ δηπνδφκπ. Α) Πλατύποσς KLK6 IIAGEKCKEDGHPYQVAVYRGG----GLLCGGVLIHPGWVLTAAHCRKP-QLQVLLGKYNLHK 58 Σαύρα KLK ορφανή1 VPGGKACPAHSQPWQAGLFSGF----RLVCGGTLIHKSWVLSAAHCRRRSPFPVRLGEHDLKR 59 Σαύρα KLK ορφανή2 IIGGYNCPQRSRAFQAALVTGRRGNWNIYCGGSLVHPCWVLSAAHCKPRRQMKVCLGKSNLRR 63 Σαύρα KLK ορφανή3 IIGGQECPKHGQPYQVILSNSRKNGPDVQCGGVLIDKDWVLTAAHCDNQGTIHTRMGDHSLRA 63 Βάτρατος KLK1 IIGGEECVPHSQPWQVALYYFS----DFICGGVLINEWWVLTAAHCIQS-HLQVALGAHNKTN 58 Άνθρωπος KLK1 IVGGWECEQHSQPWQAALYHFS----TFQCGGILVHRQWVLTAAHCISD-NYQLWLGRHNLFD 58 Άνθρωπος KLK5 IINGSDCDMHTQPWQAALLLRP---NQLYCGAVLVHPQWLLTAAHCRKK-VFRVRLGHYSLSP 59 Άνθρωπος KLK6 LVHGGPCDKTSHPYQAALYTSG----HLLCGGVLIHPLWVLTAAHCKKP-NLQVFLGKHNLRQ 58 Πλατύποσς KLK6 Q-EEFQQLSPVAQPFPHPDYDR GRHDNDIMLLRLAHPT-PVSRHIKPLSLETDC 110 Σαύρα KLK ορφανή1 L-DWSEQLKLASKVIVHPNYDP QTKNNDIMLVKLLTPV-CLNNKVKILKLPTTC 111 Σαύρα KLK ορφανή2 Y-ERTEQCLNIAEVRVHPEYDR SKNNKDYMLLRLQPCA-RLSDAVKTIQLPSGC 115 Σαύρα KLK ορφανή3 N-EGSEQCIKSAQKFIHPAYNP STHDSDIMLIRLDNSA-NINEYVRPIELATQC 115 Βάτρατος KLK1 P-MGHIQYTYAAKICPHRDFDW STYNNDIMLLKLASQA-DINDRVAPIPLASYL 110 Άνθρωπος KLK1 D-ENTAQFVHVSESFPHPGFNMSLLENRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEE 120 Άνθρωπος KLK5 VYESGQQMFQGVKSIPHPGYSH PGHSNDLMLIKLNRRI-RPTKDVRPINVSSHC 112 Άνθρωπος KLK6 Q-ESSQEQSSVVRAVIHPDYDA ASHDQDIMLLRLARPA-KLSELIQPLPLERDC 110 Πλατύποσς KLK6 NANSSSCLISGWVFVKHSDGGGAREGRSERVSPPDNTECYLHVHPKQREPSRAADAIVEGGES 173 Σαύρα KLK ορφανή1 PVPGTECLISGWGTTTSPEVNFPDVLHCANITVVDYEVCRSIYPN------YINENMVCAGKM 168 Σαύρα KLK ορφανή2 PNDGKQCTVSGWGTTRSPQAQLPAQLQCANVSIVPQPKCNSAYRG------SITPYMVCAGVP 172 Σαύρα KLK ορφανή3 TKPNTRCEVSGWGTIKTPQSEFPDLLQCATVYTISNEECNKAYPN------AITENMLCATVS 172 Βάτρατος KLK1 VADNTKCLASGWG STTSPQETYPDNLKCVSITTASNSVCQASYPR-----DTVTDNMLCAGN 167 Άνθρωπος KLK1 PEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQ------KVTDFMLCVGHL 177 Άνθρωπος KLK5 PSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPR------QIDDTMFCAGDK 169 Άνθρωπος KLK6 SAQTTSCHILGWGKTADG--DFPDTIQCAYIHLVSREECEHAYPG------QITQNMLCAGDE 165 Πλατύποσς KLK6 GRGLGKAQKGDSGGPLVCGGRLRGLVSWGEVPCGTGEKPGVYTNVCRYVDWIRETIR 230 Σαύρα KLK ορφανή1 E-GGTDACQGDSGGPLACNGQLQGIVSWGPILCGQPNRPGVYVNVCKYVDWIRETIR 224 Σαύρα KLK ορφανή2 Q-GGTDSCQGDSGGPLVCNGQLEGVVSWGTYVCAQKGNPGVYAKVCCIVPWIQKTVN 228 Σαύρα KLK ορφανή3 G-GGVDSCQGDSGGPLVCNNKLQGIVSWGMQVCAQAGKPGVYTNICQFTDWIQNTMR 228 Βάτρατος KLK1 MAGGEDTCVGDSGGPLVCNGELHGITSWGDFVCGSPNKPGIFAKVFNYIDWINNIMQ 224 Άνθρωπος KLK1 E-GGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIA 234 Άνθρωπος KLK5 --AGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQ 226 Άνθρωπος KLK6 K-YGKDSCQGDSGGPLVCGDHLRGLVSWGNIPCGSKEKPGVYTNVCRYTNWIQKTIQ 221

121 120 Β) Δηθόλα 39: Α, Πξνβιεπόκελε δεπηεξνηαγήο δνκή ησλ θαηλνθαλώλ KLKs. Οη ακηλνμηθέο αθνινπζίεο πνπ αληηζηνηρνχλ ζηελ θπξίσο θαηαιπηηθή πεξηνρή ησλ θαιιηθξετλψλ ζηνηρίζεθαλ κε ρξήζε ηνπ πξνγξάκκαηνο PROMALS3D. Σα ακηλνμηθά θαηάινηπα ηεο θαηαιπηηθήο ηξηάδαο αλαγξάθνληαη κε καχξε ζθίαζε, ελψ ε ζπληεξεκέλε γιπθίλε αλαγξάθεηαη κε γθξη ζθίαζε. Ζ ζπλαηλεηηθή δεπηεξνηαγήο δνκή απεηθνλίδεηαη ζην ηέινο ηεο ζηνίρηζεο. Οη α-έιηθεο αλαπαξηζηάλνληαη κε θπιίλδξνπο θαη νη β-πηπρέο κε βέιε. Β, Σξηζδηάζηαηε δνκή ηεο pro-klk6. Γξαθηθή απεηθφληζε ηεο pro-klk6, φπνπ ε πην ζπληεξεκέλε πεξηνρή ζπκβνιίδεηαη κε κπιε ρξψκα, ελψ ε ιηγφηεξν ζπληεξεκέλε πεξηνρή ζπκβνιίδεηαη κε θφθθηλν ρξψκα. Σα ηέζζεξα ζπληεξεκέλα ακηλνμηθά θαηάινηπα ππνδεηθλχνληαη κε ηα ζχκβνια Ζ57, D102, S195 θαη G193.

122 121 Σν γνλίδην KLK2 δηαηεξεί ηελ ίδηα θαηεχζπλζε ζε φια ηα γνληδηψκαηα πιελ ησλ πεξηζζνδαθηχισλ, ππνδεηθλχνληαο φηη ε θαηεχζπλζε ηεο κεηαγξαθήο ηνπ γνληδίνπ KLK2 δηαθέξεη κεηαμχ ησλ δηαθφξσλ νξγαληζκψλ. Παξφιν πνπ ην έλδπκν KLK2 ηνπ ίππνπ έρεη πξνβιεπφκελε ελδπκηθή δξάζε ηχπνπ ρπκνζξπςίλεο, παξφκνηα κε απηή ηνπ ελδχκνπ KLK3 (Carvalho et al., 2002), παξνπζηάδεη ην κεγαιχηεξν πνζνζηφ νκνηφηεηαο ζηελ ακηλνμηθή αθνινπζία κε ηα έλδπκα KLK2 θαη, επνκέλσο, ε πξσηεΐλε ηνπ ίππνπ ζπκβνιίδεηαη σο KLK2. Δπίζεο, έρεη δεηρζεί φηη ην έλδπκν KLK2 ηνπ ζθχινπ έρεη ελδπκηθή δξαζηηθφηεηα παξφκνηα κε απηή ηνπ έλδπκνπ KLK2 (Olsson et al., 2004). Πξνηείλνπκε φηη ην γνλίδην KLK3 πξνέθπςε απφ δηπιαζηαζκφ ηνπ KLK2 ζηνπο θαηάξξηλνπο. Σα έλδπκα KLK2 θαη KLK3 εθθξίλνληαη απφ ηνλ πξνζηάηε, φπνπ ην δπκνγφλν ηνπ KLK3 έρεη δεηρζεί φηη ελεξγνπνηείηαη απφ ηελ KLK2 (Lovgren et al., 1997). Ζ παξνπζία ησλ ελδχκσλ KLK2 θαη KLK3 ζηνλ άλζξσπν, ηνλ γνξίιια, ηνλ νπξαγθνηάγθν θαη ηνλ πίζεθν (Δηθφλα 37) νδεγεί ζην ζπκπέξαζκα φηη ηα έλδπκα απηά εκπιέθνληαη ζε θπζηνινγηθέο δηεξγαζίεο πνπ ιακβάλνπλ ρψξα απνθιεηζηηθά ζηνπο θαηάξξηλνπο. Οη θιαζζηθέο KLKs ζπληζηνχλ έλαλ αλεμάξηεην, αξθεηά ππνζηεξηγκέλν θιάδν (Δηθφλα 35 θαη 36). Οη κνλνθπιεηηθέο νκάδεο KLK9 θαη KLK11 είλαη ζπγγεληθέο, φπσο θαίλεηαη ζηα θπινγελεηηθά δέλδξα ησλ Δηθφλσλ 35 θαη 36 κε πςειή ηηκή bootstrap. Σα γνλίδηα KLK9 θαη KLK11 πηζαλφλ απνηεινχλ πξντφληα δηαδνρηθψλ δπιαζηαζκψλ πνπ ζπλέβεζαλ πξηλ απφ ηελ απφθιηζε καξζηπνθφξσλπιαθνπληνθφξσλ (Δηθφλα 35 θαη 36). Παξνκνίσο, ην γνλίδην KLK4 πηζαλφλ απνηειεί πξντφλ δηπιαζηαζκνχ ηνπ KLK5 πνπ έιαβε ρψξα κεηά ηε δηαθνξνπνίεζε ησλ πιαθνπληνθφξσλ απφ ηα καξζηπνθφξα. Δπίζεο, νη θπινγελεηηθέο νκάδεο KLK10 θαη KLK12 είλαη ζπγγεληθέο (Δηθφλα 35 θαη 36), ππνδεηθλχνληαο φηη έλαο αθφκε γνληδηαθφο δηπιαζηαζκφο έιαβε ρψξα. Δπεηδή ε αληηθαηάζηαζε Gly193Ser παξνπζηάδεηαη απνθιεηζηηθά ζηα κέιε ηεο KLK10 (κε εμαίξεζε ηνλ πιαηχπνδα), είλαη εθηθηφ λα ππνζέζνπκε φηη ε αληηθαηάζηαζε απηή έιαβε ρψξα κεηά ηνλ KLK10/KLK12 γνληδηαθφ δηπιαζηαζκφ. εκεησηένλ, νη βξαρίνλεο ηνπ θιάδνπ KLK10 είλαη εμαηξεηηθά επεθηακέλνη (Δηθφλα 36), ππνδεηθλχνληαο φηη ηα κέιε ηεο ππννηθνγέλεηαο KLK10 έρνπλ εμειηρζεί κε ηαρχηεξν ξπζκφ ζπγθξηηηθά κε ηηο ππφινηπεο KLKs.

123 Δηθόλα 40: Δμειηθηηθή ηζηνξία ησλ θαιιηθξετλώλ. ρεκαηηθή αλαπαξάζηαζε ησλ θπξηφηεξσλ γεγνλφησλ πνπ έιαβαλ ρψξα θαηά ηε δηάξθεηα ηεο εμέιημεο ησλ KLKs. 122

124 123 Ζ ηαπηνπνίεζε ηεο θαιιηθξεΐλεο KLK1 ζηα ακθίβηα καο νδεγεζε ζηε δηαηχπσζε ηεο ππφζεζεο φηη ν ηειεπηαίνο θνηλφο πξφγνλνο ησλ θαιιηθξετλψλ πηζαλφλ εκθαλίζζεθε πξηλ απφ πεξίπνπ 330 εθαηνκκχξηα ρξφληα (Zhang et al., 2005). Δληνχηνηο, βάζεη ηεο θπινγελεηηθήο αλάιπζεο, δελ ππάξρνπλ πξψην-klks ζηνλ βάηξαρν (Δηθφλεο 35 θαη 36). Ζ ππφζεζε ηεο εξγαζίαο πνπ δηαηππψζακε είλαη φηη ν πξφγνλνο ησλ νξθαλψλ KLKs ησλ εξπεηψλ, έλα πξώην-νξθαλό KLK γνλίδην πνπ θσδηθνπνηνχζε κηα πξσηεΐλε ηχπνπ ζξπςίλεο, πξσηνεκθαλίζζεθε ζηα ακθίβηα. Μεηά απφ κηα ζεηξά γνληδηαθψλ δηπιαζηαζκψλ/απαινηθψλ πξνέθπςαλ ηα γνλίδηα KLK1-KLK15 ηα νπνία βξίζθνληαη ζηα ζχγρξνλα γνληδηψκαηα. ηελ Δηθφλα 40 ζπλνςίδνληαη ηα θπξηφηεξα γεγνλφηα ζηελ εμειηθηηθή ηζηνξία ησλ θαιιηθξετλψλ. Αλάιπζε ηνπ Ρπζκνύ Μεηαβνιήο Οη ζεκαληηθφηεξεο δηαθνξέο ζηνλ ξπζκφ κεηαβνιήο ησλ ακηλνμηθψλ θαηαινίπσλ ηεο KLK1 ησλ ακθηβίσλ ζπγθξηηηθά κε ηηο άιιεο θαιιηθξεΐλεο παξνπζηάδνληαη αλάκεζα ζηελ KLK1 ηνπ βαηξάρνπ θαη ηηο ηξεηο νξθαλέο KLKs ηεο ζαχξαο (9 ζέζεηο) παξά αλάκεζα ζηελ KLK1 ηνπ βαηξάρνπ θαη ηηο πξσηεΐλεο KLK1 ησλ άιισλ νξγαληζκψλ (4 ζέζεηο) (Δηθφλα 41). Σα απνηειέζκαηα απηά ππνζηεξίδνπλ ηα απνηειέζκαηα ηεο θπινγελεηηθήο αλάιπζεο, φπνπ ε KLK1 ησλ ακθηβίσλ ζρεηίδεηαη θπινγελεηηθά πεξηζζφηεξν κε ηηο πξσηεΐλεο KLK1 παξά κε ηηο θαιιηθξεΐλεο ησλ εξπεηψλ. Δπηπιένλ, ζεκαληηθέο δηαθνξέο αλαθνξηθά κε ηνλ ξπζκφ κεηαβνιήο ησλ ακηλνμέσλ παξνπζηάδνληαη κεηαμχ ησλ πξσηετλψλ KLK7 θαη KLK10, KLK7 θαη KLK12, παξά κεηαμχ ησλ KLK10 θαη KLK12 (Παξάξηεκα 4), ζε ζπκθσλία κε ηα απνηειέζκαηα ηεο θπινγελεηηθήο αλάιπζεο. Γνκή ησλ Γνληδίσλ KLK Oη ζέζεηο καηίζκαηνο ησλ πξσηετληθψλ αθνινπζηψλ ησλ θαιιηθξετλψλ είλαη δηαηεξεκέλεο κε κηθξέο απνθιίζεηο (Παξάξηεκα 3). Ζ παξαηήξεζε απηή νδεγεί ζηε δηαηχπσζε ηεο ππφζεζεο φηη νη ζεξηλνπξσηετλάζεο εμειίρζεθαλ απφ κηα αξρέγνλε

125 124 πξσηεΐλε ηχπνπ ζξπςίλεο θαη έρνπλ δηαηεξήζεη ηηο ίδηεο ζέζεηο καηίζκαηνο. Δμαίξεζε απνηεινχλ ηα γνλίδηα πνπ θσδηθνπνηνχλ ην πιαζκηλνγφλν (PLG), ηα νπνία έρνπλ δηαθνξεηηθέο ζέζεηο καηίζκαηνο ζπγθξηλφκελα κε ηα γνλίδηα πνπ θσδηθνπνηνχλ ηηο ππφινηπεο ζεξηλνπξσηετλάζεο (Παξάξηεκα 3), ππνδεηθλχνληαο φηη ε δηαθνξνπνίεζε κεηαμχ ησλ ζεξηλνπξσηετλαζψλ έιαβε ρψξα εθείλε ηε ρξνληθή πεξίνδν (Forsgren et al., 1987). Α) Β) Δηθόλα 41: Αλάιπζε ηνπ ξπζκνύ κεηαβνιήο. Α, Ζ KLK1 ησλ ακθηβίσλ έλαληη ησλ νξθαλψλ KLKs θαη Β, Ζ KLK1 ησλ ακθηβίσλ έλαληη ησλ πξσηετλψλ KLK1. Σα ακηλνμηθά θαηάινηπα πνπ αλαγξάθνληαη κε θφθθηλν ρξψκα αληηζηνηρνχλ ζε ηαρχηεξν ξπζκφ εμέιημεο ελψ ηα ακηλνμέα πνπ αλαγξάθνληαη κε κπιε ρξψκα αληηζηνηρνχλ ζε βξαδχηεξν ξπζκφ εμέιημεο.

126 125 ΤΕΖΣΖΖ Οη γνληδηαθνί δηπιαζηαζκνί είλαη απαξαίηεηνη γηα ηε δεκηνπξγία γνληδίσλ κε θαηλνθαλείο ή δηαθνξεηηθέο ιεηηνπξγίεο. Καηά απηφλ ηνλ ηξφπν, δεκηνπξγνχληαη νηθνγέλεηεο γνληδίσλ νη νπνίεο απαξηίδνληαη απφ έλα κεγάιν αξηζκφ κειψλ. Ο κεγάινο αξηζκφο ησλ θαιιηθξετληθψλ γνληδίσλ θαη ε νξγάλσζή ηνπο ζε ζπζηάδεο απνηειεί έλα ηδηαίηεξν ραξαθηεξηζηηθφ ηεο νηθνγέλεηαο ησλ θαιιηθξετλψλ, ην νπνίν παξνπζηάδεη ελδηαθέξνλ απφ εμειηθηηθή άπνςε. Γηα παξάδεηγκα, νη πξσηεΐλεο MMP (Fanjul-Fernandez et al., 2010) έρνπλ εμειηρζεί απφ κηα πξσηεΐλε απνηεινχκελε απφ κηα δνκηθή πεξηνρή κεηά απφ κηα ζεηξά γνληδηαθψλ δηπιαζηαζκψλ θαζψο θαη γνληδηαθψλ ζπληήμεσλ. Σα γνλίδηα MMP ζπληζηνχλ κηα εμίζνπ ζεκαληηθή νηθνγέλεηα ε νπνία απαξηίδεηαη απφ 25 γνλίδηα ζηα ζπνλδπισηά θαη 24 ζηνλ άλζξσπν. Σα γνλίδηα ηεο νηθνγέλεηαο απηήο, ελ αληηζέζεη κε ηελ νηθνγέλεηα ησλ γνληδίσλ KLK, είλαη δηαζθνξπηζκέλα ζε δηαθνξεηηθνχο γελεηηθνχο ηφπνπο (Fanjul-Fernandez et al., 2010). Ζ δηαζεζηκφηεηα ελφο κεγάινπ αξηζκνχ γνληδησκάησλ θαηέζηεζε δπλαηή ηε δηεμαγσγή ιεπηνκεξνχο θπινγελεηηθήο αλάιπζεο ηεο νηθνγέλεηαο ησλ θαιιηθξετλψλ. ηελ παξνχζα κειέηε, δείρζεθε φηη ππνζεηηθέο KLKs βξίζθνληαη ζε νξγαληζκνχο πέξαλ απφ ηα ζεξία, ελ αληηζέζεη κε ηελ επηθξαηνχζα άπνςε (Elliott et al., 2006), θαιχπηνληαο κηα εμειηθηηθή απφζηαζε απφ ηα ακθίβηα κέρξη ηα επζεξία. ε πξνεγνχκελεο κειέηεο είρε πξνηαζεί φηη δελ ππάξρνπλ γνλίδηα KLK ζην γνληδίσκα ηνπ θνηφπνπινπ, ηνπ βαηξάρνπ θαη ηνπ ζπίλνπ (Quesada et al., 2010). Δληνχηνηο, ζηε θπινγελεηηθή αλάιπζε πνπ δηεμήρζε ζηελ παξνχζα κειέηε δείρζεθε φηη ππάξρεη ην γνλίδην KLK1 ζην βάηξαρν (Xenopus tropicalis), θαζψο επίζεο θαη κηα νκφινγε πξσηετληθή αθνινπζία KLK ζην δηάλν (Meleagris gallopavo) θαη κηα κεξηθή πξσηετληθή αθνινπζία KLK (πηζαλφλ πξντφλ ςεπδνγνληδίνπ) ζην ζπίλν (Taeniopygia gullata), ελψ ζην θνηφπνπιν (Gallus gallus) δελ βξέζεθαλ νκφινγεο πξσηεΐλεο KLK. Δλ φςεη ησλ απνηειεζκάησλ ηεο παξνχζαο έξεπλαο πξνηείλνπκε ηελ εμειηθηηθή θαηαγσγή ησλ θαιιηθξετλψλ πξηλ απφ 330 εθαηνκκχξηα ρξφληα, φηαλ δειαδή εκθαλίζζεθαλ ηα ακθίβηα. εκεησηένλ, δελ αληρλεχζεθαλ νκφινγεο KLKs ζηνπο ηρζχεο, ηα αζθίδηα θαη ηα έληνκα. Ζ ζπνπδαηφηεηα ησλ απνηειεζκάησλ ηεο παξνχζαο έξεπλαο έγθεηηαη ζην γεγνλφο φηη ε εμέιημε ησλ θαιιηθξετλψλ ζρεηίδεηαη άκεζα κε ηελ εμέιημε ησλ ππνζηξσκάησλ ηνπο.

127 126 πλεμέιημε ησλ Δλδύκσλ KLK θαη ησλ Δηδηθώλ Τπνζηξσκάησλ ηνπο Σα γνλίδηα KLK2 θαη KLK3 εκθαλίζζεθαλ κεηαγελέζηεξα ζηελ πνξεία ηεο εμέιημεο ησλ θαιιηθξετλψλ. Ζ ελδπκηθή ηνπο δξάζε ζρεηίδεηαη θπξίσο κε ηελ αλαπαξαγσγή θαη ζπγθεθξηκέλα κε ηε πγξνπνίεζε ηνπ ζπέξκαηνο δηεπθνιχλνληαο έηζη ηελ απειεπζέξσζε ησλ ζπεξκαηνδσαξίσλ (Borgoño et al., 2004; Lundwall and Brattsand, 2008). Όπσο πξναλαθέξζεθε, ζηνλ πίζεθν ε KLK2 είλαη κεηαιιαγκέλε θαη αλελεξγή (Lovgren et al., 1997). Απηφ πηζαλφλ αληηθαηνπηξίδεη ηηο δηαθνξέο ζηελ αλαπαξαγσγηθή θπζηνινγία ησλ πξσηεπφλησλ, δηφηη ζηνλ πίζεθν ην ζπέξκα δελ πγξνπνηείηαη αιιά δεκηνπξγεί πήγκα (Clark and Swanson, 2005; Jensen-Seaman and Li, 2003)., ηνλ γνξίιια, επίζεο, ην έλδπκν KLK2 είλαη αλελεξγφ, θαζψο θαη ηα ππνζηξψκαηα ηνπ KLK2 ζην ζπεξκαηηθφ πήγκα (δει. ζεκηλνδειίλε I, ζεκηλνδειίλε II θαη ΣGM4). Ζ απνπζία ησλ πξσηετλψλ απηψλ έρεη σο απνηέιεζκα ηελ ειάηησζε ηεο ξεπζηνπνίεζεο ηνπ ζπέξκαηνο θαηά ηελ εθζπεξκάησζε (Clark and Swanson, 2005; Jensen-Seaman and Li, 2003). Δπνκέλσο, ε ελδπκηθή δξαζηηθφηεηα ηεο KLK2 δελ είλαη απαξαίηεηε ζηνλ γνξίιια. Ο πίζεθνο είλαη πνιπγακηθφο θαη παξάγεη ζπεξκαηηθφ πήγκα απαξαίηεην γηα ηνλ αληαγσληζκφ ζπέξκαηνο θαη ηελ πεξηθξνχξεζε ηεο ζεμνπαιηθήο απνθιεηζηηθφηεηαο (Clark and Swanson, 2005; Jensen-Seaman and Li, 2003). Ο γνξίιιαο, ελ αληηζέζεη κε ηνλ πίζεθν, είλαη κνλνγακηθφο θαη δελ παξάγεη ζπεξκαηηθφ πήγκα. Δπνκέλσο, ε απελεξγνπνίεζε ηνπ KLK2 είλαη απνηέιεζκα θπζηθήο επηινγήο. ηνλ ρηκπαηδή, πνπ αλήθεη ζηα πνιπγακηθά πξσηεχνληα, παξφιν πνπ ηα γνλίδηα πνπ θσδηθνπνηνχλ ηηο πξσηεΐλεο KLK2 θαη KLK3 δελ έρνπλ απαιεηθζεί, ην γνλίδην ζεκηλνδειίλε I θσδηθνπνηεί κηα πξσηεΐλε κε κεγαιχηεξε ξεπζηφηεηα ζπγθξηηηθά κε απηή ηνπ αλζξψπνπ (Clark and Swanson, 2005; Jensen-Seaman and Li, 2003). Δπηπιένλ, ηα βννεηδή δελ παξάγνπλ ζπεξκαηηθφ πήγκα. Δπίζεο, ην γνλίδην TGM4, ην νπνίν είλαη απαξαίηεην γηα ηε δεκηνπξγία ηνπ πήγκαηνο, θαζψο επίζεο θαη ηα έλδπκα KLK2 θαη KLK3, ηα νπνία εκπιέθνληαη ζηελ πγξνπνίεζε ηνπ πήγκαηνο, δελ έρνπλ βξεζεί ζηα βννεηδή (Tian et al., 2009). Σα ηξσθηηθά, ηα νπνία είλαη επίζεο πνιπγακηθά δψα, παξάγνπλ ζπεξκαηηθφ πήγκα. Ζ απνπζία ησλ ελδχκσλ KLK2 θαη KLK3 ζηα ηξσθηηθά απνηξέπεη ηε δηάιπζε ηνπ ζπεξκαηηθνχ πήγκαηνο θαη, επνκέλσο, ηελ ηαρεία πγξνπνίεζε ηνπ ζπέξκαηνο (Tian

128 127 et al., 2009). Σα γνλίδηα KLK2, KLK3 θαη TGM4 δελ έρνπλ βξεζεί ζην δίδειθπ, φπσο είλαη πξνβιεπφκελν (Tian et al., 2009). Μηα ζεηξά δεδνκέλσλ ππνδεηθλχνπλ φηη ην έλδπκν KLK4 παίδεη ζεκαληηθφ ξφιν ζηελ αλάπηπμε ησλ νδφλησλ θαη ζπγθεθξηκέλα είλαη απαξαίηεηε γηα ηελ παξαγσγή ηεο αδακαληίλεο (Hart et al., 2004). ε κηα πξφζθαηε κειέηε δείρζεθε φηη ην γνλίδην πνπ θσδηθνπνηεί ηελ αδακαληίλε δελ ππάξρεη ζηα πηελά (Quesada et al., 2010), ζπλάδνληαο κε ηελ απνπζία νδνληνθπΐαο ζηα πηελά. Δπίζεο, ζηελ παξνχζα εξγαζία, ην γνλίδην KLK4 δελ αληρλεχζεθε ζηνλ ζπίλν θαη ηνλ δηάλν, φπσο είλαη πξνβιεπφκελν. Παξνκνίσο, ην γνλίδην πνπ θσδηθνπνηεί ηελ αδακαληίλε βξίζθεηαη ζηα κνλνηξήκαηα, θαη ελψ ηα κηθξά δψα έρνπλ ππνηππψδε δφληηα, ηα ψξηκα κνλνηξήκαηα δελ έρνπλ νδνληνθπΐα (Al-Hashimi et al., 2009). Δπηπιένλ, ζηνπο νξγαληζκνχο απηνχο δελ ππάξρεη ην γνλίδην KLK4 εθφζνλ δελ αληρλεχζεθε ζηνλ πιαηχπνδα. Δπηπξνζζέησο, ηα μέλαξζξα δελ έρνπλ νδνληνθπΐα θαζηζηψληαο ηελ παξνπζία ηνπ έλδπκνπ KLK4 κε αλαγθαία. Παξφιν πνπ δελ αληρλεχζεθε ην γνλίδην KLK4 ζηα μέλαξζξα, δε κπνξνχκε λα απνθιείζνπκε ηελ πηζαλφηεηα παξνπζίαο KLK4 ζην γνληδίσκα ησλ μέλαξζξσλ εμαηηίαο ηνπ γεγνλφηνο φηη ε αιιεινχρεζε ησλ γνληδησκάησλ ησλ μέλαξζξσλ δελ έρεη νινθιεξσζεί. Δληνχηνηο, ην γνλίδην πνπ θσδηθνπνηεί ηελ αδακαληίλε είλαη δηαηεξεκέλν (Al-Hashimi et al., 2009). Ο πξσηενιπηηθφο θαηαξξάθηεο πνπ ζπκκεηέρεη ζηελ απνθνιίδσζε ηνπ δέξκαηνο, αξρίδεη κε απηελεξγνπνίεζε ηνπ δπκνγφλνπ proklk5 (Brattsand et al., 2005). Δλ ζπλερεία, ε ελεξγή KLK5 ελεξγνπνηεί ηα δπκνγφλα proklk7 θαη proklk14. Σν ψξηκν έλδπκν KLK14 επάγεη κε ζεηηθή αλαηξνθνδφηεζε ηελ ελεξγνπνίεζε ηνπ proklk5. Δπηπιένλ, έρεη δεηρζεί φηη ε KLK5 ελεξγνπνηεί ην δπκνγφλν ηεο ειαζηάζεο 2 in vitro, ππνδεηθλχνληαο φηη ε KLK5 είλαη ν θπζηνινγηθφο ελεξγνπνηεηήο ηεο πξνειαζηάζεο 2 ζηελ επηδεξκίδα (Bonnart et al., 2010). Τπεξέθθξαζε ησλ KLK5 θαη KLK7 ζηελ επηδεξκίδα ζπλδέεηαη κε παζνινγηθή απνθνιίδσζε ηνπ δέξκαηνο, έλα ζχκπησκα θνηλφ ζε ζεκαληηθφ αξηζκφ δεξκαηνπαζεηψλ πεξηιακβαλνκέλνπ ηνπ ζπλδξφκνπ Netherton (Descargues et al., 2005). Σν ζχλδξνκo απηφ πξνθαιείηαη απφ κεηάιιαμε ηνπ γνληδίνπ Spink5 ην νπνίν θσδηθνπνηεί ηελ πξσηεΐλε LEKTI, έλαλ αλαζηνιέα ησλ KLKs θαη ησλ ζεξηλνπξσηετλαζψλ (Descargues et al., 2005). ε πεηξακαηφδσα κε απελεξγνπνηεκέλν Spink5 (πνληίθηα Spink5-/-) παξαηεξήζεθε απμεκέλε ελδπκηθή δξαζηηθφηεηα ησλ KLK5,

129 128 KLK7 θαη KLK14 έλαληη ησλ ππνζηξσκάησλ ηνπο, δειαδή ησλ δεζκνζσκάησλ (δεζκνζσκαηίλε, δεζκνγιεΐλε θαη δεζκνθνιιίλε) έρνληαο σο ζπλνδφ απνηέιεζκα ηελ απνθφιιεζε ηεο θεξάηηλεο ζηηβάδαο θαη ζλεζηκφηεηα ησλ λενγλψλ πνληηθψλ (Borgoño et al., 2007). Οη πξσηεΐλεο δεζκνζσκαηίλε (ABU86923), δεζκνγιεΐλε (XP_ ) θαη δεζκνθνιιίλε (XP_ ) βξέζεθαλ ζηνλ πιαηχπνδα, ελψ ζηνλ βάηξαρν βξέζεθε κφλνλ ε πξσηεΐλε δεζκνθνιιίλε (NP_ ). Σα αλσηέξσ απνηειέζκαηα ππνδεηθλχνπλ φηη νη πξσηεΐλεο KLK5, KLK7 θαη KLK14 έρνπλ ζπλεμειηρζεί κε ηα εηδηθά ππνζηξψκαηά ηνπο, ηα νπνία απνηεινχλ ηα αλψηεξα ζηξψκαηα ηεο επηδεξκίδαο. Δληνχηνηο, δε κπνξνχκε λα πξνζδηνξίζνπκε εάλ ν θαιιηθξετληθφο θαηαξξάθηεο ηνπ δέξκαηνο εκθαλίζζεθε ζηνλ πιαηχπνδα εθφζνλ δελ αληρλεχζεθε KLK7 νξζφινγν ζηνλ πιαηχπνδα. Απηφ, φκσο, κπνξεί λα νθείιεηαη ζην γεγνλφο φηη ε αιιεινχρεζε ηνπ γνληδηψκαηνο ηνπ πιαηχπνδα δελ έρεη αθφκα νινθιεξσζεί. Βξόγρνο-99 θαη Πξνζαξκνγή ζε Απμεκέλε Δλδπκηθή Γξαζηηθόηεηα Ο θαιιηθξετληθφο βξφγρνο-99 είλαη απαξαίηεηνο γηα ηε δξαζηηθφηεηα ηνπ θηληλνγφλνπ θαη βξίζθεηαη απνθιεηζηηθά ζηηο θαιιηθξεΐλεο KLK1, KLK2 θαη KLK3/PSA. Σν έλδπκν KLK1 έρεη δεηρζεί φηη πέπηεη έλα θηληλνγφλν ρακεινχ κνξηαθνχ βάξνπο απειεπζεξψλνληαο βξαδπθηλίλε (Borgoño and Diamandis, 2004). ηελ παξνχζα κειέηε, δείρζεθε φηη ε KLK1 πξσηνεκθαλίζζεθε ζηα ακθίβηα. εκεησηένλ, νη(kita et al., 2004)ηαπηνπνίεζαλ κηα ηνμίλε, BLTX, ζηελ κπγαιή Blarina brevicauda, ε νπνία παξνπζηάδεη ζεκαληηθφ πνζνζηφ νκνηφηεηαο ζηελ ακηλνμηθή αθνινπζία (55,5%) κε ηελ αλζξψπηλε KLK1. Μάιηζηα, ζηε θπινγελεηηθή αλάιπζε πνπ δηεμήρζε ζηελ παξνχζα εξγαζία απνδείμακε φηη ε BLTX ζρεηίδεηαη πεξηζζφηεξν κε ηηο πξσηεΐλεο KLK1 (Δηθφλα 36). Δπίζεο, πξφζθαηα, δείρζεθε φηη νη αληηθαηαζηάζεηο θαη νη ελζέζεηο ακηλνμηθψλ θαηαινίπσλ ζηνλ βξφγρν-99 έρνπλ σο απνηέιεζκα ηελ παξαγσγή απμεκέλεο πνζφηεηαο βξαδπθηλίλεο, ε νπνία ζρεηίδεηαη κε ηνμηθφηεηα (Aminetzach et al., 2009). Δπνκέλσο, κπνξνχκε λα ππνζέζνπκε φηη ν βξφγρνο-99 εμειίρζεθε ζηελ KLK1 θαη θαη επέθηαζε ζηηο KLK2 θαη KLK3, πξνθεηκέλνπ λα απνθηήζνπλ ηα έλδπκα απηά απμεκέλε δξαζηηθφηεηα.

130 129 ΠΔΡΗΛΖΦΖ

131 130 ΠΔΡΗΛΖΦΖ ην πιαίζην ηεο παξνχζεο δηαηξηβήο, αμηνπνηήζεθαλ νη αιιεινπρίεο γλσζηψλ γνληδησκάησλ, αιιά θαη γνληδησκάησλ πνπ απνθξππηνγξαθήζεθαλ πξφζθαηα, γηα λα κειεηεζεί ε εμειηθηηθή ηζηνξία ηξηψλ ιεηηνπξγηθά ζεκαληηθψλ πξσηετληθψλ νηθνγελεηψλ: (α) ησλ θπηηθψλ DNA κεζπινκεηαθνξαζψλ θαη (β) ησλ επθαξπσηηθψλ RNA κεζπινκεηαθνξαζψλ, νη νπνίεο είλαη έλδπκα πνπ επηθέξνπλ κεζπιίσζε ζηηο λνπθιενηηδηθέο αιιεινπρίεο, θαζψο θαη (γ) ησλ πεπηηδαζψλ ζπγγελψλ ηεο θαιιηθξεΐλεο (KLKs), νη νπνίεο είλαη γλσζηέο ζεξηλνπξσηετλάζεο κε δξάζε ηχπνπ ζξπςίλεο ή ρπκνζξπςίλεο. Οη εμειηθηηθέο ζρέζεηο ησλ ραξαθηεξηζκέλσλ θαη θαηλνθαλψλ πξσηετλψλ ησλ ηξηψλ νηθνγελεηψλ δηεξεπλήζεθαλ κε θαηαζθεπή θπινγελεηηθψλ δέλδξσλ. Δπίζεο, αλαιχζεθε ε δεπηεξνηαγήο θαη ηξηηνηαγήο δνκή ησλ νκφινγσλ πξσηετλψλ, ε δνκή ησλ γνληδίσλ πνπ θσδηθνπνηνχλ ηηο πξσηεΐλεο απηέο, θαη θαηαζθεπάζζεθαλ δηαγλσζηηθά πξσηετληθά κνηίβα απφ ηηο αιιεινπρίεο ησλ ηξηψλ νηθνγελεηψλ ελδχκσλ. Σα απνηειέζκαηα ησλ αλαιχζεσλ νδήγεζαλ ζηελ εμαγσγή ζεκαληηθψλ ζπκπεξαζκάησλ ζρεηηθά κε ηελ πηζαλή βηνινγηθή ιεηηνπξγία ησλ θαηλνθαλψλ πξσηετλψλ. πγθεθξηκέλα, νκφινγεο θπηηθέο DNA κεζπινκεηαθνξάζεο θαη θαηλνθαλείο επθαξπσηηθέο RNA κεζπινκεηαθνξάζεο ηαπηνπνηήζεθαλ ζε δεκφζηεο βάζεηο δεδνκέλσλ. Λεπηνκεξήο θπινγελεηηθή αλάιπζε νδήγεζε ζηελ ηαπηνπνίεζε ησλ ηεζζάξσλ ήδε γλσζηψλ νηθνγελεηψλ θπηηθψλ DNA κεζπινκεηαθνξαζψλ θαη κηαο θαηλνθαλνχο ππννηθνγέλεηαο (Pavlopoulou and Kossida, 2007). Δπίζεο, ηαπηνπνηήζεθαλ πέληε ππννηθνγέλεηεο επθαξπσηηθψλ RNA κεζπινκεηαθνξαζψλ. Πέξαλ ησλ ηξηψλ ήδε γλσζηψλ ππννηθνγελεηψλ (NOP2, NCL1 θαη YNL022C), ηαπηνπνηήζεθε κηα θαηλνθαλήο ππννηθνγέλεηα (RCMT9), θαη κηα ππννηθνγέλεηα, FMU, ε νπνία εζεσξείην φηη απαληάηαη απνθιεηζηηθά ζε πξνθαξπσηηθνχο νξγαληζκνχο (Pavlopoulou and Kossida, 2009). Δπηπιένλ, θαηαζθεπάζζεθαλ πξσηετληθά απνηππψκαηα ηεο νηθνγέλεηαο (θαη ησλ επηκέξνπο ππννηθνγελεηψλ) ησλ RNA κεζπινκεηαθνξαζψλ, ηα νπνία θαηαρσξήζεθαλ ζηε δεπηεξνγελή πξσηετληθή βάζε δεδνκέλσλ PRINTS (http://www.bioinf.man.ac.uk/dbbrowser/prints). ηα πιαίζηα ηεο δηαηξηβήο,

132 131 αλαπηχρζεθε ην ππνινγηζηηθφ πξφγξακκα RCMTHMM, κε ζθνπφ ηε δηάθξηζε/ηαπηνπνίεζε ησλ επθαξπσηηθψλ RNA κεζπινκεηαθνξαζψλ, ην νπνίν δηαηέζεθε γηα δεκφζηα ρξήζε ζηε δηεχζπλζε URL: εκαληηθή ζπλεηζθνξά ηεο παξνχζαο κειέηεο είλαη ε αλαδηαηχπσζε ηεο εμειηθηηθήο ηζηνξίαο ησλ θαιιηθξετλψλ (Pavlopoulou et al., 2010). Οη θαιιηθξεΐλεο είλαη ζεκαληηθά πξσηενιπηηθά έλδπκα πνπ δξνπλ αηνκηθά ή ζε πξσηενιπηηθνχο θαηαξξάθηεο θαη ξπζκίδνπλ ζεκαληηθέο θπζηνινγηθέο ιεηηνπξγίεο, ελψ ε απνξξπζκηζκέλε δξάζε ηνπο έρεη ζπλδεζεί κε ζνβαξέο αζζέλεηεο (θαξδηναγγεηαθέο, λεπξνεθθπιηζηηθέο, θιεγκνλψδεηο, δεξκαηηθέο, δηάθνξνπο ηχπνπο θαξθίλνπ). Γηα ηελ απνκφλσζε λέσλ θαιιηθξετλψλ αμηνπνηήζεθε ην γεγνλφο φηη ηα KLK γνλίδηα ζπλεληνπίδνληαη ζην ίδην ρξσκφζσκα ππφ κνξθή κε δηαθνπηφκελεο ζπζηάδαο γνληδίσλ. ε πξνεγνχκελεο κειέηεο είρε πξνηαζεί φηη νη θαιιηθξεΐλεο απαληψληαη κφλνλ ζηα ζειαζηηθά θαη φηη εκθαλίζζεθαλ πξηλ απφ πεξίπνπ 150 εθαηνκκχξηα ρξφληα. ηελ παξνχζα κειέηε, νκφινγεο θαηλνθαλείο αθνινπζίεο θαιιηθξετλψλ αληρλεχζεθαλ in silico ζηα γνληδηψκαηα δηάθνξσλ νξγαληζκψλ. Οξζφινγα ησλ θαιιηθξετλψλ ηαπηνπνηήζεθαλ γηα πξψηε θνξά ζηα εξπεηά, ζηα πηελά θαη ζηα ακθίβηα, ππνδεηθλχνληαο ηελ εμειηθηηθή θαηαγσγή ησλ θαιιηθξετλψλ πξηλ απφ 330 εθαηνκκχξηα ρξφληα. Δπηπξνζζέησο, πέξαλ ησλ 15 γλσζηψλ KLKs (KLΚ1-15), ηαπηνπνηήζεθαλ ηξία θαηλνθαλή κέιε (νξθαλέο Klks) θαη κε ζχγθξηζε ησλ πξνβιεπφκελσλ δνκψλ δείρζεθε φηη ηα δνκηθά ραξαθηεξηζηηθά πνπ ζρεηίδνληαη κε ηελ θαηαιπηηθή δξάζε είλαη ζπληεξεκέλα ζηηο θαηλνθαλείο πξσηετληθέο αιιεινπρίεο KLK. εκεησηένλ, δείρζεθε φηη ζηα γνληδηψκαηα φισλ ησλ ππφ εμέηαζε νξγαληζκψλ, ηα νξζφινγα γνλίδηα KLK ραξηνγξαθνχληαη ζηελ ίδηα ρξσκνζσκηθή πεξηνρή, δηεπζεηεκέλα ελ ζεηξά κε ηνλ ίδην πξνζαλαηνιηζκφ θαη ρσξίο παξεκβνιή κε θαιιηθξετληθψλ γνληδίσλπξνηείλακε φηη ε νηθνγέλεηα ησλ θαιιηθξετλψλ πξνέθπςε απφ κηα ζεηξά γνληδηαθψλ δηπιαζηαζκψλ θαη κεηαιιάμεσλ, θαη φηη νη θαιιηθξεΐλεο έρνπλ ζπλεμειηρζεί κε ηα εηδηθά ππνζηξψκαηά ηνπο (Pavlopoulou et al., 2010).

133 132 ABSTRACT

134 133 ABSTRACT In the present thesis, the availability of an increasing number of complete or almost complete genomes, including those that were completed recently, enabled the study of the evolutionary history of three functionally important protein families: (a) the plant DNA methyltransferases and (b) the eukaryotic RNA methyltransferases, which are enzymes that catalyze the transfer of a methyl group to nucleotide sequences, as well as (c) the kallikrein-related peptidases or KLKs, which are trypsin- or chymotrypsin-like serine proteases. The evolutionary relationships of the already known and the novel proteins of the three families that were identified here were investigated using phylogenetic trees. Moreover, the secondary and tertiary structures of the homologous proteins were analyzed, as well as the structure of the protein-encoding genes, and diagnostic protein motifs were constructed based on the sequences of the three enzyme families. Our results led to suggestions pertaining to the biological function of the identified novel proteins. In particular, homologous plant DNA methyltransferases and novel eukaryotic RNA methyltransferases were identified in publicly accessible sequence databases. Detailed phylogenetic analysis of plant DNA methyltransferases identified four already known families and a novel subfamily in addition (Pavlopoulou and Kossida, 2007). Moreover, five distinct eukaryotic RNA methyltransferase subfamilies were identified; apart from the three already known subfamilies (NOP2, NCL1 and YNL022C), one novel subfamily (RCMT9) and the FMU which hitherto was considered to exist exclusively in prokaryotes were also identified (Pavlopoulou and Kossida, 2009). Furthermore, protein fingerprints were constructed from the generic family of RNA methyltransferases (and the individual subfamilies), which were deposited in the PRINTS database (http://www.bioinf.man.ac.uk/dbbrowser/prints). We developed the

135 134 computational program RCMTHMM, in order to discriminate/identify eukaryotic RNA methyltransferases from other proteins. The RCMTHMM program has been made publicly available in the URL: Finally, the evolutionary history of KLKs was reconstructed. Kallikreins are important proteolytic enzymes which are involved in proteolytic cascade pathways and their dysregulated expression has been associated with major human pathologies (cardiovascular diseases, neurodegenerative disorders, inflammatory diseases, skin diseases, different cancer types). The prominent feature of the kallikrein family is that it consists of tandemly and uninterruptedly arrayed genes on a single locus at human chromosome 19q This unique feature was used in order to identify novel KLKs and KLK-like genes/proteins. Previous studies on the evolution of kallikreins were restricted to mammals and the emergence of the kallikrein genes was suggested approximately 150 million years ago. In the present study, homologous novel kallikrein protein sequences were detected in silico in the genomes of various species. For the first time, novel KLK orthologues were identified in reptiles, aves and amphibia, which allowed us to trace the evolutionary origin of kallikreins 330 million years ago. In addition, apart from the 15 already known KLK genes (KLK1-15), three novel members were identified (orphan Klks). All the defining structural features which are related to the catalytic activity of KLKs were found to be conserved in the novel KLK protein sequences. Of particular interest, the synteny of the KLK-encoding genes was analyzed and it was shown that these genes are co-localized in contiguous, uninterrupted clusters maintaining the same orientation in all species under investigation. We suggest that a series of gene duplication and mutation events gave rise to the family of KLK enzymes and KLKs have co-evolved with their specific substrates (Pavlopoulou et al., 2010).

136 135 ΒΗΒΛΗΟΓΡΑΦΗΚΔ ΑΝΑΦΟΡΔ

137 136 ΒΗΒΛΗΟΓΡΑΦΗΚΔ ΑΝΑΦΟΡΔ Al-Hashimi N, Sire JY, Delgado S. (2009) Evolutionary analysis of mammalian enamelin, the largest enamel protein, supports a crucial role for the 32-kDa peptide and reveals selective adaptation in rodents and primates. J Mol Evol 69: Alfano JR, Collmer A. (1996) Bacterial Pathogens in Plants: Life up against the Wall. Plant Cell 8: Altschul SF, Gish W, Miller W, Myers EW, Lipman DJ. (1990) Basic local alignment search tool. J Mol Biol 215: Altschul SF, Madden TL, Schaffer AA, Zhang J, Zhang Z, Miller W, Lipman DJ. (1997) Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucleic Acids Res 25: Aminetzach YT, Srouji JR, Kong CY, Hoekstra HE. (2009) Convergent evolution of novel protein function in shrew and lizard venom. Curr Biol 19: Andreeva A, Howorth D, Brenner SE, Hubbard TJ, Chothia C, Murzin AG. (2004) SCOP database in 2004: refinements integrate structure and sequence family data. Nucleic Acids Res 32: D Antequera F, Bird A. (1999) CpG islands as genomic footprints of promoters that are associated with replication origins. Curr Biol 9: R Attwood TK. (2000) The role of pattern databases in sequence analysis. Brief Bioinform 1: Attwood TK, Bradley P, Flower DR, Gaulton A, Maudling N, Mitchell AL, Moulton G, Nordle A, Paine K, Taylor P, Uddin A, Zygouri C. (2003) PRINTS and its automatic supplement, preprints. Nucleic Acids Res 31: Babinger P, Volkl R, Cakstina I, Maftei A, Schmitt R. (2007) Maintenance DNA methyltransferase (Met1) and silencing of CpG-methylated foreign DNA in Volvox carteri. Plant Mol Biol 63:

138 137 Bairoch A, Apweiler R. (2000) The SWISS-PROT protein sequence database and its supplement TrEMBL in Nucleic Acids Res 28: Bairoch A, Apweiler R, Wu CH, Barker WC, Boeckmann B, Ferro S, Gasteiger E, Huang H, Lopez R, Magrane M, Martin MJ, Natale DA, O'Donovan C, Redaschi N, Yeh LS. (2005) Alpha Science International, LtdThe Universal Protein Resource (UniProt). Nucleic Acids Res 33: D Bartee L, Malagnac F, Bender J. (2001) Arabidopsis cmt3 chromomethylase mutations block non-cg methylation and silencing of an endogenous gene. Genes Dev 15: Barton GJ. (1990) Protein multiple sequence alignment and flexible pattern matching. Methods Enzymol 183: Barton GJ. (1993) ALSCRIPT: a tool to format multiple sequence alignments. Protein Eng 6: Barton GJ, Sternberg MJ. (1987) Evaluation and improvements in the automatic alignment of protein sequences. Protein Eng 1: Benson DA, Karsch-Mizrachi I, Lipman DJ, Ostell J, Sayers EW. (2009) GenBank. Nucleic Acids Res 37: D Bergsten J. (2005) A review of long-branch attraction. Cladistics 21: Berman HM, Westbrook J, Feng Z, Gilliland G, Bhat TN, Weissig H, Shindyalov IN, Bourne PE. (2000) The Protein Data Bank. Nucleic Acids Res 28: Bernacchia G, Primo A, Giorgetti L, Pitto L, Cella R. (1998) Carrot DNAmethyltransferase is encoded by two classes of genes with differing patterns of expression. Plant J 13: Bonnart C, Deraison C, Lacroix M, Uchida Y, Besson C, Robin A, Briot A, Gonthier M, Lamant L, Dubus P, Monsarrat B, Hovnanian A. (2010) Elastase 2 is expressed in human and mouse epidermis and impairs skin barrier function in Netherton syndrome through filaggrin and lipid misprocessing. J Clin Invest 120:

139 138 Borgoño CA, Diamandis EP. (2004) The emerging roles of human tissue kallikreins in cancer. Nat Rev Cancer 4: Borgoño CA, Michael IP, Diamandis EP. (2004) Human tissue kallikreins: physiologic roles and applications in cancer. Mol Cancer Res 2: Borgoño CA, Michael IP, Komatsu N, Jayakumar A, Kapadia R, Clayman GL, Sotiropoulou G, Diamandis EP. (2007) A potential role for multiple tissue kallikrein serine proteases in epidermal desquamation. J Biol Chem 282: Brachat A, Liebundguth N, Rebischung C, Lemire S, Scharer F, Hoepfner D, Demchyshyn V, Howald I, Dusterhoft A, Mostl D, Pohlmann R, Kotter P, Hall MN, Wach A, Philippsen P. (2000) Analysis of deletion phenotypes and GFP fusions of 21 novel Saccharomyces cerevisiae open reading frames. Yeast 16: Brattsand M, Stefansson K, Lundh C, Haasum Y, Egelrud T. (2005) A proteolytic cascade of kallikreins in the stratum corneum. J Invest Dermatol 124: Bujnicki JM, Feder M, Ayres CL, Redman KL. (2004) Sequence-structure-function studies of trna:m5c methyltransferase Trm4p and its relationship to DNA:m5C and RNA:m5U methyltransferases. Nucleic Acids Res 32: Buryanov YI, Shevchuk TV. (2005) DNA methyltransferases and structural-functional specificity of eukaryotic DNA modification. Biochemistry (Mosc) 70: Callebaut I, Courvalin JC, Mornon JP. (1999) The BAH (bromo-adjacent homology) domain: a link between DNA methylation, replication and transcriptional regulation. FEBS Lett 446: Cao X, Aufsatz W, Zilberman D, Mette MF, Huang MS, Matzke M, Jacobsen SE. (2003) Role of the DRM and CMT3 methyltransferases in RNA-directed DNA methylation. Curr Biol 13: Cao X, Jacobsen SE. (2002a) Locus-specific control of asymmetric and CpNpG methylation by the DRM and CMT3 methyltransferase genes. Proc Natl Acad Sci U S A 99 Suppl 4:

140 139 Cao X, Jacobsen SE. (2002b) Role of the arabidopsis DRM methyltransferases in de novo DNA methylation and gene silencing. Curr Biol 12: Cao X, Springer NM, Muszynski MG, Phillips RL, Kaeppler S, Jacobsen SE. (2000) Conserved plant genes with similarity to mammalian de novo DNA methyltransferases. Proc Natl Acad Sci U S A 97: Carvalho AL, Sanz L, Barettino D, Romero A, Calvete JJ, Romao MJ. (2002) Crystal structure of a prostate kallikrein isolated from stallion seminal plasma: a homologue of human PSA. J Mol Biol 322: Caubet C, Jonca N, Brattsand M, Guerrin M, Bernard D, Schmidt R, Egelrud T, Simon M, Serre G. (2004) Degradation of corneodesmosome proteins by two serine proteases of the kallikrein family, SCTE/KLK5/hK5 and SCCE/KLK7/hK7. J Invest Dermatol 122: Chapdelaine P, Gauthier E, Ho-Kim MA, Bissonnette L, Tremblay RR, Dube JY. (1991) Characterization and expression of the prostatic arginine esterase gene, a canine glandular kallikrein. DNA Cell Biol 10: Chen T, Li E. (2004) Structure and function of eukaryotic DNA methyltransferases. Curr Top Dev Biol 60: Cheng H, Sen TZ, Kloczkowski A, Margaritis D, Jernigan RL. (2005a) Prediction of protein secondary structure by mining structural fragment database. Polymer (Guildf) 46: Cheng J, Randall AZ, Sweredoski MJ, Baldi P. (2005b) SCRATCH: a protein structure and structural feature prediction server. Nucleic Acids Res 33: W Cheng X, Kumar S, Posfai J, Pflugrath JW, Roberts RJ. (1993) Crystal structure of the HhaI DNA methyltransferase complexed with S-adenosyl-L-methionine. Cell 74: Clark NL, Swanson WJ. (2005) Pervasive adaptive evolution in primate seminal proteins. PLoS Genet 1: e35.

141 140 Cole C, Barber JD, Barton GJ. (2008) The Jpred 3 secondary structure prediction server. Nucleic Acids Res 36: W Crooks GE, Hon G, Chandonia JM, Brenner SE. (2004) WebLogo: a sequence logo generator. Genome Res 14: Dayhoff MO, Schwartz RM, Orcutt BC. (1978) A model of evolutionary change in proteins. In MO Dayhoff, Atlas of Protein Sequence and Structure vol. 5, suppl. 3. Washington, DC: National Biomedical Research Foundation, pp de Beus E, Brockenbrough JS, Hong B, Aris JP. (1994) Yeast NOP2 encodes an essential nucleolar protein with homology to a human proliferation marker. J Cell Biol 127: de Castro E, Sigrist CJ, Gattiker A, Bulliard V, Langendijk-Genevaux PS, Gasteiger E, Bairoch A, Hulo N. (2006) ScanProsite: detection of PROSITE signature matches and ProRule-associated functional and structural residues in proteins. Nucleic Acids Res 34: W Debela M, Hess P, Magdolen V, Schechter NM, Steiner T, Huber R, Bode W, Goettig P. (2007) Chymotryptic specificity determinants in the 1.0 A structure of the zinc-inhibited human tissue kallikrein 7. Proc Natl Acad Sci U S A 104: Descargues P, Deraison C, Bonnart C, Kreft M, Kishibe M, Ishida-Yamamoto A, Elias P, Barrandon Y, Zambruno G, Sonnenberg A, Hovnanian A. (2005) Spink5- deficient mice mimic Netherton syndrome through degradation of desmoglein 1 by epidermal protease hyperactivity. Nat Genet 37: Doolittle RF. (1981) Similar amino acid sequences: chance or common ancestry? Science 214: Eddy SR. (1998) Profile hidden Markov models. Bioinformatics 14: Edgar RC. (2004) MUSCLE: multiple sequence alignment with high accuracy and high throughput. Nucleic Acids Res 32:

142 141 Egelrud T, Brattsand M, Kreutzmann P, Walden M, Vitzithum K, Marx UC, Forssmann WG, Magert HJ. (2005) hk5 and hk7, two serine proteinases abundant in human skin, are inhibited by LEKTI domain 6. Br J Dermatol 153: Eissenberg JC. (2001) Molecular biology of the chromo domain: an ancient chromatin module comes of age. Gene 275: Elliott MB, Irwin DM, Diamandis EP. (2006) In silico identification and Bayesian phylogenetic analysis of multiple new mammalian kallikrein gene families. Genomics 88: Fanjul-Fernandez M, Folgueras AR, Cabrera S, López-Otín C. (2010) Matrix metalloproteinases: evolution, gene regulation and functional analysis in mouse models. Biochim Biophys Acta 1803: Farris JS. (1972) Estimating Phylogenetic Trees from Distance Matrices Am Nat 106: Felsenstein J. (1981) Evolutionary trees from DNA sequences: a maximum likelihood approach. J Mol Evol 17: Felsenstein J. (1985) Confidence limits on phylogenies: an approach using the bootstrap. Evolution 39: Felsenstein J. (2004) Inferring phylogenies. Sunderland, MA: Sinauer Associates. Feng DF, Doolittle RF. (1987) Progressive sequence alignment as a prerequisite to correct phylogenetic trees. J Mol Evol 25: Fernando SC, Najar FZ, Guo X, Zhou L, Fu Y, Geisert RD, Roe BA, DeSilva U. (2007) Porcine kallikrein gene family: genomic structure, mapping, and differential expression analysis. Genomics 89: Finn RD, Tate J, Mistry J, Coggill PC, Sammut SJ, Hotz HR, Ceric G, Forslund K, Eddy SR, Sonnhammer EL, Bateman A. (2008) The Pfam protein families database. Nucleic Acids Res 36: D

143 142 Finnegan EJ, Dennis ES. (1993) Isolation and identification by sequence homology of a putative cytosine methyltransferase from Arabidopsis thaliana. Nucleic Acids Res 21: Finnegan EJ, Genger RK, Peacock WJ, Dennis ES. (1998) DNA Methylation in Plants. Annu Rev Plant Physiol Plant Mol Biol 49: Finnegan EJ, Kovac KA. (2000) Plant DNA methyltransferases. Plant Mol Biol 43: Forsgren M, Raden B, Israelsson M, Larsson K, Heden LO. (1987) Molecular cloning and characterization of a full-length cdna clone for human plasminogen. FEBS Lett 213: Foster PG, Nunes CR, Greene P, Moustakas D, Stroud RM. (2003) The first structure of an RNA m5c methyltransferase, Fmu, provides insight into catalytic mechanism and specific binding of RNA substrate. Structure 11: Frye M, Watt FM. (2006) The RNA methyltransferase Misu (NSun2) mediates Mycinduced proliferation and is upregulated in tumors. Curr Biol 16: Fujimori H, Levison PR, Schachter M. (1986) Purification and partial characterization of cat pancreatic and urinary kallikreins--comparison with other cat tissue kallikreins and related proteases. Adv Exp Med Biol 198 Pt A: Fujimoto R, Sasaki T, Nishio T. (2006) Characterization of DNA methyltransferase genes in Brassica rapa. Genes Genet Syst 81: Gautham N. (2006) Bioinformatics: Databases and Algorithms: Alpha Science International, Ltd. Genger RK, Kovac KA, Dennis ES, Peacock WJ, Finnegan EJ. (1999) Multiple DNA methyltransferase genes in Arabidopsis thaliana. Plant Mol Biol 41: Giannino D, Mele G, Cozza R, Bruno L, Testone G, Ticconi C, Frugis G, Bitonti MB, Innocenti AM, Mariotti D. (2003) Isolation and characterization of a maintenance DNA-methyltransferase gene from peach (Prunus persica [L.] Batsch): transcript

144 143 localization in vegetative and reproductive meristems of triple buds. J Exp Bot 54: Giovanni-De-Simone S, Aguiar AS, Gimenez AR, Novellino K, de Moura RS. (1997) Purification, properties, and N-terminal amino acid sequence of a kallikrein-like enzyme from the venom of Lachesis muta rhombeata (Bushmaster). J Protein Chem 16: Goll MG, Bestor TH. (2005) Eukaryotic cytosine methyltransferases. Annu Rev Biochem 74: Goll MG, Kirpekar F, Maggert KA, Yoder JA, Hsieh CL, Zhang X, Golic KG, Jacobsen SE, Bestor TH. (2006) Methylation of trnaasp by the DNA methyltransferase homolog Dnmt2. Science 311: Gomis-Ruth FX, Bayés A, Sotiropoulou G, Pampalakis G, Tsetsenis T, Villegas V, Avilés FX, Coll M. (2002) The structure of human prokallikrein 6 reveals a novel activation mechanism for the kallikrein family. J Biol Chem 277: Graur D, Li W-H. (1999) Fundamentals of Molecular Evolution. Sunderland, Massachusetts.: Sinauer Associates. Gribskov M, McLachlan AD, Eisenberg D. (1987) Profile analysis: detection of distantly related proteins. Proc Natl Acad Sci U S A 84: Gruenbaum Y, Naveh-Many T, Cedar H, Razin A. (1981) Sequence specificity of methylation in higher plant DNA. Nature 292: Gu XR, Gustafsson C, Ku J, Yu M, Santi DV. (1999) Identification of the 16S rrna m5c967 methyltransferase from Escherichia coli. Biochemistry 38: Guindon S, Lethiec F, Duroux P, Gascuel O. (2005) PHYML Online--a web server for fast maximum likelihood-based phylogenetic inference. Nucleic Acids Res 33: W Hall BG. (2000) Phylogenetic trees made easy: a how-to manual for molecular biologists. Sunderland, MA: Sinauer Associates.

145 144 Hallstrom BM, Kullberg M, Nilsson MA, Janke A. (2007) Phylogenomic data analyses provide evidence that Xenarthra and Afrotheria are sister groups. Mol Biol Evol 24: Hart PS, Hart TC, Michalec MD, Ryu OH, Simmons D, Hong S, Wright JT. (2004) Mutation in kallikrein 4 causes autosomal recessive hypomaturation amelogenesis imperfecta. J Med Genet 41: Hasegawa M, Fujiwara M. (1993) Relative efficiencies of the maximum likelihood, maximum parsimony, and neighbor-joining methods for estimating protein phylogeny. Mol Phylogenet Evol 2: 1-5. Hashimoto T, Nakamura Y, Nakamura F, Shirakura T, Adachi J, Goto N, Okamoto K, Hasegawa M. (1994) Protein phylogeny gives a robust estimation for early divergences of eukaryotes: phylogenetic place of a mitochondria-lacking protozoan, Giardia lamblia. Mol Biol Evol 11: Henikoff S, Comai L. (1998) A DNA methyltransferase homolog with a chromodomain exists in multiple polymorphic forms in Arabidopsis. Genetics 149: Henikoff S, Henikoff JG. (1992) Amino acid substitution matrices from protein blocks. Proc Natl Acad Sci U S A 89: Henikoff S, Henikoff JG. (1997) Embedding strategies for effective use of information from multiple sequence alignments. Protein Sci 6: Hermann A, Gowher H, Jeltsch A. (2004) Biochemistry and biology of mammalian DNA methyltransferases. Cell Mol Life Sci 61: Hicks GR, Raikhel NV. (1993) Specific binding of nuclear localization sequences to plant nuclei. Plant Cell 5: Hillis DM, Bull JJ. (1993) An empirical test of bootstrapping as a method for assessing confidence in phylogenetic analysis. Syst Biol 42: Hillis DM, Dixon MT. (1991) Ribosomal DNA: molecular evolution and phylogenetic inference. Q Rev Biol 66:

146 145 Hillis DM, Huelsenbeck JP, Cunningham CW. (1994) Application and accuracy of molecular phylogenies. Science 264: Hofmann K. (2000) Sensitive protein comparisons with profiles and hidden Markov models. Brief Bioinform 1: Holland TA, Veretnik S, Shindyalov IN, Bourne PE. (2006) Partitioning protein structures into domains: why is it so difficult? J Mol Biol 361: Hong B, Brockenbrough JS, Wu P, Aris JP. (1997) Nop2p is required for pre-rrna processing and 60S ribosome subunit synthesis in yeast. Mol Cell Biol 17: Hubbard TJ, Aken BL, Ayling S, Ballester B, Beal K, Bragin E, Brent S, Chen Y, Clapham P, Clarke L, Coates G, Fairley S, Fitzgerald S, Fernandez-Banet J, Gordon L, Graf S, Haider S, Hammond M, Holland R, Howe K, Jenkinson A, Johnson N, Kahari A, Keefe D, Keenan S, Kinsella R, Kokocinski F, Kulesha E, Lawson D, Longden I, Megy K, Meidl P, Overduin B, Parker A, Pritchard B, Rios D, Schuster M, Slater G, Smedley D, Spooner W, Spudich G, Trevanion S, Vilella A, Vogel J, White S, Wilder S, Zadissa A, Birney E, Cunningham F, Curwen V, Durbin R, Fernandez-Suarez XM, Herrero J, Kasprzyk A, Proctor G, Smith J, Searle S, Flicek P. (2009) Ensembl Nucleic Acids Res 37: D Huelsenbeck JP. (1995) Performance of phylogenetic methods in simulation. Syst Biol 44: Huelsenbeck JP, Crandall KA. (1997) Phylogeny estimation and hypothesis testing using maximum likelihood. Annu Rev Ecol Syst 28: Hulo N, Bairoch A, Bulliard V, Cerutti L, Cuche BA, de Castro E, Lachaize C, Langendijk-Genevaux PS, Sigrist CJ. (2008) The 20 years of PROSITE. Nucleic Acids Res 36: D Huson DH, Richter DC, Rausch C, Dezulian T, Franz M, Rupp R. (2007) Dendroscope: An interactive viewer for large phylogenetic trees. BMC Bioinformatics 8: 460. Jeltsch A. (2006) Molecular enzymology of mammalian DNA methyltransferases. Curr Top Microbiol Immunol 301:

147 146 Jeltsch A, Nellen W, Lyko F. (2006) Two substrates are better than one: dual specificities for Dnmt2 methyltransferases. Trends Biochem Sci 31: Jensen-Seaman MI, Li WH. (2003) Evolution of the hominoid semenogelin genes, the major proteins of ejaculated semen. J Mol Evol 57: Jones DT, Taylor WR, Thornton JM. (1992) The rapid generation of mutation data matrices from protein sequences. Comput Appl Biosci 8: Kankel MW, Ramsey DE, Stokes TL, Flowers SK, Haag JR, Jeddeloh JA, Riddle NC, Verbsky ML, Richards EJ. (2003) Arabidopsis MET1 cytosine methyltransferase mutants. Genetics 163: Karr JF, Kantor JA, Hand PH, Eggensperger DL, Schlom J. (1995) The presence of prostate-specific antigen-related genes in primates and the expression of recombinant human prostate-specific antigen in a transfected murine cell line. Cancer Res 55: Kidwell MG, Lisch DR. (2001) Perspective: transposable elements, parasitic DNA, and genome evolution. Evolution 55: Kim WS, Nakayama K, Nakagawa T, Kawamura Y, Haraguchi K, Murakami K. (1991) Mouse submandibular gland prorenin-converting enzyme is a member of glandular kallikrein family. J Biol Chem 266: King MY, Redman KL. (2002) RNA methyltransferases utilize two cysteine residues in the formation of 5-methylcytosine. Biochemistry 41: Kita M, Nakamura Y, Okumura Y, Ohdachi SD, Oba Y, Yoshikuni M, Kido H, Uemura D. (2004) Blarina toxin, a mammalian lethal venom from the short-tailed shrew Blarina brevicauda: Isolation and characterization. Proc Natl Acad Sci U S A 101: Knudsen B, Miyamoto MM. (2001) A likelihood ratio test for evolutionary rate shifts and functional divergence among proteins. Proc Natl Acad Sci U S A 98: Komatsu N, Takata M, Otsuki N, Ohka R, Amano O, Takehara K, Saijoh K. (2002) Elevated stratum corneum hydrolytic activity in Netherton syndrome suggests an

148 147 inhibitory regulation of desquamation by SPINK5-derived peptides. J Invest Dermatol 118: Koonin EV. (1994) Prediction of an rrna methyltransferase domain in human tumorspecific nucleolar protein P120. Nucleic Acids Res 22: Kulikova T, Akhtar R, Aldebert P, Althorpe N, Andersson M, Baldwin A, Bates K, Bhattacharyya S, Bower L, Browne P, Castro M, Cochrane G, Duggan K, Eberhardt R, Faruque N, Hoad G, Kanz C, Lee C, Leinonen R, Lin Q, Lombard V, Lopez R, Lorenc D, McWilliam H, Mukherjee G, Nardone F, Pastor MP, Plaister S, Sobhany S, Stoehr P, Vaughan R, Wu D, Zhu W, Apweiler R. (2007) EMBL Nucleotide Sequence Database in Nucleic Acids Res 35: D Kumar S, Cheng X, Klimasauskas S, Mi S, Posfai J, Roberts RJ, Wilson GG. (1994) The DNA (cytosine-5) methyltransferases. Nucleic Acids Res 22: Kumar S, Nei M, Dudley J, Tamura K. (2008) MEGA: a biologist-centric software for evolutionary analysis of DNA and protein sequences. Brief Bioinform 9: Landau M, Mayrose I, Rosenberg Y, Glaser F, Martz E, Pupko T, Ben-Tal N. (2005) ConSurf 2005: the projection of evolutionary conservation scores of residues on protein structures. Nucleic Acids Res 33: W Lawrence MG, Lai J, Clements JA. (2010) Kallikreins on Steroids: Structure, Function, and Hormonal Regulation of Prostate-Specific Antigen and the Extended Kallikrein Locus. Endocr Rev 31: Laxmikanthan G, Blaber SI, Bernett MJ, Scarisbrick IA, Juliano MA, Blaber M. (2005) 1.70 Å X-ray structure of human apo kallikrein 1: structural changes upon peptide inhibitor/substrate binding. Proteins 58: Le SQ, Gascuel O. (2008) An improved general amino acid replacement matrix. Mol Biol Evol 25: Letunic I, Doerks T, Bork P. (2009) SMART 6: recent updates and new developments. Nucleic Acids Res 37: D

149 148 Lilja H, Ulmert D, Vickers AJ. (2008) Prostate-specific antigen and prostate cancer: prediction, detection and monitoring. Nat Rev Cancer 8: Lindroth AM, Cao X, Jackson JP, Zilberman D, McCallum CM, Henikoff S, Jacobsen SE. (2001) Requirement of CHROMOMETHYLASE3 for maintenance of CpXpG methylation. Science 292: Lio P, Goldman N. (1998) Models of molecular evolution and phylogeny. Genome Res 8: Liu Y, Santi DV. (2000) m5c RNA and m5c DNA methyl transferases use different cysteine residues as catalysts. Proc Natl Acad Sci U S A 97: Livingstone CD, Barton GJ. (1993) Protein sequence alignments: a strategy for the hierarchical analysis of residue conservation. Bioinformatics 9: Lovgren J, Rajakoski K, Karp M, Lundwall a, Lilja H. (1997) Activation of the zymogen form of prostate-specific antigen by human glandular kallikrein 2. Biochem Biophys Res Commun 238: Lundwall A, Band V, Blaber M, Clements JA, Courty Y, Diamandis EP, Fritz H, Lilja H, Malm J, Maltais LJ, Olsson AY, Petraki C, Scorilas A, Sotiropoulou G, Stenman UH, Stephan C, Talieri M, Yousef GM. (2006) A comprehensive nomenclature for serine proteases with homology to tissue kallikreins. Biol Chem 387: Lundwall A, Brattsand M. (2008) Kallikrein-related peptidases. Cell Mol Life Sci 65: Mailund T, Brodal GS, Fagerberg R, Pedersen CN, Phillips D. (2006) Recrafting the neighbor-joining method. BMC Bioinformatics 7: 29. Marchler-Bauer A, Anderson JB, Chitsaz F, Derbyshire MK, DeWeese-Scott C, Fong JH, Geer LY, Geer RC, Gonzales NR, Gwadz M, He S, Hurwitz DI, Jackson JD, Ke Z, Lanczycki CJ, Liebert CA, Liu C, Lu F, Lu S, Marchler GH, Mullokandov M, Song JS, Tasneem A, Thanki N, Yamashita RA, Zhang D, Zhang N, Bryant SH. (2009) CDD: specific functional annotation with the Conserved Domain Database. Nucleic Acids Res 37: D

150 149 Marchler-Bauer A, Bryant SH. (2004) CD-Search: protein domain annotations on the fly. Nucleic Acids Res 32: W Markowitz VM, Szeto E, Palaniappan K, Grechkin Y, Chu K, Chen IM, Dubchak I, Anderson I, Lykidis A, Mavromatis K, Ivanova NN, Kyrpides NC. (2008) The integrated microbial genomes (IMG) system in 2007: data content and analysis tool extensions. Nucleic Acids Res 36: D Martinez Gimenez JA, Saez GT, Seisdedos RT. (1998) On the function of modified nucleosides in the RNA world. J Theor Biol 194: Matzke MA, Birchler JA. (2005) RNAi-mediated pathways in the nucleus. Nat Rev Genet 6: McGuffin LJ, Bryson K, Jones DT. (2000) The PSIPRED protein structure prediction server. Bioinformatics 16: Mitchell AL, Reich JR, Attwood TK. (2003) PRECIS: protein reports engineered from concise information in SWISS-PROT. Bioinformatics 19: Moore W. (1995) Inferring Phylogenies from mtdna Variation: Mitochondrial-Gene Trees Versus Nuclear Gene Trees. Evolution 49: Motorin Y, Grosjean H. (1999) Multisite-specific trna:m5c-methyltransferase (Trm4) in yeast Saccharomyces cerevisiae: identification of the gene and substrate specificity of the enzyme. RNA 5: Mueller TD, Feigon J. (2002) Solution structures of UBA domains reveal a conserved hydrophobic surface for protein-protein interactions. J Mol Biol 319: Mulder NJ, Apweiler R. (2002) Tools and resources for identifying protein families, domains and motifs. Genome Biol 3: REVIEWS2001. Nakano Y, Steward N, Sekine M, Kusano T, Sano H. (2000) A tobacco NtMET1 cdna encoding a DNA methyltransferase: molecular characterization and abnormal phenotypes of transgenic tobacco plants. Plant Cell Physiol 41: Nei M, Kumar S. (2000) Molecular Evolution and Phylogenetics. Oxford: Oxford University Press.

151 150 Nikolaev S, Montoya-Burgos JI, Margulies EH, Rougemont J, Nyffeler B, Antonarakis SE. (2007) Early history of mammals is elucidated with the ENCODE multiple species sequencing data. PLoS Genet 3: e2. Nishiyama R, Ito M, Yamaguchi Y, Koizumi N, Sano H. (2002) A chloroplast-resident DNA methyltransferase is responsible for hypermethylation of chloroplast genes in Chlamydomonas maternal gametes. Proc Natl Acad Sci U S A 99: Noyer-Weidner M, Trautner TA. (1993) Methylation of DNA in prokaryotes. EXS 64: Olsson AY, Lilja H, Lundwall A. (2004) Taxon-specific evolution of glandular kallikrein genes and identification of a progenitor of prostate-specific antigen. Genomics 84: Olsson AY, Lundwall A. (2002) Organization and evolution of the glandular kallikrein locus in Mus musculus. Biochem Biophys Res Commun 299: Page RDM, Holmes EC. (1998) Molecular Evolution: a phylogenetic approach. Oxford: Blackwell Publishing. Pampalakis G, Sotiropoulou G. (2007) Tissue kallikrein proteolytic cascade pathways in normal physiology and cancer. BBA Rev Cancer 1776: Papa CM, Springer NM, Muszynski MG, Meeley R, Kaeppler SM. (2001) Maize chromomethylase Zea methyltransferase2 is required for CpNpG methylation. Plant Cell 13: Pavlopoulou A, Kossida S. (2007) Plant cytosine-5 DNA methyltransferases: structure, function, and molecular evolution. Genomics 90: Pavlopoulou A, Kossida S. (2009) Phylogenetic analysis of the eukaryotic RNA (cytosine-5)-methyltransferases. Genomics 93: Pavlopoulou A, Pampalakis G, Michalopoulos I, Sotiropoulou G. (2010) Evolutionary history of tissue kallikreins. PLoS One 5: e Pearl F, Todd A, Sillitoe I, Dibley M, Redfern O, Lewis T, Bennett C, Marsden R, Grant A, Lee D, Akpor A, Maibaum M, Harrison A, Dallman T, Reeves G, Diboun I,

152 151 Addou S, Lise S, Johnston C, Sillero A, Thornton J, Orengo C. (2005) The CATH Domain Structure Database and related resources Gene3D and DHS provide comprehensive domain family information for genome analysis. Nucleic Acids Res 33: D Pei J, Kim BH, Grishin NV. (2008) PROMALS3D: a tool for multiple protein sequence and structure alignments. Nucleic Acids Res 36: Perlaky L, Busch RK, Busch H. (1996) Combinatorial effects of monoclonal anti-p120 antibody (MAbp120), liposomes and hyperthermia on MCF-7 and LOX tumor cell lines. Oncol Res 8: Perriere G, Gouy M. (1996) WWW-query: an on-line retrieval system for biological sequence banks. Biochimie 78: Pertsemlidis A, Fondon JW, 3rd. (2001) Having a BLAST with bioinformatics (and avoiding BLASTphemy). Genome Biol 2: REVIEWS2002. Pettifer S, Thorne D, McDermott P, Marsh J, Villeger A, Kell DB, Attwood TK. (2009) Visualising biological data: a semantic approach to tool and database integration. BMC Bioinformatics 10 Suppl 6: S19. Pietrokovski S, Henikoff JG, Henikoff S. (1996) The Blocks database--a system for protein classification. Nucleic Acids Res 24: Pollastri G, McLysaght A. (2005) Porter: a new, accurate server for protein secondary structure prediction. Bioinformatics 21: Ponting CP, Russell RR. (2002) The natural history of protein domains. Annu Rev Biophys Biomol Struct 31: Posfai J, Bhagwat AS, Posfai G, Roberts RJ. (1989) Predictive motifs derived from cytosine methyltransferases. Nucleic Acids Res 17: Pradhan S, Adams RL. (1995) Distinct CG and CNG DNA methyltransferases in Pisum sativum. Plant J 7:

153 152 Pradhan S, Cummings M, Roberts RJ, Adams RL. (1998) Isolation, characterization and baculovirus-mediated expression of the cdna encoding cytosine DNA methyltransferase from Pisum sativum. Nucleic Acids Res 26: Pruitt KD, Tatusova T, Maglott DR. (2007) NCBI reference sequences (RefSeq): a curated non-redundant sequence database of genomes, transcripts and proteins. Nucleic Acids Res 35: D Puente XS, López-Otín C. (2004) A genomic analysis of rat proteases and protease inhibitors. Genome Res 14: Quesada V, Velasco G, Puente XS, Warren WC, López-Otín C. (2010) Comparative genomic analysis of the zebra finch degradome provides new insights into evolution of proteases in birds and mammals. BMC Genomics 11: 220. Radchuk VV, Sreenivasulu N, Radchuk RI, Wobus U, Weschke W. (2005) The methylation cycle and its possible functions in barley endosperm development. Plant Mol Biol 59: Reichhardt T. (1999) It's sink or swim as a tidal wave of data approaches. Nature 399: Reid R, Greene PJ, Santi DV. (1999) Exposition of a family of RNA m(5)c methyltransferases from searching genomic and proteomic sequences. Nucleic Acids Res 27: Roberts RJ, Vincze T, Posfai J, Macelis D. (2003) REBASE: restriction enzymes and methyltransferases. Nucleic Acids Res 31: Rosen BS, Cook KS, Yaglom J, Groves DL, Volanakis JE, Damm D, White T, Spiegelman BM. (1989) Adipsin and complement factor D activity: an immune-related defect in obesity. Science 244: Rozenski J, Crain PF, McCloskey JA. (1999) The RNA Modification Database: 1999 update. Nucleic Acids Res 27: Sato K, Nishi T, Takeshima H, Kochi M, Kuratsu J, Masuko N, Sugimoto Y, Yamada Y, Ushio Y. (1999) Expression of p120 nucleolar proliferating antigen in

154 153 human gliomas and growth suppression of glioma cells by p120 ribozyme vector. Int J Oncol 14: Sayle RA, Milner-White EJ. (1995) RASMOL: biomolecular graphics for all. Trends Biochem Sci 20: 374. Schmidt AE, Ogawa T, Gailani D, Bajaj SP. (2004) Structural role of Gly(193) in serine proteases: investigations of a G555E (GLY193 in chymotrypsin) mutant of blood coagulation factor XI. J Biol Chem 279: Scordis P, Flower DR, Attwood TK. (1999) FingerPRINTScan: intelligent searching of the PRINTS motif database. Bioinformatics 15: Sen TZ, Jernigan RL, Garnier J, Kloczkowski A. (2005) GOR V server for protein secondary structure prediction. Bioinformatics 21: Shaw JL, Diamandis EP. (2007) Distribution of 15 human kallikreins in tissues and biological fluids. Clin Chem 53: Sotiropoulou G, Pampalakis G, Diamandis EP. (2009) Functional roles of human kallikrein-related peptidases. J Biol Chem 284: Steward N, Kusano T, Sano H. (2000) Expression of ZmMET1, a gene encoding a DNA methyltransferase from maize, is associated not only with DNA replication in actively proliferating cells, but also with altered DNA methylation status in cold-stressed quiescent cells. Nucleic Acids Res 28: Sugawara H, Ogasawara O, Okubo K, Gojobori T, Tateno Y. (2008) DDBJ with new system and face. Nucleic Acids Res 36: D Swofford DL, Olsen GJ, Waddell PJ, Hillis DM. (1996) Phylogenetic inference. Sunderland, MA: Sinauer Associates. Szegedi SS, Gumport RI. (2000) DNA binding properties in vivo and target recognition domain sequence alignment analyses of wild-type and mutant RsrI [N6-adenine] DNA methyltransferases. Nucleic Acids Res 28:

155 154 Teerawanichpan P, Chandrasekharan MB, Jiang Y, Narangajavana J, Hall TC. (2004) Characterization of two rice DNA methyltransferase genes and RNAi-mediated reactivation of a silenced transgene in rice callus. Planta 218: Thompson JD, Higgins DG, Gibson TJ. (1994) CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, positionspecific gap penalties and weight matrix choice. Nucleic Acids Res 22: Thompson JD, Plewniak F, Poch O. (1999) BAliBASE: a benchmark alignment database for the evaluation of multiple alignment programs. Bioinformatics 15: Tian X, Pascal G, Fouchecourt S, Pontarotti P, Monget P. (2009) Gene birth, death, and divergence: the different scenarios of reproduction-related gene evolution. Biol Reprod 80: Tramontano A. (2005) The ten most wanted solutions in protein bioinformatics: Taylor & Francis Group, LLC. Tscherne JS, Nurse K, Popienick P, Michel H, Sochacki M, Ofengand J. (1999) Purification, cloning, and characterization of the 16S RNA m5c967 methyltransferase from Escherichia coli. Biochemistry 38: Valdez BC, Perlaky L, Henning D, Saijo Y, Chan PK, Busch H. (1994) Identification of the nuclear and nucleolar localization signals of the protein p120. Interaction with translocation protein B23. J Biol Chem 269: Vilkaitis G, Dong A, Weinhold E, Cheng X, Klimasauskas S. (2000) Functional roles of the conserved threonine 250 in the target recognition domain of HhaI DNA methyltransferase. J Biol Chem 275: Wada Y, Ohya H, Yamaguchi Y, Koizumi N, Sano H. (2003) Preferential de novo methylation of cytosine residues in non-cpg sequences by a domains rearranged DNA methyltransferase from tobacco plants. J Biol Chem 278: Wang L, Jiang T. (1994) On the complexity of multiple sequence alignment. J Comput Biol 1:

156 155 Warren WC, Clayton DF, Ellegren H, Arnold AP, Hillier LW, Kunstner A, Searle S, White S, Vilella AJ, Fairley S, Heger A, Kong L, Ponting CP, Jarvis ED, Mello CV, Minx P, Lovell P, Velho TA, Ferris M, Balakrishnan CN, Sinha S, Blatti C, London SE, Li Y, Lin YC, George J, Sweedler J, Southey B, Gunaratne P, Watson M, Nam K, Backstrom N, Smeds L, Nabholz B, Itoh Y, Whitney O, Pfenning AR, Howard J, Volker M, Skinner BM, Griffin DK, Ye L, McLaren WM, Flicek P, Quesada V, Velasco G, López-Otín C, Puente XS, Olender T, Lancet D, Smit AF, Hubley R, Konkel MK, Walker JA, Batzer MA, Gu W, Pollock DD, Chen L, Cheng Z, Eichler EE, Stapley J, Slate J, Ekblom R, Birkhead T, Burke T, Burt D, Scharff C, Adam I, Richard H, Sultan M, Soldatov A, Lehrach H, Edwards SV, Yang SP, Li X, Graves T, Fulton L, Nelson J, Chinwalla A, Hou S, Mardis ER, Wilson RK. (2010) The genome of a songbird. Nature 464: Warren WC, Hillier LW, Marshall Graves JA, Birney E, Ponting CP, Grutzner F, Belov K, Miller W, Clarke L, Chinwalla AT, Yang SP, Heger A, Locke DP, Miethke P, Waters PD, Veyrunes F, Fulton L, Fulton B, Graves T, Wallis J, Puente XS, López-Otín C, Ordonez GR, Eichler EE, Chen L, Cheng Z, Deakin JE, Alsop A, Thompson K, Kirby P, Papenfuss AT, Wakefield MJ, Olender T, Lancet D, Huttley GA, Smit AF, Pask A, Temple-Smith P, Batzer MA, Walker JA, Konkel MK, Harris RS, Whittington CM, Wong ES, Gemmell NJ, Buschiazzo E, Vargas Jentzsch IM, Merkel A, Schmitz J, Zemann A, Churakov G, Kriegs JO, Brosius J, Murchison EP, Sachidanandam R, Smith C, Hannon GJ, Tsend-Ayush E, McMillan D, Attenborough R, Rens W, Ferguson-Smith M, Lefevre CM, Sharp JA, Nicholas KR, Ray DA, Kube M, Reinhardt R, Pringle TH, Taylor J, Jones RC, Nixon B, Dacheux JL, Niwa H, Sekita Y, Huang X, Stark A, Kheradpour P, Kellis M, Flicek P, Chen Y, Webber C, Hardison R, Nelson J, Hallsworth-Pepin K, Delehaunty K, Markovic C, Minx P, Feng Y, Kremitzki C, Mitreva M, Glasscock J, Wylie T, Wohldmann P, Thiru P, Nhan MN, Pohl CS, Smith SM, Hou S, Nefedov M, de Jong PJ, Renfree MB, Mardis ER, Wilson RK. (2008) Genome analysis of the platypus reveals unique signatures of evolution. Nature 453: Wassenegger M, Heimes S, Riedel L, Sanger HL. (1994) RNA-directed de novo methylation of genomic sequences in plants. Cell 76:

157 156 Westhead D, Oarish JH and RM Twyman (2002) Bioinformatics: BIOS Scientific Publishers Ltd. Wheeler DL, Barrett T, Benson DA, Bryant SH, Canese K, Chetvernin V, Church DM, Dicuccio M, Edgar R, Federhen S, Feolo M, Geer LY, Helmberg W, Kapustin Y, Khovayko O, Landsman D, Lipman DJ, Madden TL, Maglott DR, Miller V, Ostell J, Pruitt KD, Schuler GD, Shumway M, Sequeira E, Sherry ST, Sirotkin K, Souvorov A, Starchenko G, Tatusov RL, Tatusova TA, Wagner L, Yaschenko E. (2008) Database resources of the National Center for Biotechnology Information. Nucleic Acids Res 36: D Wolfsberg TG. (2007) Using the NCBI Map Viewer to browse genomic sequence data. Curr Protoc Bioinformatics Chapter 1: Unit 1.5. Wu CH, Huang H, Arminski L, Castro-Alvear J, Chen Y, Hu ZZ, Ledley RS, Lewis KC, Mewes HW, Orcutt BC, Suzek BE, Tsugita A, Vinayaka CR, Yeh LS, Zhang J, Barker WC. (2002) The Protein Information Resource: an integrated public resource of functional annotation of proteins. Nucleic Acids Res 30: Wu CH, Huang H, Yeh LS, Barker WC. (2003) Protein family classification and functional annotation. Comput Biol Chem 27: Wu P, Brockenbrough JS, Paddy MR, Aris JP. (1998) NCL1, a novel gene for a nonessential nuclear protein in Saccharomyces cerevisiae. Gene 220: Yoon H, Blaber SI, Debela M, Goettig P, Scarisbrick IA, Blaber M. (2009) A completed KLK activome profile: investigation of activation profiles of KLK9, 10, and 15. Biol Chem 390: Yousef GM, Diamandis EP. (2001) The new human tissue kallikrein gene family: structure, function, and association to disease. Endocr Rev 22: Zhang P, Zhou H, Chen YQ, Liu YF, Qu LH. (2005) Mitogenomic perspectives on the origin and phylogeny of living amphibians. Syst Biol 54: Zuckerlandl E, Pauling L. (1965) Evolutionary divergence and convergence in proteins. In: Bryson V, Vogel HJ. Evolving genes and proteins. New York: Academic Press, pp

158 157 ΠΑΡΑΡΣΖΜΑΣΑ

159 158 ΠΑΡΑΡΣΖΜΑ 1. Ολόκαηα θαη αξηζκνί πξόζβαζεο ησλ αληηπξνζσπεπηηθώλ πξσηετλώλ RCMT πνπ αλαιύζεθαλ ζηελ παξνύζα κειέηε Αθνινπζία Αξηζκόο Πξόζβαζεο ΒΓ* Homo sapiens NOP2 emb CAA NCBI Homo sapiens NSUN2 ref NP_ NCBI Homo sapiens NSUN5 gb AAH NCBI Mus musculus Nop2 ref NP_ NCBI Mus musculus Nsun2 gb ABF NCBI Mus musculus Nsun5 gb AAM NCBI Gallus gallus nop2 ref XP_ NCBI Gallus gallus nsun2 ref NP_ NCBI Gallus gallus nsun5 ref XP_ NCBI Danio rerio nop2 gb AAI NCBI Danio rerio nsun2 emb Can NCBI Danio rerio nsun5 gb AAH NCBI Xenopus tropicalis nop2 jgi Xentr fgenesh1_pm.c_scaffold_ jgi Xenopus tropicalis nsun2 jgi Xentr fgenesh_pm_kg.c_scaffold_ jgi Xenopus tropicalis nsun5 jgi Xentr e_gw jgi Branchiostoma floridae nop2 jgi Brafl estext_fgenesh2_pg.c_ jgi Branchiostoma floridae nsun2 jgi Brafl estext_fgenesh2_pg.c_ jgi Branchiostoma floridae nsun5 jgi Brafl e_gw jgi Ciona intestinalis nop2 jgi Cioin gw1.03q jgi Ciona intestinalis nsun2 jgi Cioin gw1.03q jgi Caenorhabditis elegans nop2 gb AAC NCBI Caenorhabditis elegans nsun2 gb AAK NCBI Caenorhabditis elegans nsun5 ref NP_ NCBI Strongylocentrotus purpuratus nop2 ref XP_ NCBI Strongylocentrotus purpuratus nsun5 ref XP_ NCBI Nematostella vectensis nop2 jgi Nemve estext_gwp.c_ jgi Nematostella vectensis nsun2 jgi Nemve gw jgi Nematostella vectensis nsun5 jgi Nemve estext_fgenesh1_pg.c_ jgi Helobdella robusta nop2 jgi Helro jgi Helobdella robusta nsun2 jgi Helro jgi Helobdella robusta nsun5 jgi Helro jgi

160 159 Lottia gigantea nop2 jgi Lotgi estext_fgenesh2_pg.c_sca_ jgi Lottia gigantea nsun2 jgi Lotgi gw jgi Lottia gigantea nsun5 jgi Lotgi e_gw jgi Drosophila melanogaster nop2 ref NP_ NCBI Drosophila melanogaster nsun2 ref NP_ NCBI Drosophila melanogaster nsun5 ref NP_ NCBI Arabidopsis thaliana Fmu At3g TIGR Arabidopsis thaliana nop2a At5g TIGR Arabidopsis thaliana nop2b At4g TIGR Arabidopsis thaliana nsun2a At4g TIGR Arabidopsis thaliana nsun2b At2g TIGR Arabidopsis thaliana nsun5 At5g TIGR Arabidopsis thaliana RCMT9 At5g TIGR Oryza sativa Fmu Os09g TIGR Oryza sativa nop2a Os09g TIGR Oryza sativa nop2b Os02g TIGR Oryza sativa nsun2a Os09g TIGR Oryza sativa nsun2b Os08g TIGR Oryza sativa nsun5 Os02g TIGR Oryza sativa RCMT9 Os02g TIGR Zea mays nop2 AC _FGT011 Maize Zea mays RCMT9 AC _FGT023 Maize Sorghum bicolor RCMT9 jgi Sorbi gw jgi Chlamydomonas reinhardtii nop2 jgi Chlre gwh jgi Chlamydomonas reinhardtii nsun2 jgi Chlre e_gww jgi Chlamydomonas reinhardtii nsun5 jgi Chlre gwh jgi Saccharomyces cerevisiae NOP2 gb AAA NCBI Saccharomyces cerevisiae NCL1 ref NP_ NCBI Saccharomyces cerevisiae YNL022c ref NP_ NCBI Schizosaccharomyces pombe NOP2 SPBP8B7.20c Broadinstitute Schizosaccharomyces pombe NCL1 SPAC23C4.17 Broadinstitute Schizosaccharomyces pombe SPAC2C4.06c Broadinstitute YNL022c Cryptococcus neoformans NOP2 CNAG_ Broadinstitute Cryptococcus neoformans NCL1 CNAG_ Broadinstitute Cryptococcus neoformans YNL022c CNAG_ Broadinstitute Encephalitozoon cuniculi NOP2 ref XP_ NCBI Encephalitozoon cuniculi NCL1 ref NP_ NCBI Encephalitozoon cuniculi YNL022c ref NP_ NCBI Rhizopus oryzae NOP2 RO3G_15432 Broadinstitute

161 160 Rhizopus oryzae NCL1 RO3G_07093 Broadinstitute Rhizopus oryzae YNL022c RO3G_05461 Broadinstitute Cryptosporidium parvum nop2 ref XP_ NCBI Cryptosporidium parvum nsun2 ref XP_ NCBI Cryptosporidium parvum nsun5 ref XP_ NCBI Paramecium tetraurelia nop2 ref XP_ NCBI Paramecium tetraurelia nsun5 ref XP_ NCBI Paramecium tetraurelia RCMT9 emb CAK NCBI Plasmodium falciparum nop2 ref XP_ NCBI Plasmodium falciparum nsun5 ref XP_ NCBI Tetrahymena thermophila nsun2 ref XP_ NCBI Tetrahymena thermophila nsun5 ref XP_ NCBI Tetrahymena thermophila RCMT9 gb EAS NCBI Theileria parva nop2 ref XP_ NCBI Theileria parva nsun2 ref XP_ NCBI Theileria parva RCMT9 gb EAN NCBI Toxoplasma gondii nsun2 emb CAJ NCBI Monosiga brevicolis nop2 jgi Monbr estext_gwp_gw1.c_70264 jgi Monosiga brevicolis nsun5 jgi Monbr fgenesh2_pg.scaffold_ jgi Guillardia theta nop2 ref XP_ NCBI Giardia lamblia nop2 ref XP_ NCBI Giardia lamblia nsun2 ref XP_ NCBI Giardia lamblia nsun5 ref XP_ NCBI Entamoeba histolytica nop2 gb EAL NCBI Entamoeba histolytica nsun2 gb EAL NCBI Entamoeba histolytica nsun5 gb EAL NCBI Trypanosoma cruzi nop2 ref XP_ NCBI Trypanosoma cruzi nsun2 ref XP_ NCBI Trypanosoma cruzi nsun5 ref XP_ NCBI Trypanosoma cruzi RCMT9 ref XP_ NCBI Naegleria gruberi nop2 jgi Naegr estext_gwp_gw1.c_20247 jgi Naegleria gruberi nsun2 jgi Naegr estext_fgeneshng_pg.c_ jgi Naegleria gruberi nsun5 jgi Naegr estext_fgeneshng_kg.c_ jgi Dictyostelium discoideum nop2 ref XP_ NCBI Dictyostelium discoideum nsun5 ref XP_ NCBI Dictyostelium discoideum RCMT9 ref XP_ NCBI Trichomonas vaginalis nop2 gb EAX NCBI Trichomonas vaginalis nsun2 gb EAX NCBI Phytophthora sojae nop2 jgi Physo1_ estext_fgenesh1_pg.c_35012 jgi 8 Phytophthora sojae nsun2 jgi Physo1_ C_scaffold_ jgi

162 161 Phytophthora sojae nsun5 jgi Physo1_ estext_fgenesh1_pg.c_50323 jgi Thalassiosira pseudonana nop2 jgi Thaps e_gw jgi Thalassiosira pseudonana nsun2 jgi Thaps estext_gwp_gw1.c_chr_30129 jgi Thalassiosira pseudonana nsun5 jgi Thaps estext_fgenesh1_pg.c_chr_40717 jgi Cyanidioschyzon merolae nop2 gnl CMER CMT214C cmer Cyanidioschyzon merolae nsun2 gnl CMER CMG165C cmer Cyanidioschyzon merolae nsun5 gnl CMER CMQ219C cmer Escherichia coli Fmu ref NP_ NCBI Escherichia coli Yebu ref AP_ NCBI Archaeoglobus fulgidus RCMT4 ref NP_ NCBI Archaeoglobus fulgidus RCMT5 ref NP_ NCBI Escherichia coli RumA ref NP_ NCBI *Bάζεηο δεδνκέλσλ : NCBI: jgi: TIGR: Broadinstitute: cmer: maize:

163 162 ΠΑΡΑΡΣΖΜΑ 2. Ολόκαηα θαη αξηζκνί θαηαρώξεζεο ησλ πξσηετλώλ KLK πνπ αλαιύζεθαλ ζηελ παξνύζα κειέηε. Σα νλφκαηα ησλ ςεπδνγνληδίσλ KLK αλαγξάθνληαη κε πιάγηα γξαθή. Οξγαληζκόο Αθνινπζία Αξηζκόο Πξόζβαζεο ΒΓ* Homo sapiens Άλζξσπνο KLK1 P06870, NP_002248, ENSP , 2, 3 Homo sapiens Άλζξσπνο KLK2 P20151, NP_005542, ENSP , 2, 3 Homo sapiens Άλζξσπνο KLK3 P07288, NP_001639, ENSP , 2, 3 Homo sapiens Άλζξσπνο KLK4 Q9Y5K2, NP_004908, ENSP , 2, 3 Homo sapiens Άλζξσπνο KLK5 Q9Y337, NP_036559, ENSP , 2, 3 Homo sapiens Άλζξσπνο KLK6 Q92876, NP_002765, ENSP , 2, 3 Homo sapiens Άλζξσπνο KLK7 P49862, NP_005037, ENSP , 2, 3 Homo sapiens Άλζξσπνο KLK8 O60259, NP_009127, ENSP , 2, 3 Homo sapiens Άλζξσπνο KLK9 Q9UKQ9, NP_036447, ENSP , 2, 3 Homo sapiens Άλζξσπνο KLK10 O43240, NP_002767, ENSP , 2, 3 Homo sapiens Άλζξσπνο KLK11 Q9UBX7-2, NP_006844, ENSP , 2, 3 Homo sapiens Άλζξσπνο KLK12 Q9UKR0, NP_062544, ENSP , 2, 3 Homo sapiens Άλζξσπνο KLK13 Q9UKR3, NP_056411, ENSP , 2, 3 Homo sapiens Άλζξσπνο KLK14 Q9P0G3, NP_071329, ENSP ,2, 3 Homo sapiens Άλζξσπνο KLK15 Q9H2R5, NP_059979, ENSP , 2, 3 Homo sapiens Άλζξσπνο Θξπςίλε P35030, NP_002762, ENSP , 2, 3 Homo sapiens Άλζξσπνο CFD P00746, NP_001919, ENSP , 2, 3 Homo sapiens Άλζξσπνο Υπκνζξπςίλε Q99895, CAA74031, ENSP , 2, 3 Homo sapiens Άλζξσπνο PLG P00747, NP_000292, ENSP , 2, 3 Gorilla gorilla Γνξίιιαο KLK1 ENSGGOP Gorilla gorilla Γνξίιιαο KLK3 Q5U7M5; AAV51953; 1, 2, 3 ENSGGOP Gorilla gorilla Γνξίιιαο KLK4 XP_524486; ENSGGOP , 3 Gorilla gorilla Γνξίιιαο KLK5 AAP36503; ENSGGOP , 3 Gorilla gorilla Γνξίιιαο KLK6 NP_002765; ENSGGOP , 3 Gorilla gorilla Γνξίιιαο KLK7 ENSGGOP Gorilla gorilla Γνξίιιαο KLK8 Q5V9U0; ENSGGOP , 3 Gorilla gorilla Γνξίιιαο KLK9 ENSGGOP Gorilla gorilla Γνξίιιαο KLK10 ENSGGOP Gorilla gorilla Γνξίιιαο KLK11 ENSGGOP Gorilla gorilla Γνξίιιαο KLK12 ENSGGOP Gorilla gorilla Γνξίιιαο KLK13 ENSGGOP Gorilla gorilla Γνξίιιαο KLK14 ENSGGOP Gorilla gorilla Γνξίιιαο KLK15 ENSGGOP

164 163 Gorilla gorilla Γνξίιιαο Trypsin ENSGGOP Pongo pygmaeus Οπξαγθνηάγθνο KLK1 ENSPPYP Pongo pygmaeus Οπξαγθνηάγθνο KLK2 Q3I216, ENSPPYP , 3 Pongo pygmaeus Οπξαγθνηάγθνο KLK3 Q5U7M4, ENSPPYP , 3 Pongo pygmaeus Οπξαγθνηάγθνο KLK5 ENSPPYP Pongo pygmaeus Οπξαγθνηάγθνο KLK6 ENSPPYP Pongo pygmaeus Οπξαγθνηάγθνο KLK7 ENSPPYP Pongo pygmaeus Οπξαγθνηάγθνο KLK8 ENSPPYP Pongo pygmaeus Οπξαγθνηάγθνο KLK9 ENSPPYP Pongo pygmaeus Οπξαγθνηάγθνο KLK10 ENSPPYP Pongo pygmaeus Οπξαγθνηάγθνο KLK12 ENSPPYP Pongo pygmaeus Οπξαγθνηάγθνο KLK13 ENSPPYP Pongo pygmaeus Οπξαγθνηάγθνο KLK14 ENSPPYP Pongo pygmaeus Οπξαγθνηάγθνο KLK15 ENSPPYP Pongo pygmaeus Οπξαγθνηάγθνο Θξπςίλε ENSPPYP Macaca mulatta Πίζεθνο KLK1 ENSMMUP Macaca mulatta Πίζεθνο KLK2 Q3I215, AAZ82223, 1, 2, 3 ENSMMUP Macaca mulatta Πίζεθνο KLK3 P33619, CAA51957, 1, 2, 3 ENSMMUP Macaca mulatta Πίζεθνο KLK4 XP_ , ENSMMUP , 3 Macaca mulatta Πίζεθνο KLK5 XP_ , ENSMMUP , 3 Macaca mulatta Πίζεθνο LK6 XP_ , ENSMMUP , 3 Macaca mulatta Πίζεθνο ΚLK7 XP_ , ENSMMUP , 3 Macaca mulatta Πίζεθνο KLK8 A6YBE7, ABQ81883, 1, 2, 3 ENSMMUP Macaca mulatta Πίζεθνο KLK9 ENSMMUP Macaca mulatta Πίζεθνο KLK10 XP_ , ENSMMUP , 3 Macaca mulatta Πίζεθνο KLK12 XP_ , ENSMMUP , 3 Macaca mulatta Πίζεθνο KLK13 ENSMMUP Macaca mulatta Πίζεθνο KLK14 ENSMMUP Macaca mulatta Πίζεθνο KLK15 XP_ , ENSMMUP , 3 Macaca mulatta Πίζεθνο Θξπςίλε Q5H728; AC149201, 1, 2, 3 ENSMMUP Callithrix jacchus Καιιίζξημ KLK1 ENSCJAP Callithrix jacchus Καιιίζξημ KLK2 ENSCJAP Callithrix jacchus Καιιίζξημ KLK4 ENSCJAP Callithrix jacchus Καιιίζξημ KLK6 ENSCJAP Callithrix jacchus Καιιίζξημ KLK7 ENSCJAP Callithrix jacchus Καιιίζξημ KLK8 ENSCJAP Callithrix jacchus Καιιίζξημ KLK9 ENSCJAP

165 164 Callithrix jacchus Καιιίζξημ KLK10 ENSCJAP Callithrix jacchus Καιιίζξημ KLK11 ENSCJAP Callithrix jacchus Καιιίζξημ KLK12 ENSCJAP Callithrix jacchus Καιιίζξημ KLK13 ENSCJAP Callithrix jacchus Καιιίζξημ KLK14 ENSCJAP Callithrix jacchus Καιιίζξημ KLK15 ENSCJAP Callithrix jacchus Καιιίζξημ Θξπςίλε ENSCJAP Microcebus murinus Λεκνχξηνο KLK2 ENSMICP Microcebus murinus Λεκνχξηνο KLK4 ENSMICP Microcebus murinus Λεκνχξηνο KLK5 ENSMICP Microcebus murinus Λεκνχξηνο KLK8 ENSMICP Microcebus murinus Λεκνχξηνο KLK10 ENSMICP Microcebus murinus Λεκνχξηνο KLK11 ENSMICP Microcebus murinus Λεκνχξηνο KLK12 ENSMICP Microcebus murinus Λεκνχξηνο KLK13 ENSMICP Microcebus murinus Λεκνχξηνο KLK15 ENSMICP Microcebus murinus Λεκνχξηνο Θξπςίλε ENSMICP Bos taurus Βννεηδέο KLK1 Q6H320, NP_ , 1, 2, 3 ENSBTAP Bos taurus Βννεηδέο KLK4 XP_584478, ENSBTAP , 3 Bos taurus Βννεηδέο KLK5 XP_875061, ENSBTAP , 3 Bos taurus Βννεηδέο KLK6 A6QQ95, NP_ , 1, 2, 3 ENSBTAP Bos taurus Βννεηδέο KLK7 Q08D90, NP_ , 1, 2, 3 ENSBTAP Bos taurus Βννεηδέο KLK8 XP_875861, ENSBTAP , 3 Bos taurus Βννεηδέο KLK9 XP_609272, ENSBTAP , 3 Bos taurus Βννεηδέο KLK10 Q0VCZ4, NP_ , 1, 2, 3 ENSBTAP Bos taurus Βννεηδέο KLK11 XP_605111, ENSBTAP , 3 Bos taurus Βννεηδέο KLK12 XP_875874, ENSBTAP , 3 Bos taurus Βννεηδέο KLK13 XP_593029, ENSBTAP , 3 Bos taurus Βννεηδέο KLK14 XP_870367, ENSBTAP , 3 Bos taurus Βννεηδέο KLK15 XP_ , ENSBTAP , 3 Bos taurus Βννεηδέο Θξπςίλε Q547S4, NP_777115, 1, 2, 3 ENSBTAP Tursiops truncatus Γειθίλη KLK1 ENSTTRP Tursiops truncatus Γειθίλη KLK4 ENSTTRP Tursiops truncatus Γειθίλη KLK5 ENSTTRP Tursiops truncatus Γειθίλη KLK6 ENSTTRP Tursiops truncatus Γειθίλη KLK8 ENSTTRP

166 165 Tursiops truncatus Γειθίλη KLK9 ENSTTRP Tursiops truncatus Γειθίλη KLK10 ENSTTRP Tursiops truncatus Γειθίλη KLK11 ENSTTRP Tursiops truncatus Γειθίλη KLK12 ENSTTRP Tursiops truncatus Γειθίλη KLK14 ENSTTRP Tursiops truncatus Γειθίλη Θξπςίλε ENSTTRP Equus caballus Ίππνο KLK1 Q6H322, NP_ , 1, 2, 3 ENSECAP Equus caballus Ίππνο KLK2 Q6H321, NP_ , 1, 2, 3 ENSECAP Equus caballus Ίππνο KLK4 XP_ , ENSECAP , 3 Equus caballus Ίππνο KLK5 XP_ , ENSECAP , 3 Equus caballus Ίππνο KLK6 XP_ , ENSECAP , 3 Equus caballus Ίππνο KLK8 XP_ , ENSECAP , 3 Equus caballus Ίππνο KLK9 XP_ , ENSECAP , 3 Equus caballus Ίππνο KLK11 XP_ , ENSECAP , 3 Equus caballus Ίππνο KLK12 XP_ , ENSECAP , 3 Equus caballus Ίππνο KLK13 XP_ , ENSECAP , 3 Equus caballus Ίππνο KLK14 XP_ , ENSECAP , 3 Equus caballus Ίππνο KLK15 XP_ , ENSECAP , 3 Equus caballus Ίππνο Θξπςίλε XP_ , ENSECAP , 3 Pteropus vampyrus Νπρηεξίδα KLK1 ENSPVAP Pteropus vampyrus Νπρηεξίδα KLK5 ENSPVAP Pteropus vampyrus Νπρηεξίδα KLK6 ENSPVAP Pteropus vampyrus Νπρηεξίδα KLK7 ENSPVAP Pteropus vampyrus Νπρηεξίδα KLK8 ENSPVAP Pteropus vampyrus Νπρηεξίδα KLK9 ENSPVAP Pteropus vampyrus Νπρηεξίδα KLK10 ENSPVAP Pteropus vampyrus Νπρηεξίδα KLK11 ENSPVAP Pteropus vampyrus Νπρηεξίδα KLK12 ENSPVAP Pteropus vampyrus Νπρηεξίδα KLK13 ENSPVAP Pteropus vampyrus Νπρηεξίδα KLK14 ENSPVAP Pteropus vampyrus Νπρηεξίδα KLK15 ENSPVAP Pteropus vampyrus Νπρηεξίδα Θξπςίλε ENSPVAP Canis familiaris Κχσλ KLK1 Q29474, CAA53210, 1, 2, 3 ENSCAFP Canis familiaris θχινο KLK2 XP_854598, ENSCAFP , 3 Canis familiaris θχινο KLK4 XP_541470, ENSCAFP , 3 Canis familiaris θχινο KLK5 XP_541469, ENSCAFP , 3 Canis familiaris θχινο KLK6 XP_533605, ENSCAFP , 3 Canis familiaris θχινο KLK7 XP_854584, ENSCAFP , 3

167 166 Canis familiaris θχινο KLK8 XP_541468, ENSCAFP , 3 Canis familiaris θχινο KLK9 ENSCAFP Canis familiaris θχινο KLK10 XP_541467, ENSCAFP , 3 Canis familiaris θχινο KLK11 XP_533604, ENSCAFP , 3 Canis familiaris θχινο KLK12 XP_854572, ENSCAFP , 3 Canis familiaris θχινο KLK13 XP_541465, ENSCAFP , 3 Canis familiaris θχινο KLK14 C7T1J3, ACU82847, 1, 2, 3 ENSCAFP Canis familiaris θχινο KLK15 XP_537938, ENSCAFP , 3 Canis familiaris θχινο Θξπςίλε P06872, XP_532744, 1, 2, 3 ENSCAFP Felis catus Γάηα KLK1 ENSFCAP Felis catus Γάηα KLK2 ENSFCAP Felis catus Γάηα KLK4 ENSFCAP Felis catus Γάηα KLK5 ENSFCAP Felis catus Γάηα KLK6 ENSFCAP Felis catus Γάηα KLK9 ENSFCAP Felis catus Γάηα KLK11 ENSFCAP Felis catus Γάηα KLK12 ENSFCAP Felis catus Γάηα KLK13 ENSFCAP Felis catus Γάηα KLK15 ENSFCAP Felis catus Γάηα Θξπςίλε ENSFCAP Erinaceus europaeus Αθαλζφρνηξνο KLK1 ENSEEUP Erinaceus europaeus Αθαλζφρνηξνο KLK2 ENSEEUP Erinaceus europaeus Αθαλζφρνηξνο KLK4 ENSEEUP Erinaceus europaeus Αθαλζφρνηξνο KLK6 ENSEEUP Erinaceus europaeus Αθαλζφρνηξνο KLK8 ENSEEUP Erinaceus europaeus Αθαλζφρνηξνο KLK11 ENSEEUP Erinaceus europaeus Αθαλζφρνηξνο KLK13 ENSEEUP Erinaceus europaeus Αθαλζφρνηξνο KLK14 ENSEEUP Erinaceus europaeus Αθαλζφρνηξνο KLK15 ENSEEUP Erinaceus europaeus Αθαλζφρνηξνο Θξπςίλε ENSEEUP Erinaceus europaeus Αθαλζφρνηξνο CFD ENSEEUP Procavia capensis Ύξαμ KLK1 ENSPCAP Procavia capensis Ύξαμ KLK5 ENSPCAP Procavia capensis Ύξαμ KLK7 ENSPCAP Procavia capensis Ύξαμ KLK8 ENSPCAP Procavia capensis Ύξαμ KLK9 ENSPCAP Procavia capensis Ύξαμ KLK10 ENSPCAP Procavia capensis Ύξαμ KLK11 ENSPCAP Procavia capensis Ύξαμ KLK12 ENSPCAP

168 167 Procavia capensis Ύξαμ KLK14 ENSPCAP Procavia capensis Ύξαμ KLK15 ENSPCAP Procavia capensis Ύξαμ Θξπςίλε ENSPCAP Echinops telfairi Σελξέθ KLK1 ENSETEP Echinops telfairi Σελξέθ KLK8 ENSETEP Echinops telfairi Σελξέθ KLK10 ENSETEP Echinops telfairi Σελξέθ KLK11 ENSETEP Echinops telfairi Σελξέθ KLK15 ENSETEP Echinops telfairi Σελξέθ Θξπςίλε ENSETEP Mus musculus Μπο Klk1 P15947, NP_034769, 1, 2, 3 ENSMUSP Mus musculus Μπο Klk2-ps AY Mus musculus Μπο Klk1b1 P00755, NP_034775, ENSMUSP Mus musculus Μπο Klk1b3 P00756, NP_032719, ENSMUSP Mus musculus Μπο Klk1b4 P00757, NP_035045, ENSMUSP Mus musculus Μπο Klk1b5 P15945, NP_032482, ENSMUSP Mus musculus Μπο Klk1b8 P07628, NP_032483, ENSMUSP Mus musculus Μπο Klk1b9 P15949, NP_034246, ENSMUSP Mus musculus Μπο Klk1b11 P15946, NP_034770, ENSMUSP Mus musculus Μπο Klk1b16 P04071, NP_032480, ENSMUSP Mus musculus Μπο Klk1b21 Q61759, NP_034772, ENSMUSP Mus musculus Μπο Klk1b22 P15948, NP_034244, ENSMUSP Mus musculus Μπο Klk1b24 Q61754, NP_034773, ENSMUSP Mus musculus Μπο Klk1b26 P36369, NP_034774, ENSMUSP Mus musculus Μπο Klk1b27 Q9JM71, NP_064664, ENSMUSP Mus musculus Μπο Klk4 Q9JIS2, NP_064312, ENSMUSP , 2, 3 1, 2, 3 1, 2, 3 1, 2, 3 1, 2, 3 1, 2, 3 1, 2, 3 1, 2, 3 1, 2, 3 1, 2, 3 1, 2, 3 1, 2, 3 1, 2, 3 1, 2, 3

169 168 Mus musculus Μπο Klk5 Q9D140, NP_081082, 1, 2, 3 ENSMUSP Mus musculus Μπο Klk6 Q91Y82, NP_035307, 1, 2, 3 ENSMUSP Mus musculus Μπο Klk7 Q91VE3, NP_036002, 1, 2, 3 ENSMUSP Mus musculus Μπο Klk8 Q61955, NP_032966, 1, 2, 3 ENSMUSP Mus musculus Μπο Klk9 Q32M27, NP_082936, 1, 2, 3 ENSMUSP Mus musculus Μπο Klk10 Q99M20, NP_598473, 1, 2, 3 ENSMUSP Mus musculus Μπο Klk11 Q9QYN3, NP_064358, 1, 2, 3 ENSMUSP Mus musculus Μπο Klk12 B2RVZ0, NP_081373, 1, 2, 3 ENSMUSP Mus musculus Μπο Klk13 Q8CGR6, NP_ , 1, 2, 3 ENSMUSP Mus musculus Μπο Klk14 Q8CGR5, NP_777355, 1, 2, 3 ENSMUSP Mus musculus Μπο Klk15 Q8CGR4, NP_777354, 1, 2, 3 ENSMUSP Mus musculus Μπο Θξπςίλε Q792Y9, NP_ , 1, 2, 3 ENSMUSP Rattus norvegicus Αξνπξαίνο Klk1 P00758, AAA41464, 1, 2, 3 ENSRNOP Rattus norvegicus Αξνπξαίνο Klk2-ps BK Rattus norvegicus Αξνπξαίνο Klk1c2 P00759, AAA41466, 1, 2, 3 ENSRNOP Rattus norvegicus Αξνπξαίνο Klk1c3 P15950, AAA41465, 1, 2, 3 ENSRNOP Rattus norvegicus Αξνπξαίνο Klk1c4 Q63274, AAA58781, 1, 2, 3 ENSRNOP Rattus norvegicus Αξνπξαίνο Klk1c6 Q6IE61, CAE48387, 1, 2, 3 ENSRNOP Rattus norvegicus Αξνπξαίνο Klk1c7 P36373, AAA41461, 1, 2, 3 ENSRNOP Rattus norvegicus Αξνπξαίνο Klk1c8 P36374, AAA42036, 1, 2, 3 ENSRNOP Rattus norvegicus Αξνπξαίνο Klk1c9 P07647, AAA41467, ENSRNOP , 2, 3

170 169 Rattus norvegicus Αξνπξαίνο Klk1c10 P36375, AAB24071, 1, 2, 3 ENSRNOP Rattus norvegicus Αξνπξαίνο Klk1c12 P36376, AAA51640, 1, 2, 3 ENSRNOP Rattus norvegicus Αξνπξαίνο Klk4 Q6IE12, CAE51907, 1, 2, 3 ENSRNOP Rattus norvegicus Αξνπξαίνο Klk5 XP_ , ENSRNOP , 3 Rattus norvegicus Αξνπξαίνο Klk6 O54854, AAC02300, 1, 2, 3 ENSRNOP Rattus norvegicus Αξνπξαίνο Klk7 NP_ , ENSRNOP , 3 Rattus norvegicus Αξνπξαίνο Klk8 O88780, CAA06643, 1, 2, 3 ENSRNOP Rattus norvegicus Αξνπξαίνο Klk9 NP_ , ENSRNOP , 3 Rattus norvegicus Αξνπξαίνο Klk10 Q6IE55, CAE48393, 1, 2, 3 ENSRNOP Rattus norvegicus Αξνπξαίνο Klk11 NP_ , ENSRNOP , 3 Rattus norvegicus Αξνπξαίνο Klk12 NP_ , ENSRNOP , 3 Rattus norvegicus Αξνπξαίνο Klk13 XP_218643, ENSRNOP , 3 Rattus norvegicus Αξνπξαίνο Klk14 XP_218641, ENSRNOP , 3 Rattus norvegicus Αξνπξαίνο Klk15 XP_ , ENSRNOP , 3 Rattus norvegicus Αξνπξαίνο Θξπςίλε P00762, AAA98518, 1, 2, 3 ENSRNOP Dipodomys ordii Γηπνδφκπο KLK1 ENSDORP Dipodomys ordii Γηπνδφκπο KLK2 ENSDORP Dipodomys ordii Γηπνδφκπο KLK5 ENSDORP Dipodomys ordii Γηπνδφκπο KLK7 ENSDORP Dipodomys ordii Γηπνδφκπο KLK8 ENSDORP Dipodomys ordii Γηπνδφκπο KLK9 ENSDORP Dipodomys ordii Γηπνδφκπο KLK11 ENSDORP Dipodomys ordii Γηπνδφκπο KLK13 ENSDORP Dipodomys ordii Γηπνδφκπο KLK15 ENSDORP Dipodomys ordii Γηπνδφκπο Θξπςίλε ENSDORP Dasypus novemcinctus Αξκαδίιινο KLK5 ENSDNOP Dasypus novemcinctus Αξκαδίιινο KLK8 ENSDNOP Dasypus novemcinctus Αξκαδίιινο KLK9 ENSDNOP Dasypus novemcinctus Αξκαδίιινο KLK10 ENSDNOP Dasypus novemcinctus Αξκαδίιινο KLK15 ENSDNOP Dasypus novemcinctus Αξκαδίιινο Θξπςίλε ENSDNOP Monodelphis domestica Γίδειθπο KLK5 XP_ , ENSMODP , 3

171 170 Monodelphis Γίδειθπο KLK7 XP_ , ENSMODP , 3 domestica Monodelphis Γίδειθπο KLK9 XP_ , ENSMODP , 3 domestica Monodelphis Γίδειθπο KLK11 XP_ , ENSMODP , 3 domestica Monodelphis Γίδειθπο KLK13 XP_ , ENSMODP , 3 domestica Monodelphis Γίδειθπο KLK14 XP_ , ENSMODP , 3 domestica Monodelphis Γίδειθπο KLK15 XP_ , ENSMODP , 3 domestica Monodelphis Γίδειθπο Θξπςίλε XP_ , ENSMODP , 3 domestica Macropus eugenii Καγθνπξφ KLK5 ENSMEUP Macropus eugenii Καγθνπξφ KLK6 ENSMEUP Macropus eugenii Καγθνπξφ KLK8 ENSMEUP Macropus eugenii Καγθνπξφ KLK10 ENSMEUP Macropus eugenii Καγθνπξφ KLK11 ENSMEUP Macropus eugenii Καγθνπξφ KLK14 ENSMEUP Macropus eugenii Καγθνπξφ KLK15 ENSMEUP Macropus eugenii Καγθνπξφ Θξπςίλε ENSMEUP Ornithorhynchus Πιαηχπνπο KLK5L XP_ anatinus Ornithorhynchus Πιαηχπνπο KLK6 XP_ , ENSOANP , 3 anatinus Ornithorhynchus Πιαηχπνπο KLK10 XP_ , ENSOANP , 3 anatinus Ornithorhynchus Πιαηχπνπο KLK14 XP_ , ENSOANP , 3 anatinus Ornithorhynchus Πιαηχπνπο KLK15 XP_ , ENSOANP , 3 anatinus Ornithorhynchus Πιαηχπνπο Θξπςίλε XP_ , ENSOANP , 3 anatinus Taeniopygia guttata πίλνο KLK-like Μ XP_ , ENSTGUP , 3 Meleagris gallopavo Γηάλνο KLK-like Μ ENSMGAP Blarina brevicauda Μπγαιή BLTX Q76B45; BAD , 2 Anolis carolinensis αχξα KLK orphan1 ENSACAP Anolis carolinensis αχξα KLK orphan2 ENSACAP Anolis carolinensis αχξα KLK νξθαλή 3 ENSACAP Anolis carolinensis αχξα KLKL ηνμίλε ENSACAP

172 171 Anolis carolinensis αχξα Θξπςίλε ENSACAP Xenopus tropicalis Βάηξαρνο KLK1 Q5M908, AAH87753, ENSXETP Xenopus tropicalis Βάηξαρνο Θξπςίλε Q5M959, NP_ , ENSXETP Danio rerio Ηρζχο Θξπςίλε Q8AV83, NP_571783, ENSDARP Danio rerio Ηρζχο CFD Q6DBS8, NP_ , ENSDARP Danio rerio Ηρζχο Υπκνζξπςίλε Q7SX97, NP_997783, ENSDARP Danio rerio Ηρζχο PLG Q6PBA6, NP_958880, ENSDARP , 2, 3 1, 2, 3 1, 2, 3 1, 2, 3 1, 2, 3 1, 2, 3 *ΒΓ: 1 UniProt: 2 NCBI: 3 ENSEMBL: release 55 Μ: Μεξηθή αθνινπζία

173 172 ΠΑΡΑΡΣΖΜΑ 3. Οξγάλσζε ησλ γνληδίσλ KLK. Πνιιαπιή γξακκηθή ζηνίρηζε ησλ ακηλνμηθψλ αθνινπζηψλ πνπ αληηζηνηρνχλ ζηελ θπξίσο θαηαιπηηθή πεξηνρή ηεο ζξπςίλεο ησλ πξσηετλψλ KLK κε ρξήζε ηνπ πξνγξάκκαηνο MUSCLE. Οη ζέζεηο καηίζκαηνο αλαγξάθνληαη ζην ηέινο ησλ αληίζηνηρσλ εμσλίσλ κε καχξε ζθίαζε. Οη ζέζεηο καηίζκαηνο ηνπ πιαζκηληγφλνπ (PLG) αλαγξάθνληαη κε γθξη ζθίαζε. Οη αξηζκνί αλαθέξνληαη ζηηο ζέζεηο ησλ ακηλνμέσλ ζε ζρέζε κε ηε ζέζε έλαξμεο ηεο θαηαιπηηθήο πεξηνρήο. Σα ακηλνμεά ηεο θαηαιπηηθήο ηξηάδαο αλαπαξίζηαληαη κε κπιε ρξψκα θαη ε γιπθίλε κε πξάζηλν ρξψκα. Άνθπυπορ KLK1 IVGGWECEQHSQPWQAALYHF--ST----FQCGGILVHRQWVLTAAHCI----SD-NYQLWLGRHNLFDD-E NTAQFVHVSES 71 Βάτπασορ KLK1 IIGGEECVPHSQPWQVALYYF--SD----FICGGVLINEWWVLTAAHCI----QS-HLQVALGAHNKTNP-M GHIQYTYAAKI 71 Άνθπυπορ KLK2 IVGGWECEKHSQPWQVAVYSH--GW----AHCGGVLVHPQWVLTAAHCL----KK-NSQVWLGRHNLFEP-E DTGQRVPVSHS 71 Άνθπυπορ KLK3 IVGGWECEKHSQPWQVLVASR--GR----AVCGGVLVHPQWVLTAAHCI----RN-KSVILLGRHSLFHP-E DTGQVFQVSHS 71 Άνθπυπορ KLK4 IINGEDCSPHSQPWQAALVME--NE----LFCSGVLVHPQWVLSAAHCF----QN-SYTIGLGLHSLEADQE PGSQMVEASLS 72 Άνθπυπορ KLK5 IINGSDCDMHTQPWQAALLLRP-NQ----LYCGAVLVHPQWLLTAAHCR----KK-VFRVRLGHYSLSPVYE SGQQMFQGVKS 73 Δίδελφςρ KLK5 ILNGKDCQPQTQPWQAALFLRP-NR----LYCGAVLVHPQWVLTAAHCQ----KP-AYSVRLGRYHLQGI-D PGQRILRGVKS 72 Άνθπυπορ KLK6 LVHGGPCDKTSHPYQAALYTS--GH----LLCGGVLIHPLWVLTAAHCK----KP-NLQVFLGKHNLRQR-E SSQEQSSVVRA 71 Πλατύποςρ KLK6 IIAGEKCKEDGHPYQVAVYRG--GG----LLCGGVLIHPGWVLTAAHCR----KP-QLQVLLGKYNLHKQ-E EFQQLSPVAQP 71 Άνθπυπορ KLK7 IIDGAPCARGSHPWQVALLSG--NQ----LHCGGVLVNERWVLTAAHCK----MN-EYTVHLGSDTLG---D RRAQRIKASKS 69 Δίδελφςρ KLK7 IIQGVECNKNTHPWQVALFDG--NQ----LHCGGVLVAANWVLTAAHCR----KG-SYNVHLGKHSLKGN-E KGSQVIRATRS 71 Άνθπυπορ KLK8 VLGGHECQPHSQPWQAALFQG--QQ----LLCGGVLVGGNWVLTAAHCK----KP-KYTVRLGDHSLQNK-D GPEQEIPVVQS 71 Άνθπυπορ KLK9 AIGAEECRPNSQPWQAGLFHL--TR----LFCGATLISDRWLLTAAHCR----KP-YLWVRLGEHHLWKW-E GPEQLFRVTDF 71 Δίδελφςρ KLK9 AIGAEECTPNSQPWQAGLFFL--TR----LFCGATLLNDQWLLTAAHCR----KP-YLWVRLGEHHLWKW-E GPEQLFRVTDF 71 Άνθπυπορ KLK10 EAYGAPCARGSQPWQVSLFNG--LS----FHCAGVLVDQSWVLTAAHCG----NK-PLWARVGDDHLLLL QGEQLRRTTRS 70 Πλατύποςρ KLK CGRDSHPWQVSLFRN--LK----FRCAGVLVDRSWVLTSATCI----DR-SWPVRPRGKGQQGT-L LHAKLTVQMNK 65 Άνθπυπορ KLK11 IIKGFECKPHSQPWQAALFEK--TR----LLCGATLIAPRWLLTAAHCL----KP-RYIVHLGQHNLQKE-E GCEQTRTATES 71 Δίδελφςρ KLK11 IIKGYECPAHSQPWQVALFQK--SR----LHCGATLINRQWLLTAAHCK----KP-QYWVYLGEHNLQRP-D SCEQKRMATLS 71 Άνθπυπορ KLK12 IFNGTECGRNSQPWQVGLFEG--TS----LRCGGVLIDHRWVLTAAHCS----GS-RYWVRLGEHSLSQL-D WTEQIRHSGFS 71 Άνθπυπορ KLK13 LPGGYTCFPHSQPWQAALLVQ--GR----LLCGGVLVHPKWVLTAAHCL----KE-GLKVYLGKHALGRV-E AGEQVREVVHS 71 Δίδελφςρ KLK13 LPGVKECIPHSQPWQAVLLVN--GR----LLCGGILIHPSWVLTAAHCL----KN-KYTVYLGKHALGYS-E AGEQARRVTCS 71 Άνθπυπορ KLK14 IIGGHTCTRSSQPWQAALLAGPRRR----FLCGGALLSGQWVITAAHCG----RP-ILQVALGKHNLRRW-E ATQQVLRVVRQ 73 Δίδελφςρ KLK14 IIGGYTCIPHSQPWQAALFAS--RK----FHCGGVLLSNRWVLTAAHCG----HW-NLRVALGKHNLQRL-E PSQQMLRVNRQ 71 Πλατύποςρ KLK R-FLRVSLGKHDLRWW-E PTEQRRLVVRQ 27 Άνθπυπορ KLK15 LLEGDECAPHSQPWQVALYER--GR----FNCGASLISPHWVLSAAHCQ----SR-FMRVRLGEHNLRKR-D GPEQLRTTSRV 71 Δίδελφςρ KLK15 VLGGEECPPHSQPWQVALFEG--RR----FNCGASLISSQWLLTAAHCY----TS-KMRVRLGEHNLRVW-D GMEQLRGVVYA 71 Πλατύποςρ KLK15 VLGGKECAPGSQPWQVALFDF--GR----FNCGGTLLTPRWVLTAAHCL----TR-PIRVRLGEHNLKVL-E GQEQLRGVSRA 71 Σαύπα KLK οπφανή 1 VPGGKACPAHSQPWQAGLFSG--FR----LVCGGTLIHKSWVLSAAHCR----RRSPFPVRLGEHDLKRL-D WSEQLKLASKV 72 Σαύπα KLK οπφανή 2 IIGGYNCPQRSRAFQAALVTG--RRGNWNIYCGGSLVHPCWVLSAAHCK----PRRQMKVCLGKSNLRRY-E RTEQCLNIAEV 76 Σαύπα KLK οπφανή 3 IIGGQECPKHGQPYQVILSNS--RKNGPDVQCGGVLIDKDWVLTAAHCD----NQGTIHTRMGDHSLRAN-E GSEQCIKSAQK 76 Σαύπα KLKL τοξίνη IIGGEECAEDGHPWLVSIYGS--NW----LQCSGVLINQDWVLTAAHCY----KRSGMQLKLGVHNKEVP-R EGEQLRTSAEA 72 Άνθπυπορ Θπςτίνη IVGGYTCEENSLPYQVSLNS---GS----HFCGGSLISEQWVVSAAHCY----KT-RIQVRLGEHNIKVL-E GNEQFINAAKI 70 Βάτπασορ Θπςτίνη IIGGSTCARNSVPYIVSLNA---GY----HFCGGSLLNNQWVVSAAHCY----QA-SIQVRLGEHNIALN-E GTEQFINSAKV 70 Ισθύρ Θπςτίνη IVGGYECTKNGVPYQVSLNS---GY----HFCGGSLISNLWVVSAAHCY----KS-RVQVRLGEHNIDVT-E GTEQFINSEKV 70 Άνθπυπορ Χςμοθπςτίνη VVGGEDARPHSWPWQISLQYL--KDDTWRHTCGGTLIASNFVLTAAHCI---SNTWTYRVAVGKNNLEVEDE EGSLFVGVDTI 78 Ισθύρ Χςμοθπςτίνη IVNGEEARPHSWPWQVSLQDST-GF----HFCGGSLINENWVVTAAHCN----VRTSHRVILGEHDRSSN-A EAIQTIAVGKS 73 Άνθπυπορ CFD ILGGREAEAHARPYMASVQLN--GA----HLCGGVLVAEQWVLSAAHCLEDAADG-KVQVLLGAHSLSQP-E PSKRLYDVLRA 75 Ισθύρ CFD ITGGQEAKAHSRPYMASVQWN--GK----HECGGFLISSQWVMSAAHCFQDGRTS-GVKVVLGAHSLSGA-E DTKQTFD-AEV 74 Άνθπυπορ PLG VVGGCVAHPHSWPWQVSLRTRF-GM----HFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNL-E PHVQEIEVSRL 77 Ισθύρ PLG IVGGCVSKPHSWPWQISLRTR--GK---IHFCGGTLIDPQWVVTAAHCLERSDSPSAYKIMLGIHTERAT-E SSKQERDVTKI 77 Άνθπυπορ KLK1 FPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELP-TQE--PEV-GSTCLASGWGSIEP ENF Βάτπασορ KLK1 CPHRDF DWS---TYNNDIMLLKLASQAD-INDRVAPIPLA-SYL--VAD-NTKCLASGWGSTTS PQE Άνθπυπορ KLK2 FPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAK-ITDVVKVLGLP-TQE--PAL-GTTCYASGWGSIEP EEF Άνθπυπορ KLK3 FPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAE-LTDAVKVMDLP-TQE--PAL-GTTCYASGWGSIEP EEF Άνθπυπορ KLK4 VRHPEY NRP---LLANDLMLIKLDESVS-ESDTIRSISIA-SQC--PTA-GNSCLVSGWGLLAN G Άνθπυπορ KLK5 IPHPGY SHP---GHSNDLMLIKLNRRIR-PTKDVRPINVS-SHC--PSA-GTKCLVSGWGTTKS PQV Δίδελφςρ KLK5 FPHPKY TRP---AHSNDLMLIKLNGRVS-MTPSIKTIKIS-TQP--PRP-GTQCLVSGWGTTSS PQV Άνθπυπορ KLK6 VIHPDY DAA---SHDQDIMLLRLARPAK-LSELIQPLPLE-RDC--SAN-TTSCHILGWGKTAD G Πλατύποςρ KLK6 FPHPDY DRG---RHDNDIMLLRLAHPTP-VSRHIKPLSLE-TDC--NAN-SSSCLISGWVFVKH SDG Άνθπυπορ KLK7 FRHPGY STQ---THVNDLMLVKLNSQAR-LSSMVKKVRLP-SRC--EPP-GTTCTVSGWGTTTS PDV

174 173 Δίδελφςρ KLK7 YRHPQY STV---THANDFLLIRLSRPAR-IGPTIKPITLP-SRC--APP-GTSCTVSGWGTTTS PDV Άνθπυπορ KLK8 IPHPCYNSS-----DVE---DHNHDLMLLQLRDQAS-LGSKVKPISLA-DHC--TQP-GQKCTVSGWGTVTS PRE Άνθπυπορ KLK9 FPHPGFNKDL----SAN---DHNDDIMLIRLPRQAR-LSPAVQPLNLS-QTC--VSP-GMQCLISGWGAVSS PKA Δίδελφςρ KLK9 FPHPGFNSDL----SAH---DHNHDIMLIRLKRPAK-LGPAVQPLNIS-NNC--VRP-GTTCLISGWGATSS PEV Άνθπυπορ KLK10 VVHPKYHQGSGPILPRR---TDEHDLMLLKLARPVV-PGPRVRALQLP-YRC--AQP-GDQCQVAGWGTTAA RRV Πλατύποςρ KLK10 YHRPGERCGTWTAGAGF----GEQGLGRVWKAGRGC-WRVGMDPGGWV-WGL--RRG-GSTCKV-GVGPEGE STV Άνθπυπορ KLK11 FPHPGFNNSL----PNK---DHRNDIMLVKMASPVS-ITWAVRPLTLS-SRC--VTA-GTSCLISGWGSTSS PQL Δίδελφςρ KLK11 FPHPGFNGSL----PNK---DHRNDIMLVKMNSPVM-LTRGVKPLALP-EDC--ATA-GSQCLISGWGTTTS PQL Άνθπυπορ KLK12 VTHPGYLG------AST---SHEHDLRLLRLRLPVR-VTSSVQPLPLP-NDC--ATA-GTECHVSGWGITNH PRN Άνθπυπορ KLK13 IPHPEYRRSP----THL---NHDHDIMLLELQSPVQ-LTGYIQTLPLSHNNR--LTP-GTTCRVSGWGTTTS PQV Δίδελφςρ KLK13 VPHPLYRGIP----THQ---SHDHDIMLLHLHKPAQ-LNNQVQVLPLPSQEY--LPP-GTCCTVSGWGTTTS PQV Άνθπυπορ KLK14 VTHPNY NSR---THDNDLMLLQLQQPAR-IGRAVRPIEVT-QAC--ASP-GTSCRVSGWGTISS PIA Δίδελφςρ KLK14 VVYPRY NQR---TNDHDLMLLHLERPVK-LTREIQPIQVA-RNC--ASP-GTSCLVSGWGTISS PHV Πλατύποςρ KLK14 IPHPSY NPR---TQDSDLMLLRLDRPVQ-LTPAVQPLGLS-PDC--AAP-GTPCRVSGWGTISS PLASPGPS 135 Άνθπυπορ KLK15 IPHPRY EAR---SHRNDIMLLRLVQPAR-LNPQVRPAVLP-TRC--PHP-GEACVV-GWGLVSHNEPGTAGSPRSQV Δίδελφςρ KLK15 FPHPRY QGH---GHHDDIMLLRLARPAS-LSDSVQPVALP-VRC--PRT-GEQCVVSGWGLVAESNNKTQRAPVPKV Πλατύποςρ KLK15 IPHPRY RER---DHEDDIMLLKLALPAR-LTPSVRPLSLP-TRC--PQP-GDRCVVSGWGLVAN SK Σαύπα KLK οπφανή 1 IVHPNY DPQ---TKNNDIMLVKLLTPVC-LNNKVKILKLP-TTC--PVP-GTECLISGWGTTTS PEV Σαύπα KLK οπφανή 2 RVHPEY DRS---KNNKDYMLLRLQPCAR-LSDAVKTIQLP-SGC--PND-GKQCTVSGWGTTRS PQA Σαύπα KLK οπφανή 3 FIHPAY NPS---THDSDIMLIRLDNSAN-INEYVRPIELA-TQC--TKP-NTRCEVSGWGTIKT PQS Σαύπα KLKL τοξίνη KCYPDAASSDSNNCAEK---TFVNDIMLVKLNAPVD-YNDNIQPVPLP-TAV--PEV-GTECKVMGWGTIHS SED Άνθπυπορ Θπςτίνη IRHPKY NRD---TLDNDIMLIKLSSPAV-INARVSTISLP-TAP--PAA-GTECLISGWGNTLS FGA Βάτπασορ Θπςτίνη IRHPNY NSR---TIDNDIMLIKLASPAS-LNSNVNAVALP-SSC--AAA-GSSCLISGWGNTST SGS Ισθύρ Θπςτίνη IRHPSY NSN---TLDNDVMLIKLSSSAQ-INSYVKTVSLP-SSC--ASS-GTSCLISGWGNMSA SGS Άνθπυπορ Χςμοθπςτίνη HVHKRW NAL---LLRNDIALIKLAEHVE-LSDTIQVACLPEKDS--LLPKDYPCYVTGWGRLWT NG Ισθύρ Χςμοθπςτίνη IKHPNY NSF---TINNDILLIKLATPAK-INTHVSPVCLAETND--NFPGGMKCVTSGWGLTRY NAP Άνθπυπορ CFD VPHPDS QPD---TIDHDLLLLQLSEKAT-LGPAVRPLPWQRVDR-DVAP-GTLCDVAGWGIVNH AG Ισθύρ CFD YNHPDF SIS---NYDNDIALIKLDKPVT-QSDAVKPVKFQRDETADPKE-AAVVETAGWGSLNN MG Άνθπυπορ PLG FLEPTR KDIALLKLSSPAV-ITDKVIPACLPSPNY--VVADRTECFITGWGETQG T Ισθύρ PLG IKGPAG TDIALLKLDRPAL-INDKVSPVCLPEKDY--IVPSNTECYVTGWGETQD T Άνθπυπορ KLK1 ----SFPDDLQCVDLKILPNDECEK-AHV--Q---KVTDFMLCVGHLEGGKDTCV-GDSGGPLMC---DG----VLQ-GVTSWGYV-PCG 201 Βάτπασορ KLK1 ----TYPDNLKCVSITTASNSVCQA-SYPR-D---TVTDNMLCAGNMAGGEDTCV-GDSGGPLVC---NG----ELH-GITSWGDF-VCG 212 Άνθπυπορ KLK2 ----LRPRSLQCVSLHLLSNDMCAR-AYS--E---KVTEFMLCAGLWTGGKDTCG-GDSGGPLVC---NG----VLQ-GITSWGPE-PCA 211 Άνθπυπορ KLK3 ----LTPKKLQCVDLHVISNDVCAQ-VHP--Q---KVTKFMLCAGRWTGGKSTCS-GDSGGPLVC---NG----VLQ-GITSWGSE-PCA 201 Άνθπυπορ KLK4 ----RMPTVLQCVNVSVVSEEVCSK-LYD--P---LYHPSMFCAGGGQDQKDSCN-GDSGGPLIC---NG----YLQ-GLVSFGKA-PCG 200 Άνθπυπορ KLK5 ----HFPKVLQCLNISVLSQKRCED-AYP--R---QIDDTMFCAGDKA-GRDSCQ-GDSGGPVVC---NG----SLQ-GLVSWGDY-PCA 200 Δίδελφςρ KLK5 ----HYPQVLQCLNITIMSHEACQR-AYP--G---AIDSTMFCAGDEV-GKDSCQ-GDSGGPVVC---NG----YLQ-GLVSWGDV-PCG 199 Άνθπυπορ KLK6 ----DFPDTIQCAYIHLVSREECEH-AYP--G---QITQNMLCAGDEKYGKDSCQ-GDSGGPLVC---GD----HLR-GLVSWGNI-PCG 198 Πλατύποςρ KLK6 ----GGAREGRSERVSPPDNTECYLHVHPKQREPSRAADAIVEGGESGRGLGKAQKGDSGGPLVC---GG----RLR-GLVSWGEV-PCG 205 Άνθπυπορ KLK7 ----TFPSDLMCVDVKLISPQDCTK-VYK--D---LLENSMLCAGIPDSKKNACN-GDSGGPLVC---RG----TLQ-GLVSWGTF-PCG 200 Δίδελφςρ KLK7 ----TYPDKLQCTDVKLISFSECKK-VYK--D---LLKESMLCAGIPGSSTNACN-GDSGGPLVC---NG----VLE-GLVSWGTF-PCG 203 Άνθπυπορ KLK8 ----NFPDTLNCAEVKIFPQKKCED-AYP--G---QITDGMVCAGSSK-GADTCQ-GDSGGPLVC---DG----ALQ-GITSWGSD-PCG 203 Άνθπυπορ KLK9 ----LFPVTLQCANISILENKLCHW-AYP--G---HISDSMLCAGLWEGGRGSCQ-GDSGGPLVC---NG----TLA-GVVSGGAE-PCS 204 Δίδελφςρ KLK9 ----EYPLSLQCANISVLDPRLCHK-AYP--G---RITSNMVCAGLWEGGRGSCQ-GDSGGPLVC---NG----ALA-GVVSGGAE-PCS 207 Άνθπυπορ KLK KYNKGLTCSSITILSPKECEV-FYP--G---VVTNNMICAGLDR-GQDPCQ-SDSGGPLVC---DE----TLQ-GILSWGVY-PCG 201 Πλατύποςρ KLK KYAKNLSCAPVKVLSHEECSQ-SYP--G---VVTRNMLCAG-QAGGRDPCQ-GDSGGPLVC---NG----TLQ-GILSWGDY-PCG 201 Άνθπυπορ KLK RLPHTLRCANITIIEHQKCEN-AYP--G---NITDTMVCASVQEGGKDSCQ-GDSGGPLVC---NQ----SLQ-GIISWGQD-PCA 204 Δίδελφςρ KLK TLPHTLRCANITLIDHRECEG-AYP--G---NITDTMVCAGVTKEGKDSCQ-GDSGGPLVC---NG----TLQ-GIISWGQD-PCA 202 Άνθπυπορ KLK PFPDLLQCLNLSIVSHATCHG-VYP--G---RITSNMVCAGGVP-GQDACQ-GDSGGPLVC---GG----VLQ-GLVSWGSVGPCG 204 Άνθπυπορ KLK NYPKTLQCANIQLRSDEECRQ-VYP--G---KITDNMLCAGTKEGGKDSCE-GDSGGPLVC---NR----TLY-GIVSWGDF-PCG 205 Δίδελφςρ KLK NYPKTLQCAEIQLRSDEECHQ-SYP--G---KITPNMLCAGSQEGGKDSCE-GDSGGPLVC---NG----ILQ-GVISWGDF-PCG 203 Άνθπυπορ KLK RYPASLQCVNINISPDEVCQK-AYP--R---TITPGMVCAGVPQGGKDSCQ-GDSGGPLVC---RG----QLQ-GLVSWGME-RCA 200 Δίδελφςρ KLK RYPSTLQCVNIDILSDERCRN-SYP--G---AITRGMVCAGDQKGEKDSCQ-GDSGGPLVC---NG----ALQ-GLVSWGSE-QCA 156 Πλατύποςρ KLK14 PSPVRYPDILQCVNIQIVSDKACQG-AYP--G---GITPSMVCAGDWQGGKDSCQ-GDSGGPLVC---RG----KLQ-GLVSWGLE-QCG 209 Άνθπυπορ KLK SLPDTLHCANISIISDTSCDK-SYP--G---RLTNTMVCAGAEGRGAESCE-GDSGGPLVC---GG----ILQ-GIVSWGDV-PCD 209 Δίδελφςρ KLK KLPDTLHCANISIISAASCNR-DYP--G---QVTDTMVCAGVEGGGTDSCE-GDSGGPLVC---GG----TLQ-GIVSWGDV-PCD 210 Πλατύποςρ KLK GEEAGGTDRWV-GC Σαύπα KLK οπφανή NFPDVLHCANITVVDYEVCRS-IYP--N---YINENMVCAGKMEGGTDACQ-GDSGGPLAC---NG----QLQ-GIVSWGPI-LCG 205 Σαύπα KLK οπφανή QLPAQLQCANVSIVPQPKCNS-AYR--G---SITPYMVCAGVPQGGTDSCQ-GDSGGPLVC---NG----QLE-GVVSWGTY-VCA 205 Σαύπα KLK οπφανή EFPDLLQCATVYTISNEECNK-AYP--N---AITENMLCATVSGGGVDSCQ-GDSGGPLVC---NN----KLQ-GIVSWGMQ-VCA 209 Σαύπα KLKL τοξίνη ----IYPLVPYCVDIEILNNGVCEA-AYPW-C---TAYDKLLCAGVLEGGKDSCH-GDSGGPLMC---GD----ELQ-GILSFGGH-PCA 200 Άνθπυπορ Θπςτίνη ----DYPDELKCLDAPVLTQAECKA-SYP--G---KITNSMFCVGFLEGGKDSCQ-RDSGGPVVC---NG----QLQ-GVVSWGH--GCA 198 Βάτπασορ Θπςτίνη ----NYPNLLQCLSAPILTTAQCTG-AYP--G---QITNNMFCAGFLEGGKDSCQ-GDSGGPVVC---NG----QLQ-GIVSWGV--GCA 198 Ισθύρ Θπςτίνη ----NYPSRLMCLNAPILSDSTCRN-AYP--G---QISSNMFCAGFMEGGKDSCQ-GDSGGPVVC---NN----QLQ-GIVSWGY--GCA 199 Άνθπυπορ Χςμοθπςτίνη ----PIADKLQQGLQPVVDHATCSRIDWW--GF--RVKKTMVCAGG-DGVISACN-GDSGGPLNCQLENG--SWEVF-GIVSFGSRRGCN 210 Ισθύρ Χςμοθπςτίνη ----DTPALLQQAALPLLTNDDCKR--YW--GT--NITDLMICAGAS--GVSSCM-GDSGGPLVC---ENNRVWTLV-GIVSWGSS-TCS 208 Άνθπυπορ CFD ----RRPDSLQHVLLPVLDRATCNRRTHHD-G---AITERLMCAESNR--RDSCK-GDSGGPLVC---GG----VLE-GVVTSGSR-VCG 204 Ισθύρ CFD ----GRPDKLHELSIPVMERWRCGRADFY--GE--KFTSNMLCAADKR--KDTCD-GDSGGPLLY---RG----IVV-GITSNGGK-KCG 210 Άνθπυπορ PLG ----FGAGLLKEAQLPVIENKVCNRYEFLN-G---RVQSTELCAGHLAGGTDSCQ-GDSGGPLVC---FEKDKYILQ-GVTSWGL--GCA 205 Ισθύρ PLG ----GGEGYLKETGFPVIENKVCNRPSFLN-G---RVKDHEMCAGNIEGGNDSCQ-GDSGGPLVC---YAQNTFVLQ-GVTSWGL--GCA 214

175 Άνθπυπορ KLK1 TP NKPSVAVRVLSYVKWIEDTIA 235 Βάτπασορ KLK1 SP NKPGIFAKVFNYIDWINNIMQ 224 Άνθπυπορ KLK2 LP EKPAVYTKVVHYRKWIKDTIA 234 Άνθπυπορ KLK3 LP ERPSLYTKVVHYRKWIKDTIV 234 Άνθπυπορ KLK4 QV GVPGVYTNLCKFTEWIEKTVQ 222 Άνθπυπορ KLK5 RP NRPGVYTNLCKFTKWIQETIQ 224 Δίδελφςρ KLK5 QP NKPGVYTNLYVFEKWIEDTIK 223 Άνθπυπορ KLK6 SK EKPGVYTNVCRYTNWIQKTIQ 221 Πλατύποςρ KLK6 TG EKPGVYTNVCRYVDWIRETIR 230 Άνθπυπορ KLK7 QP NDPGVYTQVCKFTKWINDTMK 221 Δίδελφςρ KLK7 RS NDPGVYSQVCKQMPWILSVIR 223 Άνθπυπορ KLK8 RP DKPGVYTNICRYLDWIKKIIG 225 Άνθπυπορ KLK9 KP RRPAVYTSVCHYLDWIQEIME 227 Δίδελφςρ KLK9 SA KRPSVYTSVCQYRKWISKTMR 227 Άνθπυπορ KLK10 AG QHPAVYTQICKYMSWINKVIR 229 Πλατύποςρ KLK10 IT PHPAVYTKICRYSSWINKIIK 222 Άνθπυπορ KLK11 VS RKPGVYTKVCKYVDWIQETMK 227 Δίδελφςρ KLK11 QD RKPGVYTKVCKYVDWIHETIK 227 Άνθπυπορ KLK12 QP GIPGVYTYICKYVDWIRMIMR 225 Άνθπυπορ KLK13 QP DRPGVYTRVSRYVLWIRETIR 228 Δίδελφςρ KLK13 LP NRPGVYTRVSRYVDWIQNVIQ 228 Άνθπυπορ KLK14 QA GYPGVYTNLCKYRSWIEETMR 225 Δίδελφςρ KLK14 LS KYPGVYTNLCRYWTWIQNEVG 223 Πλατύποςρ KLK14 NT NHPGVYTNLCKFTRWIQNTMR 188 Άνθπυπορ KLK15 TT TKPGVYTKVCHYLEWIRETMK 232 Δίδελφςρ KLK15 TT TKPGVYTKVCKYLTWIRDTMK 233 Πλατύποςρ KLK Σαύπα KLK οπφανή 1 QP NRPGVYVNVCKYVDWIRETIR 224 Σαύπα KLK οπφανή 2 QK GNPGVYAKVCCIVPWIQKTVN 228 Σαύπα KLK οπφανή 3 QA GKPGVYTNICQFTDWIQNTMR 228 Σαύπα KLKL τοξίνη KPLEPGVYVKVDSYLDWITTTKPGVYTKVCKYLTWIRDTMK 251 Άνθπυπορ Θπςτίνη WK NRPGVYTKVYNYVDWIKDTIA 221 Βάτπασορ Θπςτίνη QR NYPGVYTKVCNYNSWIQSTIA 221 Ισθύρ Θπςτίνη QR NKPGVYAKVCTSPPGSETP Άνθπυπορ Χςμοθπςτίνη TR KKPVVYTRVSAYIDWINEKMQ 238 Ισθύρ Χςμοθπςτίνη T STPAVYARVTKLRAWVDQTIA 228 Άνθπυπορ CFD NR KKPGIYTRVASYAAWIDSVLA 228 Ισθύρ CFD SS RKPGLYTIISHYASWIDTTTT 228 Άνθπυπορ PLG RP NKPGVYVRVSRFVTWIEGVMR 228 Ισθύρ PLG NA MKPGVYTRVSKFVDWIERSIK

176 175 ΠΑΡΑΡΣΖΜΑ 4. Αλάιπζε ηνπ ξπζκνύ κεηαβνιήο. Α, KLK7 έλαληη KLK10. Β, KLK7 έλαληη KLK12. Γ, KLK12 έλαληη KLK10. Α) Β)

177 Γ) 176

ΑΛΛΑΓΗ ΟΝΟΜΑΣΟ ΚΑΙ ΟΜΑΔΑ ΕΡΓΑΙΑ, ΚΟΙΝΟΥΡΗΣΟΙ ΦΑΚΕΛΟΙ ΚΑΙ ΕΚΣΤΠΩΣΕ ΣΑ WINDOWS XP

ΑΛΛΑΓΗ ΟΝΟΜΑΣΟ ΚΑΙ ΟΜΑΔΑ ΕΡΓΑΙΑ, ΚΟΙΝΟΥΡΗΣΟΙ ΦΑΚΕΛΟΙ ΚΑΙ ΕΚΣΤΠΩΣΕ ΣΑ WINDOWS XP ΑΛΛΑΓΗ ΟΝΟΜΑΣΟ ΚΑΙ ΟΜΑΔΑ ΕΡΓΑΙΑ, ΚΟΙΝΟΥΡΗΣΟΙ ΦΑΚΕΛΟΙ ΚΑΙ ΕΚΣΤΠΩΣΕ ΣΑ WINDOWS XP ηότοι εργαζηηρίοσ ην πιαίζην ηνπ ζπγθεθξηκέλνπ εξγαζηεξίνπ ζα παξνπζηαζηνύλ βαζηθέο ιεηηνπξγίεο ησλ Windows XP πνπ ζρεηίδνληαη

Διαβάστε περισσότερα

H ΜΑΓΕΙΑ ΤΩΝ ΑΡΙΘΜΩΝ

H ΜΑΓΕΙΑ ΤΩΝ ΑΡΙΘΜΩΝ H ΜΑΓΕΙΑ ΤΩΝ ΑΡΙΘΜΩΝ Φξεζηκόηεηα καζεκαηηθώλ Αξρή θαηακέηξεζεο Όζα έδσζαλ νη Έιιελεο... Τξίγσλνη αξηζκνί Τεηξάγσλνη αξηζκνί Δπηκήθεηο αξηζκνί Πξώηνη αξηζκνί Αξηζκνί κε μερσξηζηέο ηδηόηεηεο Γίδπκνη πξώηνη

Διαβάστε περισσότερα

ΚΤΠΡΙΑΚΗ ΜΑΘΗΜΑΣΙΚΗ ΕΣΑΙΡΕΙΑ ΜΑΘΗΜΑΣΙΚΗ ΚΤΣΑΛΟΓΡΟΜΙΑ 2007 ΓΙΑ ΣΟ ΓΤΜΝΑΙΟ Παπασκευή 26 Ιανουαπίου 2007 Σάξη: Α Γυμνασίου ΥΟΛΕΙΟ..

ΚΤΠΡΙΑΚΗ ΜΑΘΗΜΑΣΙΚΗ ΕΣΑΙΡΕΙΑ ΜΑΘΗΜΑΣΙΚΗ ΚΤΣΑΛΟΓΡΟΜΙΑ 2007 ΓΙΑ ΣΟ ΓΤΜΝΑΙΟ Παπασκευή 26 Ιανουαπίου 2007 Σάξη: Α Γυμνασίου ΥΟΛΕΙΟ.. ΜΑΘΗΜΑΣΙΚΗ ΚΤΣΑΛΟΓΡΟΜΙΑ 2007 ΓΙΑ ΣΟ ΓΤΜΝΑΙΟ Παπασκευή 26 Ιανουαπίου 2007 Σάξη: Α Γυμνασίου έλαξμεο 09.30 ιήμεο 09.45 Σην παξαθάησ ζρήκα θαίλεηαη ηκήκα ελόο πνιενδνκηθνύ ζρεδίνπ κηαο πόιεο. Οη ζθηαζκέλεο

Διαβάστε περισσότερα

Βάσεις Δεδομέμωμ. Εξγαζηήξην V. Τκήκα Πιεξνθνξηθήο ΑΠΘ 2015-2016

Βάσεις Δεδομέμωμ. Εξγαζηήξην V. Τκήκα Πιεξνθνξηθήο ΑΠΘ 2015-2016 Βάσεις Δεδομέμωμ Εξγαζηήξην V Τκήκα Πιεξνθνξηθήο ΑΠΘ 2015-2016 2 Σκοπός του 5 ου εργαστηρίου Σθνπόο απηνύ ηνπ εξγαζηεξίνπ είλαη: ε κειέηε ζύλζεησλ εξσηεκάησλ ζύλδεζεο ζε δύν ή πεξηζζόηεξεο ζρέζεηο ε κειέηε

Διαβάστε περισσότερα

Δπηιέγνληαο ην «Πξνεπηινγή» θάζε θνξά πνπ ζα ζπλδέεζηε ζηελ εθαξκνγή ζα βξίζθεζηε ζηε λέα ρξήζε.

Δπηιέγνληαο ην «Πξνεπηινγή» θάζε θνξά πνπ ζα ζπλδέεζηε ζηελ εθαξκνγή ζα βξίζθεζηε ζηε λέα ρξήζε. ΑΝΟΙΓΜΑ ΝΔΑ ΥΡΗΗ 1. Γεκηνπξγείηε ηε λέα ρξήζε από ηελ επηινγή «Παξάκεηξνη/Παξάκεηξνη Δηαηξίαο/Γηαρείξηζε Δηαηξηώλ». Πιεθηξνινγείηε ηνλ θσδηθό ηεο εηαηξίαο ζαο θαη παηάηε Enter. Σηελ έλδεημε «Υξήζεηο» παηάηε

Διαβάστε περισσότερα

ΛΙΜΝΗ ΤΣΑΝΤ. Σρήκα 1. Σρήκα 2

ΛΙΜΝΗ ΤΣΑΝΤ. Σρήκα 1. Σρήκα 2 ΛΙΜΝΗ ΤΣΑΝΤ Τν Σρήκα 1 δείρλεη ηελ αιιαγή ηεο ζηάζκεο ηεο Λίκλεο Τζαλη, ζηε Σαράξα ηεο Βόξεηαο Αθξηθήο. Η Λίκλε Τζαλη εμαθαλίζηεθε ηειείσο γύξσ ζην 20.000 π.χ., θαηά ηε δηάξθεηα ηεο ηειεπηαίαο επνρήο ησλ

Διαβάστε περισσότερα

Η/Υ A ΤΑΞΕΩΣ ΑΕ 2010-2011. Συστήματα Αρίθμησης. Υποπλοίαρχος Ν. Πετράκος ΠΝ

Η/Υ A ΤΑΞΕΩΣ ΑΕ 2010-2011. Συστήματα Αρίθμησης. Υποπλοίαρχος Ν. Πετράκος ΠΝ Συστήματα Αρίθμησης Υποπλοίαρχος Ν. Πετράκος ΠΝ 1 Ειζαγωγή Τν bit είλαη ε πην βαζηθή κνλάδα κέηξεζεο. Είλαη κία θαηάζηαζε on ή off ζε έλα ςεθηαθό θύθισκα. Άιιεο θνξέο είλαη κία θαηάζηαζε high ή low voltage

Διαβάστε περισσότερα

ΚΤΠΡΙΑΚΗ ΜΑΘΗΜΑΣΙΚΗ ΕΣΑΙΡΕΙΑ ΜΑΘΗΜΑΣΙΚΗ ΚΤΣΑΛΟΓΡΟΜΙΑ 2007 ΓΙΑ ΣΟ ΓΤΜΝΑΙΟ Παπασκευή 26 Ιανουαπίου 2007 Σάξη: Α Γυμνασίου ΥΟΛΕΙΟ..

ΚΤΠΡΙΑΚΗ ΜΑΘΗΜΑΣΙΚΗ ΕΣΑΙΡΕΙΑ ΜΑΘΗΜΑΣΙΚΗ ΚΤΣΑΛΟΓΡΟΜΙΑ 2007 ΓΙΑ ΣΟ ΓΤΜΝΑΙΟ Παπασκευή 26 Ιανουαπίου 2007 Σάξη: Α Γυμνασίου ΥΟΛΕΙΟ.. ΜΑΘΗΜΑΣΙΚΗ ΚΤΣΑΛΟΓΡΟΜΙΑ 2007 ΓΙΑ ΣΟ ΓΤΜΝΑΙΟ Παπασκευή 26 Ιανουαπίου 2007 Σάξη: Α Γυμνασίου έλαξμεο 09.30 ιήμεο 09.45 Σην παξαθάησ ζρήκα θαίλεηαη ηκήκα ελόο πνιενδνκηθνύ ζρεδίνπ κηαο πόιεο. Οη ζθηαζκέλεο

Διαβάστε περισσότερα

iii. iv. γηα ηελ νπνία ηζρύνπλ: f (1) 2 θαη

iii. iv. γηα ηελ νπνία ηζρύνπλ: f (1) 2 θαη ΔΠΑΝΑΛΗΠΣΙΚΑ ΘΔΜΑΣΑ ΣΟ ΓΙΑΦΟΡΙΚΟ ΛΟΓΙΜΟ Μάρτιος 0 ΘΔΜΑ Να ππνινγίζεηε ηα όξηα: i ii lim 0 0 lim iii iv lim e 0 lim e 0 ΘΔΜΑ Γίλεηαη ε άξηηα ζπλάξηεζε '( ) ( ) γηα θάζε 0 * : R R γηα ηελ νπνία ηζρύνπλ:

Διαβάστε περισσότερα

Α Ο Κ Η Α Μ Α Ζ Η Η Ρ Η ( S E A R C H )

Α Ο Κ Η Α Μ Α Ζ Η Η Ρ Η ( S E A R C H ) Ξ G O O G L E S C H O L A R Α Ο Ξ Ε Κ Ε Θ Λ Θ Α Λ Η Τ Α Μ Η Α Μ Α Ζ Η Η Ρ Η Ρ Οξαγκαηνπνηώληαο αλαδήηεζε ζην GoogleScholar (http://scholar.google.com/) ν ρξήζηεο κπνξεί λα εληνπίζεη πιηθό αθαδεκαϊθνύ θαη

Διαβάστε περισσότερα

ΑΠΑΝΤΗΣΔΙΣ ΓΙΚΤΥΑ ΥΠΟΛΟΓΙΣΤΩΝ II ΔΠΑΛ

ΑΠΑΝΤΗΣΔΙΣ ΓΙΚΤΥΑ ΥΠΟΛΟΓΙΣΤΩΝ II ΔΠΑΛ ΑΠΑΝΤΗΣΔΙΣ ΓΙΚΤΥΑ ΥΠΟΛΟΓΙΣΤΩΝ II ΔΠΑΛ ΘΔΜΑ Α Α1. α. Σ β. Σ γ. Λ δ. Λ ε. Λ ζη. Σ Α2. Γ Α3. 1. γ 2. ε 3. δ 4. α Β1. ΘΔΜΑ Β Οη ηειηθνί ππνινγηζηέο παίξλνπλ απνθάζεηο δξνκνιόγεζεο κόλν γηα ηα δηθά ηνπο απηνδύλακα

Διαβάστε περισσότερα

Σημεία Ασύπματηρ Ππόσβασηρ (Hot-Spots)

Σημεία Ασύπματηρ Ππόσβασηρ (Hot-Spots) Σημεία Ασύπματηρ Ππόσβασηρ (Hot-Spots) 1.1 Σςνοπτική Πεπιγπαυή Hot Spots Σα ζεκεία αζύξκαηεο πξόζβαζεο πνπ επηιέρζεθαλ αλαθέξνληαη ζηνλ επόκελν πίλαθα θαη παξνπζηάδνληαη αλαιπηηθά ζηηο επόκελεο παξαγξάθνπο.

Διαβάστε περισσότερα

Α. Εηζαγσγή ηεο έλλνηαο ηεο ηξηγσλνκεηξηθήο εμίζσζεο κε αξρηθό παξάδεηγκα ηελ εκx = 2

Α. Εηζαγσγή ηεο έλλνηαο ηεο ηξηγσλνκεηξηθήο εμίζσζεο κε αξρηθό παξάδεηγκα ηελ εκx = 2 ΣΡΙΓΩΝΟΜΔΣΡΙΚΔ EΞΙΩΔΙ Πνηα παξαδείγκαηα εμηζώζεσλ ή θαη πξνβιεκάησλ πηζηεύεηαη όηη είλαη θαηάιιεια γηα ηελ επίιπζε ηνπο θαηά ηελ δηάξθεηα ηεο δηδαθηηθήο δηαδηθαζίαο κέζα ζηελ ηάμε; 1 ε ΓΙΓΑΚΣΙΚΗ ΩΡΑ Α.

Διαβάστε περισσότερα

ΑΠΛΟΠΟΙΗΗ ΛΟΓΙΚΩΝ ΤΝΑΡΣΗΕΩΝ ΜΕ ΠΙΝΑΚΕ KARNAUGH

ΑΠΛΟΠΟΙΗΗ ΛΟΓΙΚΩΝ ΤΝΑΡΣΗΕΩΝ ΜΕ ΠΙΝΑΚΕ KARNAUGH ΑΠΛΟΠΟΙΗΗ ΛΟΓΙΚΩΝ ΤΝΑΡΣΗΕΩΝ ΜΕ ΠΙΝΑΚΕ KRNUGH Γηα λα θάλνπκε απινπνίεζε κηαο ινγηθήο ζπλάξηεζεο κε πίλαθα (ή ράξηε) Karnaugh αθνινπζνύκε ηα παξαθάησ βήκαηα:. Η ινγηθή ζπλάξηεζε ζα πξέπεη λα είλαη ζε πιήξε

Διαβάστε περισσότερα

Διαηιμήζεις για Αιολικά Πάρκα. Κώδικες 28, 78 και 84

Διαηιμήζεις για Αιολικά Πάρκα. Κώδικες 28, 78 και 84 Διαηιμήζεις για Αιολικά Πάρκα Κώδικες 28, 78 και 84 Διαηιμήζεις για Αιολικά Πάρκα Οη Διαηιμήζεις για Αιολικά Πάρκα εθαξκόδνληαη γηα ηελ απνξξνθνύκελε ελέξγεηα από Αηνιηθά Πάξθα πνπ είλαη ζπλδεδεκέλα ζην

Διαβάστε περισσότερα

ΔΦΑΡΜΟΜΔΝΑ ΜΑΘΗΜΑΣΙΚΑ ΣΗ ΧΗΜΔΙΑ Ι ΘΔΜΑΣΑ Α επηέκβξηνο 2009. 1. Να ππνινγηζηνύλ νη κεξηθέο παξάγσγνη πξώηεο ηάμεο ηεο ζπλάξηεζεο f(x,y) =

ΔΦΑΡΜΟΜΔΝΑ ΜΑΘΗΜΑΣΙΚΑ ΣΗ ΧΗΜΔΙΑ Ι ΘΔΜΑΣΑ Α επηέκβξηνο 2009. 1. Να ππνινγηζηνύλ νη κεξηθέο παξάγσγνη πξώηεο ηάμεο ηεο ζπλάξηεζεο f(x,y) = ΘΔΜΑΣΑ Α επηέκβξηνο 9. Να ππνινγηζηνύλ νη κεξηθέο παξάγσγνη πξώηεο ηάμεο ηεο ζπλάξηεζεο f(,y) = y.. Να ππνινγηζηνύλ ηα νινθιεξώκαηα: a) ln b) a) 3cos b) e sin 4. Να ππνινγηζηεί ην νινθιήξσκα: S ( y) 3

Διαβάστε περισσότερα

Απνηειέζκαηα Εξσηεκαηνινγίνπ 2o ηεηξάκελν 2011-12

Απνηειέζκαηα Εξσηεκαηνινγίνπ 2o ηεηξάκελν 2011-12 Απνηειέζκαηα Εξσηεκαηνινγίνπ 2o ηεηξάκελν 11-12 Project 6: Ταμίδη κε ηε Μεραλή ηνπ Φξόλνπ Υπεύζπλνη Καζεγεηέο: Ε. Μπηιαλάθε Φ. Αλησλάηνο Δρώηηζη 3: Πνηα από ηα παξαθάησ ΜΜΕ ηεξαξρείηε από πιεπξάο ζεκαζίαο;

Διαβάστε περισσότερα

Άζκηζη ζτέζης κόζηοσς-τρόνοσ (Cost Time trade off) Καηαζκεσαζηική ΑΔ

Άζκηζη ζτέζης κόζηοσς-τρόνοσ (Cost Time trade off) Καηαζκεσαζηική ΑΔ Άζκηζη ζτέζης κόζηοσς-τρόνοσ (Cost Time trade off) Καηαζκεσαζηική Δίζηε μησανικόρ διοίκηζηρ μεγάληρ καηαζκεςαζηικήρ εηαιπείαρ και καλείζηε να ςλοποιήζεηε ηο έπγο πος πεπιγπάθεηαι από ηον Πίνακα 1. Κωδ.

Διαβάστε περισσότερα

Λεκηική έκθραζη, κριηική, οικειόηηηα και ηύπος δεζμού ζηις ζηενές διαπροζωπικές ζτέζεις

Λεκηική έκθραζη, κριηική, οικειόηηηα και ηύπος δεζμού ζηις ζηενές διαπροζωπικές ζτέζεις Λεκηική έκθραζη, κριηική, οικειόηηηα και ηύπος δεζμού ζηις ζηενές διαπροζωπικές ζτέζεις Μαξία-Ησάλλα Αξγπξνπνύινπ Βαζίιεο Παπιόπνπινο Τνκέαο Ψπρνινγίαο, Παλεπηζηήκην Αζελώλ Αλαθνίλσζε ζην 5 ν Παλειιήλην

Διαβάστε περισσότερα

ΚΤΠΡΙΑΚΗ ΜΑΘΗΜΑΣΙΚΗ ΕΣΑΙΡΕΙΑ ΜΑΘΗΜΑΤΙΚΗ ΣΚΥΤΑΛΟΓΡΟΜΙΑ 2015 ΓΙΑ ΤΟ ΓΥΜΝΑΣΙΟ Τεηάπηη 28 Ιανουαπίου 2015 ΛΔΥΚΩΣΙΑ Τάξη: Α Γυμναζίου

ΚΤΠΡΙΑΚΗ ΜΑΘΗΜΑΣΙΚΗ ΕΣΑΙΡΕΙΑ ΜΑΘΗΜΑΤΙΚΗ ΣΚΥΤΑΛΟΓΡΟΜΙΑ 2015 ΓΙΑ ΤΟ ΓΥΜΝΑΣΙΟ Τεηάπηη 28 Ιανουαπίου 2015 ΛΔΥΚΩΣΙΑ Τάξη: Α Γυμναζίου ΚΤΠΡΙΑΚΗ ΜΑΘΗΜΑΣΙΚΗ ΕΣΑΙΡΕΙΑ ΜΑΘΗΜΑΤΙΚΗ ΣΚΥΤΑΛΟΓΡΟΜΙΑ 2015 ΓΙΑ ΤΟ ΓΥΜΝΑΣΙΟ Τεηάπηη 28 Ιανουαπίου 2015 ΛΔΥΚΩΣΙΑ Τάξη: Α Γυμναζίου ΠΡΟΒΛΗΜΑ Σε έλα ηνπξλνπά βόιετ δήισζαλ ζπκκεηνρή νκάδεο Γπκλαζίσλ ηεο Κύπξνπ.

Διαβάστε περισσότερα

Αζθήζεηο 5 νπ θεθαιαίνπ Crash course Step by step training. Dipl.Biol.cand.med. Stylianos Kalaitzis

Αζθήζεηο 5 νπ θεθαιαίνπ Crash course Step by step training. Dipl.Biol.cand.med. Stylianos Kalaitzis Αζθήζεηο 5 νπ θεθαιαίνπ Crash course Step by step training Dipl.Biol.cand.med. Stylianos Kalaitzis Stylianos Kalaitzis Μνλνϋβξηδηζκνο 1 Γπν γνλείο, εηεξόδπγνη γηα ηνλ αιθηζκό θάλνπλ παηδηά. Πνία ε πηζαλόηεηα

Διαβάστε περισσότερα

Κεθάλαιο 1. Ενόηηηα 2 Πλάνο Μάρκεηινγκ. Εξγαιεία Μάξθεηηλγθ. Dr. Andrea Grimm Dr. Astin Malschinger

Κεθάλαιο 1. Ενόηηηα 2 Πλάνο Μάρκεηινγκ. Εξγαιεία Μάξθεηηλγθ. Dr. Andrea Grimm Dr. Astin Malschinger Κεθάλαιο 1 Ενόηηηα 2 Πλάνο Μάρκεηινγκ Εξγαιεία Μάξθεηηλγθ Dr. Andrea Grimm Dr. Astin Malschinger ΠΕΡΙΕΧΟΜΕΝΑ ΕΝΟΤΗΤΑ 2 ΠΛΑΝΟ ΜΑΡΚΕΤΙΝΓΚ Κεθάιαην 1: Εξγαιεία Μάξθεηηλγθ Σπγγξαθείο: Δξ. Andrea Grimm, Δξ.

Διαβάστε περισσότερα

Μονοψϊνιο. Αγνξά κε ιίγνπο αγνξαζηέο. Δύναμη μονοψωνίος Η ηθαλόηεηα πνπ έρεη ν αγνξαζηήο λα επεξεάζεη ηελ ηηκή ηνπ αγαζνύ.

Μονοψϊνιο. Αγνξά κε ιίγνπο αγνξαζηέο. Δύναμη μονοψωνίος Η ηθαλόηεηα πνπ έρεη ν αγνξαζηήο λα επεξεάζεη ηελ ηηκή ηνπ αγαζνύ. Μονοψϊνιο Ολιγοψώνιο Αγνξά κε ιίγνπο αγνξαζηέο. Δύναμη μονοψωνίος Η ηθαλόηεηα πνπ έρεη ν αγνξαζηήο λα επεξεάζεη ηελ ηηκή ηνπ αγαζνύ. Οπιακή αξία Δπηπξόζζεηα νθέιε από ηελ ρξήζε/θαηαλάισζε κηαο επηπξόζζεηε

Διαβάστε περισσότερα

ΔΕΟ 13. Ποσοτικές Μέθοδοι. θαη λα ππνινγίζεηε ην θόζηνο γηα 10000 παξαγόκελα πξντόληα. Να ζρεδηαζηεί γηα εύξνο πξντόλησλ έσο 30000.

ΔΕΟ 13. Ποσοτικές Μέθοδοι. θαη λα ππνινγίζεηε ην θόζηνο γηα 10000 παξαγόκελα πξντόληα. Να ζρεδηαζηεί γηα εύξνο πξντόλησλ έσο 30000. ΔΕΟ 13 Ποσοτικές Μέθοδοι Σσνάρηηζη Κόζηοσς C(), μέζο κόζηος C()/. Παράδειγμα 1 Μηα εηαηξεία δαπαλά γηα θάζε πξντόλ Α πνπ παξάγεη 0.0 λ.κ. Τα πάγηα έμνδα ηεο εηαηξείαο είλαη 800 λ.κ. Ζεηείηαη 1) Να πεξηγξάςεηε

Διαβάστε περισσότερα

ΠΑΡΑΡΣΗΜΑ Δ. ΔΤΡΔΗ ΣΟΤ ΜΔΣΑΥΗΜΑΣΙΜΟΤ FOURIER ΓΙΑΦΟΡΩΝ ΗΜΑΣΩΝ

ΠΑΡΑΡΣΗΜΑ Δ. ΔΤΡΔΗ ΣΟΤ ΜΔΣΑΥΗΜΑΣΙΜΟΤ FOURIER ΓΙΑΦΟΡΩΝ ΗΜΑΣΩΝ ΠΑΡΑΡΣΗΜΑ Δ. ΔΤΡΔΗ ΣΟΤ ΜΔΣΑΥΗΜΑΣΙΜΟΤ FOURIER ΓΙΑΦΟΡΩΝ ΗΜΑΣΩΝ Εδώ ζα ππνινγίζνπκε ην κεηαζρεκαηηζκό Fourier κεξηθώλ αθόκα ζεκάησλ, πξνζπαζώληαο λα μεθηλήζνπκε από ην κεηαζρεκαηηζκό Fourier γλσζηώλ ζεκάησλ

Διαβάστε περισσότερα

ΔΓΤ Μεηαπηπρηαθφ Πξφγξακκα «Γηνίθεζε Τπεξεζηψλ Τγείαο» - 177 --

ΔΓΤ Μεηαπηπρηαθφ Πξφγξακκα «Γηνίθεζε Τπεξεζηψλ Τγείαο» - 177 -- ΔΓΤ Μεηαπηπρηαθφ Πξφγξακκα «Γηνίθεζε Τπεξεζηψλ Τγείαο» - 177 -- 5. Σίηινο καζήκαηνο Δηζαγσγή ζηα παθέηα Λνγηζκηθνχ 6. Τπεχζπλνο καζήκαηνο Ησάλλεο Απνζηνιάθεο 7. θνπφο θνπφο ηνπ καζήκαηνο είλαη ε εμνηθείσζε

Διαβάστε περισσότερα

Δξγαιεία Καηαζθεπέο 1 Σάμε Σ Δ.Κ.Φ.Δ. ΥΑΝΙΧΝ ΠΡΧΣΟΒΑΘΜΙΑ ΔΚΠΑΙΓΔΤΗ. ΔΝΟΣΗΣΑ 11 ε : ΦΧ ΔΡΓΑΛΔΙΑ ΚΑΣΑΚΔΤΔ. Καηαζθεπή 1: Φαθόο κε ζσιήλα.

Δξγαιεία Καηαζθεπέο 1 Σάμε Σ Δ.Κ.Φ.Δ. ΥΑΝΙΧΝ ΠΡΧΣΟΒΑΘΜΙΑ ΔΚΠΑΙΓΔΤΗ. ΔΝΟΣΗΣΑ 11 ε : ΦΧ ΔΡΓΑΛΔΙΑ ΚΑΣΑΚΔΤΔ. Καηαζθεπή 1: Φαθόο κε ζσιήλα. Δξγαιεία Καηαζθεπέο 1 Δ.Κ.Φ.Δ. ΥΑΝΙΧΝ ΠΡΧΣΟΒΑΘΜΙΑ ΔΚΠΑΙΓΔΤΗ ΔΝΟΣΗΣΑ 11 ε : ΦΧ ΔΡΓΑΛΔΙΑ ΚΑΣΑΚΔΤΔ Καηαζθεπή 1: Φαθόο κε ζσιήλα Γηαθξάγκαηα Δξγαιεία Καηαζθεπέο 2 Η θαηαζθεπή πεξηγξάθεηαη ζηελ αληίζηνηρε ελόηεηα

Διαβάστε περισσότερα

Σύνθεζη ηαλανηώζεων. Έζησ έλα ζώκα πνπ εθηειεί ηαπηόρξνλα δύν αξκνληθέο ηαιαληώζεηο ηεο ίδηαο ζπρλόηεηαο πνπ πεξηγξάθνληαη από ηηο παξαθάησ εμηζώζεηο:

Σύνθεζη ηαλανηώζεων. Έζησ έλα ζώκα πνπ εθηειεί ηαπηόρξνλα δύν αξκνληθέο ηαιαληώζεηο ηεο ίδηαο ζπρλόηεηαο πνπ πεξηγξάθνληαη από ηηο παξαθάησ εμηζώζεηο: Σύνθεζη ηαλανηώζεων Α. Σύλζεζε δύν α.α.η ηεο ίδιας ζστνόηηηας Έζησ έλα ζώκα πνπ εθηειεί ηαπηόρξνλα δύν αξκνληθέο ηαιαληώζεηο ηεο ίδηαο ζπρλόηεηαο πνπ πεξηγξάθνληαη από ηηο παξαθάησ εμηζώζεηο: Η απνκάθξπλζε

Διαβάστε περισσότερα

Εισαγωγή στοςρ κβαντικούρ ςπολογιστέρ και αλγόπιθμοςρ. Γηδάζθωλ : Φνπληνπιάθεο Αληώληνο

Εισαγωγή στοςρ κβαντικούρ ςπολογιστέρ και αλγόπιθμοςρ. Γηδάζθωλ : Φνπληνπιάθεο Αληώληνο Εισαγωγή στοςρ κβαντικούρ ςπολογιστέρ και αλγόπιθμοςρ. Γηδάζθωλ : Φνπληνπιάθεο Αληώληνο Θεματικές Ενότητες 1. Απιέο έλλνηεο θβαληηθήο κεραληθήο θαη ην ζύζηεκα δύν θβαληηθώλ θαηαζηάζεωλ. 2. Qubit θαη θβαληηθόο

Διαβάστε περισσότερα

ΠΡΩΣΟΚΟΛΛΑ ΓΙΑΥΔΙΡΗΗ ΣΩΝ ΣΔΡΗΓΟΝΙΚΩΝ ΒΛΑΒΩΝ Δ ΔΝΗΛΙΚΔ

ΠΡΩΣΟΚΟΛΛΑ ΓΙΑΥΔΙΡΗΗ ΣΩΝ ΣΔΡΗΓΟΝΙΚΩΝ ΒΛΑΒΩΝ Δ ΔΝΗΛΙΚΔ ΠΡΩΣΟΚΟΛΛΑ ΓΙΑΥΔΙΡΗΗ ΣΩΝ ΣΔΡΗΓΟΝΙΚΩΝ ΒΛΑΒΩΝ Δ ΔΝΗΛΙΚΔ Σν ζύγρξνλν πξόηππν αληηκεηώπηζεο ηεο ηεξεδόλαο ελειίθσλ δελ εζηηάδεηαη κόλν ζηελ απνθαηάζηαζε ησλ ηεξεδνληθώλ βιαβώλ πνπ έρνπλ εθδεισζεί, αιιά έρεη

Διαβάστε περισσότερα

Κόληξα πιαθέ ζαιάζζεο κε δηαζηάζεηο 40Υ40 εθ. Καξθηά 3 θηιά πεξίπνπ κε κήθνο ηξηπιάζην από ην πάρνο ηνπ μύινπ θπξί κεγάιν θαη ππνκνλή

Κόληξα πιαθέ ζαιάζζεο κε δηαζηάζεηο 40Υ40 εθ. Καξθηά 3 θηιά πεξίπνπ κε κήθνο ηξηπιάζην από ην πάρνο ηνπ μύινπ θπξί κεγάιν θαη ππνκνλή Δξγαιεία Καηαζθεπέο 1 Δ.Κ.Φ.Δ. ΥΑΝΙΩΝ ΠΡΩΣΟΒΑΘΜΙΑ ΔΚΠΑΙΓΔΤΗ ΔΝΟΣΗΣΑ 10 ε : ΜΗΥΑΝΙΚΗ ΜΔΡΟ Β ΠΙΔΗ ΔΡΓΑΛΔΙΑ ΚΑΣΑΚΔΤΔ Καηαζθεπή 1: Καξέθια θαθίξε Όξγαλα Τιηθά Κόληξα πιαθέ ζαιάζζεο κε δηαζηάζεηο 40Υ40 εθ.

Διαβάστε περισσότερα

ΕΡΓΑΣΤΗΡΙΑΚΗ ΑΣΚΗΣΗ 4 ΣΥΝΔΥΑΣΤΙΚΑ ΚΥΚΛΩΜΑΤΑ

ΕΡΓΑΣΤΗΡΙΑΚΗ ΑΣΚΗΣΗ 4 ΣΥΝΔΥΑΣΤΙΚΑ ΚΥΚΛΩΜΑΤΑ ΕΡΓΑΣΤΗΡΙΑΚΗ ΑΣΚΗΣΗ 4 ΣΥΝΔΥΑΣΤΙΚΑ ΚΥΚΛΩΜΑΤΑ 1. ρεδίαζε πλδπαζηηθνύ Κπθιώκαηνο Έλα ζπλδπαζηηθό θύθισκα (Κ) έρεη ηξεηο εηζόδνπο A, B θαη C θαη κία έμνδν Y Y=A B+AC Να θαηαζθεπάζεηε ην ράξηε Karnaugh. B 0

Διαβάστε περισσότερα

ΘΔΚΑ ΡΖΠ ΑΛΑΓΛΩΟΗΠΖΠ

ΘΔΚΑ ΡΖΠ ΑΛΑΓΛΩΟΗΠΖΠ ΘΔΚΑ ΡΖΠ ΑΛΑΓΛΩΟΗΠΖΠ 1.Απηόο πνπ ζα αλαγλσξηζηεί απνπζηάδεη γηα πνιύ θαηξό. 2.Δπηζηξέθεη κε πιαζηή ηαπηόηεηα ή κεηακνξθσκέλνο. 3.Απνκνλώλνληαη ηα δύν πξόζσπα 4.Άξζε κεηακόξθσζεο 5.Απνθάιπςε 6.Ακθηβνιίεο-απνδεηθηηθά

Διαβάστε περισσότερα

ΑΝΤΗΛΙΑΚΑ. Η Μηκή ζθέθηεθε έλαλ ηξόπν, γηα λα ζπγθξίλεη κεξηθά δηαθνξεηηθά αληειηαθά πξντόληα. Απηή θαη ν Νηίλνο ζπλέιεμαλ ηα αθόινπζα πιηθά:

ΑΝΤΗΛΙΑΚΑ. Η Μηκή ζθέθηεθε έλαλ ηξόπν, γηα λα ζπγθξίλεη κεξηθά δηαθνξεηηθά αληειηαθά πξντόληα. Απηή θαη ν Νηίλνο ζπλέιεμαλ ηα αθόινπζα πιηθά: ΑΝΤΗΛΙΑΚΑ Η Μηκή θαη ν Νηίλνο αλαξσηήζεθαλ πνην αληειηαθό πξντόλ παξέρεη ηελ θαιύηεξε πξνζηαζία ζην δέξκα ηνπο. Τα αληειηαθά πξντόληα έρνπλ έλα δείθηε αληειηαθήο πξνζηαζίαο (SPF), ν νπνίνο δείρλεη πόζν

Διαβάστε περισσότερα

Hellas online Προεπιλεγμένες ρσθμίσεις για FritzBox Fon WLAN 7140 (Annex B) 30.04.67 FritzBox Fon WLAN 7140 - Annex B (30.04.67)

Hellas online Προεπιλεγμένες ρσθμίσεις για FritzBox Fon WLAN 7140 (Annex B) 30.04.67 FritzBox Fon WLAN 7140 - Annex B (30.04.67) Hellas online Προεπιλεγμένες ρσθμίσεις για FritzBox Fon WLAN 7140 (Annex B) 30.04.67 FritzBox Fon WLAN 7140 - Annex B (30.04.67) Γηα λα επαλαθέξεηε ην FritzBox Fon WLAN 7140 ζηηο πξνεπηιεγκέλεο ηνπ ξπζκίζεηο

Διαβάστε περισσότερα

ΔΠΛ 450 ΤΠΟΛΟΓΙΣΙΚΗ ΒΙΟΛΟΓΙΑ. Ευκυγράμμιςθ Δφο Ακολουκιών Πίνακεσ αντικατάςταςθσ

ΔΠΛ 450 ΤΠΟΛΟΓΙΣΙΚΗ ΒΙΟΛΟΓΙΑ. Ευκυγράμμιςθ Δφο Ακολουκιών Πίνακεσ αντικατάςταςθσ 1 ΔΠΛ 450 ΤΠΟΛΟΓΙΣΙΚΗ ΒΙΟΛΟΓΙΑ Ευκυγράμμιςθ Δφο Ακολουκιών Πίνακεσ αντικατάςταςθσ 2 Δσθσγοάμμιρη ακξλξσθιώμ Γπλακηθόο πξνγξακκαηηζκόο : κέζνδνο επζπγξάκκηζεο αθνινπζηώλ DNA θαη πξσηετληθώλ αθνινπζηώλ.

Διαβάστε περισσότερα

Μεηαπηςσιακό Ππόγπαμμα Σποςδών ζηην Δθαπμοζμένη Πληποθοπική

Μεηαπηςσιακό Ππόγπαμμα Σποςδών ζηην Δθαπμοζμένη Πληποθοπική Μεηαπηςσιακό Ππόγπαμμα Σποςδών ζηην Δθαπμοζμένη Πληποθοπική Δθαπμογή Αλγοπίθμυν ακέπαιος και γπαμμικού ππογπαμμαηιζμού ζηη Βιοπληποθοπική. Γιπλυμαηική Δπγαζία Δπιβλέπυν Καθηγηηήρ: Σαμαπάρ Νικόλαορ. Δπιμέλεια

Διαβάστε περισσότερα

Δξγαιεία Καηαζθεπέο 1 Σάμε Δ Δ.Κ.Φ.Δ. ΥΑΝΗΩΝ ΠΡΩΣΟΒΑΘΜΗΑ ΔΚΠΑΗΓΔΤΖ. ΔΝΟΣΖΣΑ 2 ε : ΤΛΗΚΑ ΩΜΑΣΑ ΔΡΓΑΛΔΗΑ ΚΑΣΑΚΔΤΔ. Καηαζθεπή 1: Ογθνκεηξηθό δνρείν

Δξγαιεία Καηαζθεπέο 1 Σάμε Δ Δ.Κ.Φ.Δ. ΥΑΝΗΩΝ ΠΡΩΣΟΒΑΘΜΗΑ ΔΚΠΑΗΓΔΤΖ. ΔΝΟΣΖΣΑ 2 ε : ΤΛΗΚΑ ΩΜΑΣΑ ΔΡΓΑΛΔΗΑ ΚΑΣΑΚΔΤΔ. Καηαζθεπή 1: Ογθνκεηξηθό δνρείν Δξγαιεία Καηαζθεπέο 1 Δ.Κ.Φ.Δ. ΥΑΝΗΩΝ ΠΡΩΣΟΒΑΘΜΗΑ ΔΚΠΑΗΓΔΤΖ ΔΝΟΣΖΣΑ 2 ε : ΤΛΗΚΑ ΩΜΑΣΑ ΔΡΓΑΛΔΗΑ ΚΑΣΑΚΔΤΔ Καηαζθεπή 1: Ογθνκεηξηθό δνρείν Καηαζθεπάδνπκε έλα νγθνκεηξηθό δνρείν από πιαζηηθό κπνπθάιη λεξνύ

Διαβάστε περισσότερα

ΣΡΑΠΕΖΑ ΘΕΜΑΣΩΝ Α ΛΤΚΕΙΟΤ

ΣΡΑΠΕΖΑ ΘΕΜΑΣΩΝ Α ΛΤΚΕΙΟΤ Α/Α : 0_1379/50 1. Όηαλ ινηπόλ ήξζαλ [νη πξέζβεηο ζηελ Αζήλα], αθνύ ζπλέιαβαλ νη Αζελαίνη θαη ηνπο πξέζβεηο σο ππνθηλεηέο ζηάζεο θαη όζνπο έπεηζαλ [νη πξέζβεηο], ηνπο ζπγθέληξσζαλ γηα αζθάιεηα ζηελ Αίγηλα.

Διαβάστε περισσότερα

Διατείριση Φσσικών Καταστρουών: ACTIVE LANDSLIDE INVENTORY MAPPING AND SUSCEPTIBILITY ZONING

Διατείριση Φσσικών Καταστρουών: ACTIVE LANDSLIDE INVENTORY MAPPING AND SUSCEPTIBILITY ZONING Διατείριση Φσσικών Καταστρουών: ACTIVE LANDSLIDE INVENTORY MAPPING AND SUSCEPTIBILITY ZONING Ναηαιία Σπαλνύ, spanou@igme.gr & natspanou@gmail.com Τερληθόο Γεσιόγνο (M.Sc.) Πεξηγξαθή Χάξηεο ρσξηθήο θαηαλνκήο

Διαβάστε περισσότερα

Μορθές Κακόβοσλοσ Κώδικα (Malicious Code)

Μορθές Κακόβοσλοσ Κώδικα (Malicious Code) Μορθές Κακόβοσλοσ Κώδικα (Malicious Code) Page 1 Υποπλοίαρτος Ν. Πεηράκος ΠΝ Αηδένηα Γνύξεηνη Ίππνη (Trojan Horses) Ινί (Viruses) Worms Root-kit Page 2 Γνύξεηνο Ίππνο (Trojan Horse) Οξηζκόο: Πξόγξακκα

Διαβάστε περισσότερα

Οδηγίες τρήζης για λειηοσργία μεηαθοράς καναλιών ζε υηθιακό δέκηη OST-7060 HD

Οδηγίες τρήζης για λειηοσργία μεηαθοράς καναλιών ζε υηθιακό δέκηη OST-7060 HD Οδηγίες τρήζης για λειηοσργία μεηαθοράς καναλιών ζε υηθιακό δέκηη OST-7060 HD Γηα ηε δηεπθόιπλζή ζαο θαηά ην switch-off ηεο πεξηνρήο ηεο Πεινπνλλήζνπ έρνπκε πξνζζέζεη ζηνπο ςεθηαθνύο καο δέθηεο κία λέα,

Διαβάστε περισσότερα

γηα ηνλ Άξε Κσλζηαληηλίδε

γηα ηνλ Άξε Κσλζηαληηλίδε γηα ηνλ Άξε Κσλζηαληηλίδε γηα «ην θνηλό θαη ην θύξην» (Γ.νισκόο) γηα λα ρηίδω πάληα κε ηνλ ίδηνλε ηξόπν, κε ηηο ίδηεο θαηαζθεπαζηηθέο θαη πιαζηηθέο πξννπηηθέο, κε ηελ ίδηαλε πάληνηε πίζηε θαη αγάπε.. Α.Κ.

Διαβάστε περισσότερα

Τηλζφωνο: 99543321 Ε-mail: savvas_email@yahoo.com Ώρες διδασκαλίας: 16:00 19:15 μμ

Τηλζφωνο: 99543321 Ε-mail: savvas_email@yahoo.com Ώρες διδασκαλίας: 16:00 19:15 μμ ΠΑΙΓΑΓΩΓΙΚΟ ΙΝΣΙΣΟΤΣΟ ΚΤΠΡΟΤ Πξόγξακκα Δπηκόξθσζεο Τπνςεθίσλ Καζεγεηώλ Σερλνινγίαο Γελάξεο 2011 ΗΛΔΚΣΡΟΝΙΚΑ Ι (Ύιε Γπκλαζίνπ) Διδάσκων: Σαββίδης Σάββας Τηλζφωνο: 99543321 Ε-mail: savvas_email@yahoo.com

Διαβάστε περισσότερα

Master Class 3. Ο Ν.Ζανταρίδης προτείνει θέματα Μαθηματικών Γ Λσκειοσ ΘΕΜΑ 1.

Master Class 3. Ο Ν.Ζανταρίδης προτείνει θέματα Μαθηματικών Γ Λσκειοσ ΘΕΜΑ 1. ΘΕΜΑ. Γηα ηελ ζπλάξηεζε f : IR IR ηζρύεη + f() f(- ) = γηα θάζε IR. Να δείμεηε όηη f() =, ΙR. Να βξείηε ηελ εθαπηόκελε (ε) ηεο C f πνπ δηέξρεηαη από ην ζεκείν (-,-) 3. Να βξείηε ην εκβαδόλ Δ(α) ηνπ ρωξίνπ

Διαβάστε περισσότερα

ΕΝΤΟΛΕΣ WINDOWS ΚΑΙ UNIX

ΕΝΤΟΛΕΣ WINDOWS ΚΑΙ UNIX ΕΝΤΟΛΕΣ WINDOWS ΚΑΙ UNIX Σηότοι εργαζηηρίοσ Σην πιαίζην ηνπ ζπγθεθξηκέλνπ εξγαζηεξίνπ, νη θνηηεηέο ζα εμνηθεησζνύλ κε βαζηθέο εληνιέο δηθηπαθώλ πξσηνθόιισλ νη νπνίεο βξίζθνπλ εθαξκνγή ζε πεξηβάιινληα Windows

Διαβάστε περισσότερα

ΑΙΟΛΙΚΑ ΠΑΡΚΑ. Δρώτηση 1

ΑΙΟΛΙΚΑ ΠΑΡΚΑ. Δρώτηση 1 ΑΙΟΛΙΚΑ ΠΑΡΚΑ Πνιινί άλζξσπνη πηζηεύνπλ όηη ν άλεκνο ζα έπξεπε λα αληηθαηαζηήζεη ην πεηξέιαην θαη ην θάξβνπλν σο πεγή ελέξγεηαο γηα ηελ παξαγσγή ειεθηξηζκνύ. Οη θαηαζθεπέο πνπ θαίλνληαη ζηελ εηθόλα είλαη

Διαβάστε περισσότερα

Η απνξξόθεζε ηνπ νξαηνύ θσηόο γίλεηαη κέζσ ρξσζηηθώλ νπζηώλ πνπ νλνκάδνληαη τλωροθύλλες.

Η απνξξόθεζε ηνπ νξαηνύ θσηόο γίλεηαη κέζσ ρξσζηηθώλ νπζηώλ πνπ νλνκάδνληαη τλωροθύλλες. ΦΩΣΟΤΝΘΔΗ Δλαιιαθηηθή δηεξγαζία παξαγσγήο ελέξγεηαο Υξεζηκνπνηείηαη από ηνπο νλνκαδόκελνπο θσηνζπλζεηηθνύο νξγαληζκνύο Οπζηαζηηθά ε αληίζηξνθε δηεξγαζία ηεο αλαπλνήο πλίζηαηαη ζηελ δέζκεπζε ειηαθήο ελέξγεηαο

Διαβάστε περισσότερα

Γραφεύα Επικοινωνύασ & Ενημϋρωςησ ϋρρεσ, Τψηλϊντου 4 3οσ Όροφοσ ΣΗΛ 2321023640 ΥΑΦ 2321051861

Γραφεύα Επικοινωνύασ & Ενημϋρωςησ ϋρρεσ, Τψηλϊντου 4 3οσ Όροφοσ ΣΗΛ 2321023640 ΥΑΦ 2321051861 Οπγάνωζη και διοίκηζη ηοςπιζηικών επισειπήζεων (ξενοδοσεία, ηοςπιζηικά γπαθεία ) Α) ΑΔΙ ΣΔΙ και Β) ΑΠΟΦΟΙΣΟΙ ΤΠΟΥΡΔΩΣΙΚΗ ΓΔΤΣΔΡΟΒΑΘΜΙΑ και ΜΔΣΑΓΔΤΣΔΡΟΒΑΘΜΙΑ ΔΚΠΑΙΓΔΤΗ Ρν πξόγξακκα απηό ζρεδηάζηεθε γηα

Διαβάστε περισσότερα

Παιχνίδι γλωζζικής καηανόηζης με ζχήμαηα!

Παιχνίδι γλωζζικής καηανόηζης με ζχήμαηα! Cpyright 2013 Λόγος & Επικοινωνία // All rights Reserved Παιχνίδι γλωζζικής καηανόηζης με ζχήμαηα! Αυηό ηο παιχνίδι έχει ζηόχους: 1. ηελ εθγύκλαζε ηεο αθνπζηηθήο κλήκεο ησλ παηδηώλ 2. ηελ εμάζθεζε ζηελ

Διαβάστε περισσότερα

IV Ο ΕΛΛΗΝΙΜΟ ΣΗ ΔΤΗ,ΠΟΛΙΣΙΜΟΙ Δ.ΜΕΟΓΕΙΟΤ ΚΑΙ ΡΩΜΗ

IV Ο ΕΛΛΗΝΙΜΟ ΣΗ ΔΤΗ,ΠΟΛΙΣΙΜΟΙ Δ.ΜΕΟΓΕΙΟΤ ΚΑΙ ΡΩΜΗ IV Ο ΕΛΛΗΝΙΜΟ ΣΗ ΔΤΗ,ΠΟΛΙΣΙΜΟΙ Δ.ΜΕΟΓΕΙΟΤ ΚΑΙ ΡΩΜΗ Να σαπακηηπίζεηε ηιρ πποηάζειρ, πος ακολοςθούν, υρ ππορ ηην οπθόηηηά ηοςρ, με ηην ένδειξη Σωστό ή Λάθος 1. ηελ αξραία Ρώκε νη πιεβείνη δελ είραλ αξρηθά

Διαβάστε περισσότερα

ΔΝΓΔΙΚΤΙΚΔΣ ΛΥΣΔΙΣ ΣΤΑ ΜΑΘΗΜΑΤΙΚΑ ΚΑΤΔΥΘΥΝΣΗΣ Γ ΛΥΚΔΙΟΥ ΓΔΥΤΔΡΑ 27 ΜΑΪΟΥ 2013

ΔΝΓΔΙΚΤΙΚΔΣ ΛΥΣΔΙΣ ΣΤΑ ΜΑΘΗΜΑΤΙΚΑ ΚΑΤΔΥΘΥΝΣΗΣ Γ ΛΥΚΔΙΟΥ ΓΔΥΤΔΡΑ 27 ΜΑΪΟΥ 2013 ΔΝΓΔΙΚΤΙΚΔΣ ΛΥΣΔΙΣ ΣΤΑ ΜΑΘΗΜΑΤΙΚΑ ΚΑΤΔΥΘΥΝΣΗΣ Γ ΛΥΚΔΙΟΥ ΓΔΥΤΔΡΑ 7 ΜΑΪΟΥ 13 ΘΔΜΑ Α : (Α1) Σρνιηθό βηβιίν ζειίδα 33-335 (Α) Σρνιηθό βηβιίν ζειίδα 6 (Α3) Σρνιηθό βηβιίν ζειίδα (Α) α) Λάζνο β) Σωζηό γ) Σωζηό

Διαβάστε περισσότερα

ΤΑΞΙΝΟΜΗΣΗ ΤΩΝ ΤΔΡΗΓΟΝΙΚΩΝ ΒΛΑΒΩΝ ΚΑΤΑ ΤΑ ICDAS II ΚΡΙΤΗΡΙΑ ΜΔ ΒΑΣΗ ΤΗ ΚΛΙΝΙΚΗ ΔΞΔΤΑΣΗ

ΤΑΞΙΝΟΜΗΣΗ ΤΩΝ ΤΔΡΗΓΟΝΙΚΩΝ ΒΛΑΒΩΝ ΚΑΤΑ ΤΑ ICDAS II ΚΡΙΤΗΡΙΑ ΜΔ ΒΑΣΗ ΤΗ ΚΛΙΝΙΚΗ ΔΞΔΤΑΣΗ ΤΑΞΙΝΟΜΗΣΗ ΤΩΝ ΤΔΡΗΓΟΝΙΚΩΝ ΒΛΑΒΩΝ ΚΑΤΑ ΤΑ ICDAS II ΚΡΙΤΗΡΙΑ ΜΔ ΒΑΣΗ ΤΗ ΚΛΙΝΙΚΗ ΔΞΔΤΑΣΗ Κιηληθή ηαμηλόκεζε ηνπ βαζκνύ ηεξεδνληθήο βιάβεο ηωλ νπώλ θαη ζρηζκώλ καζεηηθώλ επηθαλεηώλ θαηά ICDAS 1 νο Βαζκόο

Διαβάστε περισσότερα

ΣΡΑΠΕΖΑ ΘΕΜΑΣΩΝ Α ΛΤΚΕΙΟΤ

ΣΡΑΠΕΖΑ ΘΕΜΑΣΩΝ Α ΛΤΚΕΙΟΤ ΜΑΘΗΜΑ : ΑΡΧΑΙΑ ΕΛΛΗΝΙΚΑ ΣΡΑΠΕΖΑ ΘΕΜΑΣΩΝ Α ΛΤΚΕΙΟΤ Α/Α : 0_1382/153 1. Καη όηαλ έγηλε ε ππνρώξεζε αξγά ην απόγεπκα, επεηδή θνβήζεθαλ νη νιηγαξρηθνί κήπσο νη δεκνθξαηηθνί, αθνύ θάλνπλ επίζεζε, θαηαιάβνπλ

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙ ΕΙΑΣ

ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙ ΕΙΑΣ ΜΑΘΗΜΑ ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙ ΕΙΑΣ ΟΝΟΜΑΤΕΠΩΝΥΜΟ ΘΕΜΑ 1 Ο Να γράψετε στο τετράδιό σας τον αριθµό της καθεµιάς από τις παρακάτω ηµιτελείς προτάσεις 1 εως 5 και δίπλα το γράµµα που αντιστοιχεί στη λέξη ή τη

Διαβάστε περισσότερα

ύζηεκα Ωξνκέηξεζεο Πξνζσπηθνύ (Έθδνζε 2) ΤΠΗΡΕΙΑ ΠΛΗΡΟΦΟΡΙΚΩΝ ΤΣΗΜΑΣΩΝ

ύζηεκα Ωξνκέηξεζεο Πξνζσπηθνύ (Έθδνζε 2) ΤΠΗΡΕΙΑ ΠΛΗΡΟΦΟΡΙΚΩΝ ΤΣΗΜΑΣΩΝ ύζηεκα Ωξνκέηξεζεο Πξνζσπηθνύ (Έθδνζε 2) ΤΠΗΡΕΙΑ ΠΛΗΡΟΦΟΡΙΚΩΝ ΤΣΗΜΑΣΩΝ Πεξηερόκελα Σερληθά Υαξαθηεξηζηηθά Καηαγξαθή Ώξαο πγρξνληζκόο πζηήκαηνο Παξνπζίαζε πζηήκαηνο Πηζαλά ελάξηα Υξήζεο 2 Σερληθά Υαξαθηεξηζηηθά

Διαβάστε περισσότερα

ΑΓΩΜΘΡΘΙΞΘ ΤΩΠΞΘ ΡΘΡ ΛΘΙΠΕΡ ΗΚΘΙΘΕΡ ΛΘΤΑΗΚΘΔΗΡ Τ.

ΑΓΩΜΘΡΘΙΞΘ ΤΩΠΞΘ ΡΘΡ ΛΘΙΠΕΡ ΗΚΘΙΘΕΡ ΛΘΤΑΗΚΘΔΗΡ Τ. ΑΓΩΜΘΡΘΙΞΘ ΤΩΠΞΘ ΡΘΡ ΛΘΙΠΕΡ ΗΚΘΙΘΕΡ ΟΑIΤΜΘΔΘ ΡΕ ΛΕΓΑΚΞ ΓΗΟΕΔΞ 11V11 ΗΚΘΙΘΑ 6-10 ΤΠΞΜΩΜ ΛΕΘΞΜΕΙΗΛΑΑ ΞΣ ΟΑΘΤΜΘΔΘΞΣ ΡΕ ΛΕΓΑΚΞ ΓΗΟΕΔΞ ΓΘΑ ΟΑΘΙΕΡ ΗΚΘΙΘΑΡ 6-10 ΕΩΜ Η ΔΘΑΔΠΞΛΗ ΑΟΞ Η ΛΘΑ ΕΡΘΑ ΡΗΜ ΑΚΚΗ ΕΘΜΑΘ ΛΕΓΑΚΗ

Διαβάστε περισσότερα

ΕΞΟΡΤΞΗ ΔΕΔΟΜΕΝΩΝ ΚΑΙ Η ΧΡΗΗ ΣΟΤ ΣΑ ΟΤΠΕΡΜΑΡΚΕΣ ΠΣΤΧΙΑΚΗ ΕΡΓΑΙΑ

ΕΞΟΡΤΞΗ ΔΕΔΟΜΕΝΩΝ ΚΑΙ Η ΧΡΗΗ ΣΟΤ ΣΑ ΟΤΠΕΡΜΑΡΚΕΣ ΠΣΤΧΙΑΚΗ ΕΡΓΑΙΑ ΕΞΟΡΤΞΗ ΔΕΔΟΜΕΝΩΝ ΚΑΙ Η ΧΡΗΗ ΣΟΤ ΣΑ ΟΤΠΕΡΜΑΡΚΕΣ ΠΣΤΧΙΑΚΗ ΕΡΓΑΙΑ ΜΠΑΖΙΜΑ ΟΛΓΑ ΑΜ:8286 22/1/2015 ΕΞΟΡΤΞΗ ΔΕΔΟΜΕΝΩΝ ΚΑΙ Η ΧΡΗΗ ΣΟΤ ΣΑ ΟΤΠΕΡΜΑΡΚΕΣ Σ.Δ.Η Ζπείξνπ Άξηα Σκήκα ηερλνινγίαο πιεξνθνξηθήο θαη ηειεπηθνηλσληψλ

Διαβάστε περισσότερα

Σ Δ Υ Ν Ι Κ Η Δ Κ Θ Δ Η Π Ρ Ο Μ Η Θ Δ Ι Α Ο Ι Κ Ο Γ Ο Μ Ι Κ Ω Ν Τ Λ Ι Κ Ω Ν Γ Η Μ Ο Τ Β Ο Λ Β Η

Σ Δ Υ Ν Ι Κ Η Δ Κ Θ Δ Η Π Ρ Ο Μ Η Θ Δ Ι Α Ο Ι Κ Ο Γ Ο Μ Ι Κ Ω Ν Τ Λ Ι Κ Ω Ν Γ Η Μ Ο Τ Β Ο Λ Β Η Σ Δ Υ Ν Ι Κ Η Δ Κ Θ Δ Η Π Ρ Ο Μ Η Θ Δ Ι Α Ο Ι Κ Ο Γ Ο Μ Ι Κ Ω Ν Τ Λ Ι Κ Ω Ν Γ Η Μ Ο Τ Β Ο Λ Β Η ΠΔΡΙΔΥΟΜΔΝΑ 1. Τερληθή Έθζεζε 2. Δλδεηθηηθφο Πξνυπνινγηζκφο 3. Έληππν νηθνλνκηθήο πξνζθνξάο ΘΔΜΑ : Πξνκήζεηα

Διαβάστε περισσότερα

Σπληήξεζε ηξνθίκσλ ρσξίο ρεκηθά πξόζζεηα PROJECT B ΛΥΚΕΙΟΥ 2 014-15

Σπληήξεζε ηξνθίκσλ ρσξίο ρεκηθά πξόζζεηα PROJECT B ΛΥΚΕΙΟΥ 2 014-15 Σπληήξεζε ηξνθίκσλ ρσξίο ρεκηθά πξόζζεηα PROJECT B ΛΥΚΕΙΟΥ 2 014-15 Εηζαγσγή Οη ηερληθέο ζπληήξεζεο ηξνθίκσλ έρνπλ ζθνπό : α) λα παξεκπνδίζνπλ αλεπηζύκεηεο κεηαβνιέο ζηα ραξαθηεξηζηηθά (γεύζε - ρξώκα -

Διαβάστε περισσότερα

Ανάπτυξη Ελληνικής τεχνολογίας μηχανών ηλεκτροπαραγωγής ORC

Ανάπτυξη Ελληνικής τεχνολογίας μηχανών ηλεκτροπαραγωγής ORC Εθνικό Συνέδριο «Γεωθερμική Ηλεκτροπαραγωγή» Ξενοδοχείο Divani Caravel Αθήνα 20 Νοεμβρίου 2013 Ανάπτυξη Ελληνικής τεχνολογίας μηχανών ηλεκτροπαραγωγής ORC Α.Μπένου, Ι. Χωροπανίτης Τμήμα Γεωθερμικής Ενέργειας

Διαβάστε περισσότερα

ΑΞΙΟΘΕΑΣΑ ΣΟΤ ΥΩΡΙΟΤ ΜΑ

ΑΞΙΟΘΕΑΣΑ ΣΟΤ ΥΩΡΙΟΤ ΜΑ ΑΞΙΟΘΕΑΣΑ ΣΟΤ ΥΩΡΙΟΤ ΜΑ α. Η ΕΚΚΛΗΙΑ ΣΟΤ ΥΩΡΙΟΤ ΜΑ β. ΣΟ ΠΝΕΤΜΑΣΙΚΟ ΜΑ ΚΕΝΣΡΟ γ. Η ΠΑΝΟΡΑΜΙΚΗ ΘΕΗ ΣΟΤ ΥΩΡΙΟΤ ΜΑ α. Η ΕΚΚΛΗΙΑ ΣΟΤ ΥΩΡΙΟΤ ΜΑ. Η Εθθιεζία ηνπ ρσξηνύ καο, ε Αγία Άλλα, είλαη θηηζκέλε πξηλ πνιιά

Διαβάστε περισσότερα

Η ΜΗΧΑΝΗ ΑΝΑΖΗΣΗΗ GOOGLE Περιγραφή λειτουργίασ, επιθέςεισ και τρόποι αντιμετώπιςησ

Η ΜΗΧΑΝΗ ΑΝΑΖΗΣΗΗ GOOGLE Περιγραφή λειτουργίασ, επιθέςεισ και τρόποι αντιμετώπιςησ ΠΑΝΕΠΙΣΗΜΙΟ ΠΕΙΡΑΙΩ Σμήμα Ψηφιακών υςτημάτων Κατεύθυνςη «Δικτυοκεντρικά υςτήματα» Η ΜΗΧΑΝΗ ΑΝΑΖΗΣΗΗ GOOGLE Περιγραφή λειτουργίασ, επιθέςεισ και τρόποι αντιμετώπιςησ Λαμπρόπουλος Μιχάλης Επιβλέπων Καθηγητήσ:

Διαβάστε περισσότερα

Η. ΣΟΗΥΔΗΑ ΠΟΤ ΓΗΑΣΖΡΟΤΝΣΑΗ

Η. ΣΟΗΥΔΗΑ ΠΟΤ ΓΗΑΣΖΡΟΤΝΣΑΗ Αγαπεηέ αξρεγέ, Τν λέν ζύζηεκα ησλ playoff πνπ πηινηηθά ζα εθαξκνζηεί ζηε θεηηλή πεξίνδν 2013 14 απνηειεί κηα βειηίσζε ηνπ πθηζηάκελνπ ζπζηήκαηνο πνπ κε επηηπρία εθαξκόζηεθε ζηηο πξώηεο έμη δηνξγαλώζεηο

Διαβάστε περισσότερα

TOOLBOOK (μάθημα 2) Δεκηνπξγία βηβιίνπ θαη ζειίδσλ ΠΡΟΑΡΜΟΓΗ: ΒΑΛΚΑΝΙΩΣΗ ΔΗΜ. ΕΚΠΑΙΔΕΤΣΙΚΟ ΠΕ19 1 TOOLBOOK ΜΑΘΗΜΑ 2

TOOLBOOK (μάθημα 2) Δεκηνπξγία βηβιίνπ θαη ζειίδσλ ΠΡΟΑΡΜΟΓΗ: ΒΑΛΚΑΝΙΩΣΗ ΔΗΜ. ΕΚΠΑΙΔΕΤΣΙΚΟ ΠΕ19 1 TOOLBOOK ΜΑΘΗΜΑ 2 TOOLBOOK (μάθημα 2) Δεκηνπξγία βηβιίνπ θαη ζειίδσλ ΕΚΠΑΙΔΕΤΣΙΚΟ ΠΕ19 1 Δημιουργία σελίδων και βιβλίων Έλα θαηλνύξην βηβιίν πεξηέρεη κία άδεηα ζειίδα κε έλα άδεην background. Δελ κπνξνύκε λα μερσξίζνπκε

Διαβάστε περισσότερα

ΠΑΝΕΠΙΣΗΜΙΟ ΜΑΚΕΔΟΝΙΑ ΟΙΚΟΝΟΜΙΚΩΝ ΚΑΙ ΚΟΙΝΩΝΙΚΩΝ ΕΠΙΣΤΗΜΩΝ ΣΜΗΜΑ ΕΦΑΡΜΟΜΕΝΗ ΠΛΗΡΟΦΟΡΙΚΗ ΣΕΥΝΗΣΗ ΝΟΗΜΟΤΝΗ

ΠΑΝΕΠΙΣΗΜΙΟ ΜΑΚΕΔΟΝΙΑ ΟΙΚΟΝΟΜΙΚΩΝ ΚΑΙ ΚΟΙΝΩΝΙΚΩΝ ΕΠΙΣΤΗΜΩΝ ΣΜΗΜΑ ΕΦΑΡΜΟΜΕΝΗ ΠΛΗΡΟΦΟΡΙΚΗ ΣΕΥΝΗΣΗ ΝΟΗΜΟΤΝΗ ΘΕΜ 1 ο (2.5 κνλάδεο) ΠΝΕΠΙΣΗΜΙΟ ΜΚΕΔΟΝΙ ΟΙΚΟΝΟΜΙΚΩΝ ΚΙ ΚΟΙΝΩΝΙΚΩΝ ΕΠΙΣΤΗΜΩΝ ΣΜΗΜ ΕΦΡΜΟΜΕΝΗ ΠΛΗΡΟΦΟΡΙΚΗ ΣΕΥΝΗΣΗ ΝΟΗΜΟΤΝΗ Σελικέρ εξετάσειρ Σετάπτη 21 Ιανοςαπίος 2009 13:00-16:00 Έζησ ν θόζκνο ηεο ειεθηξηθήο

Διαβάστε περισσότερα

ΗΛΕΚΤΡΟΝΙΚΗ ΜΝΗΜΗ ΚΑΙ ΜΙΚΡΟΕΛΕΓΚΤΕΣ

ΗΛΕΚΤΡΟΝΙΚΗ ΜΝΗΜΗ ΚΑΙ ΜΙΚΡΟΕΛΕΓΚΤΕΣ ΗΛΕΚΤΡΟΝΙΚΗ ΜΝΗΜΗ ΚΑΙ ΜΙΚΡΟΕΛΕΓΚΤΕΣ Η ζεκεξηλή ξαγδαία εμέιημε ηεο ηερλνινγίαο ηεο κηθξνειεθηξνληθήο επέηξεςε ηελ θαηαζθεπή εηδηθώλ νινθιεξσκέλσλ θπθισκάησλ απνζήθεπζεο δεδνκέλσλ θαη πιεξνθνξηώλ θαηαιακβάλνπλ

Διαβάστε περισσότερα

ΜΑΘΗΜΑΣΑ ΦΩΣΟΓΡΑΦΙΑ. Ειζαγωγή ζηη Φωηογραθία. Χριζηάκης Σαζεΐδης EFIAP

ΜΑΘΗΜΑΣΑ ΦΩΣΟΓΡΑΦΙΑ. Ειζαγωγή ζηη Φωηογραθία. Χριζηάκης Σαζεΐδης EFIAP ΜΑΘΗΜΑΣΑ ΦΩΣΟΓΡΑΦΙΑ Ειζαγωγή ζηη Φωηογραθία Χριζηάκης Σαζεΐδης EFIAP 1 ΜΑΘΗΜΑ 6 ο Προγράμμαηα θωηογραθικών μηχανών Επιλογέας προγραμμάηων Μαο δίλεη ηε δπλαηόηεηα λα ειέγμνπκε ην άλνηγκα δηαθξάγκαηνο θαη

Διαβάστε περισσότερα

Διάρηζηα Δπηθαιύπηνληα Γέλδξα

Διάρηζηα Δπηθαιύπηνληα Γέλδξα Διάρηζηα Δπηθαιύπηνληα Γέλδξα Οξηζκόο Δύξεζε Δπηθαιύπηνληνο Γέλδξνπ κε Διάρηζην Βάξνο, δειαδή ειάρηζην άζξνηζκα βαξώλ αθκώλ Αιγόξηζκνη Prim, Kruskal, Baruvka Βαζίδνληαη ζηελ ηερληθή ηεο Απιεζηίαο Η νξζόηεηα

Διαβάστε περισσότερα

Α Ρ Η Σ Ο Σ Δ Λ Δ Η Ο Π Α Ν Δ Π Η Σ Ζ Μ Η Ο Θ Δ Α Λ Ο Ν Η Κ Ζ

Α Ρ Η Σ Ο Σ Δ Λ Δ Η Ο Π Α Ν Δ Π Η Σ Ζ Μ Η Ο Θ Δ Α Λ Ο Ν Η Κ Ζ Α Ρ Η Σ Ο Σ Δ Λ Δ Η Ο Π Α Ν Δ Π Η Σ Ζ Μ Η Ο Θ Δ Α Λ Ο Ν Η Κ Ζ ΣΜΖΜΑ ΓΔΩΛΟΓΗΑ ΔΡΓΑΣΖΡΗΟ ΣΔΥΝΗΚΖ ΓΔΩΛΟΓΗΑ ΜΑΘΖΜΑ: ΤΕΧΝΙΚΗ ΓΕΩΛΟΓΙΑ ΓΗΓΑΚΟΝΣΔ: Β. ΥΡΖΣΑΡΑ, Καθ. ΔΞΑΜΖΝΟ: 7 ο Β. ΜΑΡΗΝΟ, Δπ.Καθ. Φεβροσάριος

Διαβάστε περισσότερα

ΠΟΛΤΜΕΡΙΜΟ - ΠΕΣΡΟΥΗΜΙΚΑ

ΠΟΛΤΜΕΡΙΜΟ - ΠΕΣΡΟΥΗΜΙΚΑ ΠΟΛΤΜΕΡΙΜΟ - ΠΕΣΡΟΥΗΜΙΚΑ ΠΑΡΑΔΕΙΓΜΑΣΑ Ο πολσμεριζμός Πολσμεριζμός είναι η τημική ανηίδραζη καηά ηην οποία πολλά μόρια ίδιων ή διαθορεηικών οργανικών ενώζεων, ποσ ονομάζονηαι μονομερή, ενώνονηαι και ζτημαηίζοσν

Διαβάστε περισσότερα

ΥΔΣΙΚΟΣΗΣΑ Μεηαζρεκαηηζκνί Γαιηιαίνπ. (Κιαζηθή ζεώξεζε) v t. αθνύ ζύκθσλα κε ηα πεηξάκαηα Mickelson-Morley είλαη c =c.

ΥΔΣΙΚΟΣΗΣΑ Μεηαζρεκαηηζκνί Γαιηιαίνπ. (Κιαζηθή ζεώξεζε) v t. αθνύ ζύκθσλα κε ηα πεηξάκαηα Mickelson-Morley είλαη c =c. ΥΔΣΙΚΟΣΗΣΑ Μεηαζρεκαηηζκνί Γαιηιαίνπ. (Κιαζηθή ζεώξεζε) y y z z t t Σν νπνίν νδεγεί ζην όηη = - π.(άηνπν), αθνύ ζύκθσλα κε ηα πεηξάκαηα Mikelson-Morley είλαη =. Δπίζεο y = y, z = z, t = t Σν νπνίν ( t

Διαβάστε περισσότερα

1. Οδηγίερ εγκαηάζηαζηρ και σπήζηρ έξςπνυν καπηών και τηθιακών πιζηοποιηηικών με σπήζη ηος λογιζμικού Μοzilla Thunderbird

1. Οδηγίερ εγκαηάζηαζηρ και σπήζηρ έξςπνυν καπηών και τηθιακών πιζηοποιηηικών με σπήζη ηος λογιζμικού Μοzilla Thunderbird 1. Οδηγίερ εγκαηάζηαζηρ και σπήζηρ έξςπνυν καπηών και τηθιακών πιζηοποιηηικών με σπήζη ηος λογιζμικού Μοzilla Thunderbird 1.1 Εγκαηάζηαζη ηυν οδηγών ηηρ έξςπνηρ κάπηαρ ζηο λογιζμικό Mozilla Thunderbird

Διαβάστε περισσότερα

Η Νοζηλεςηική Γιεπγαζία ζε Αζθενείρ με Κ.Ν.Μ.

Η Νοζηλεςηική Γιεπγαζία ζε Αζθενείρ με Κ.Ν.Μ. Η Νοζηλεςηική Γιεπγαζία ζε Αζθενείρ με Κ.Ν.Μ. ΜΠΙΛΙΛΗ ΑΝΑΣΑΙΑ Νοσηλεύτρια Σ.Δ. ΜSc Προϊσταμένη τμήματος ΦΙΑπ Γ.Ν. ΚΑΣ ΜΟΥΙΓΗ ΘΔΜΙΣΟΚΛΗ Νοσηλεστής Σ.Δ. τμήματος ΦΙΑπ Γ.Ν. ΚΑΣ ΒΟΤΡΛΔΓΚΑ ΠΑΝΑΓΙΩΣΑ Νοσηλεύτρια

Διαβάστε περισσότερα

ACTA A.E. Αριςτο Σέλεια Πιςτοποίηςη. Ανθρώπινου Δυναμικοφ. «ΠΙΣΟΠΟΙΗΗ ΑΝΘΡΩΠΙΝΟΤ ΔΤΝΑΜΙΚΟΤ Εξελίξεισ - Προοπτικέσ»

ACTA A.E. Αριςτο Σέλεια Πιςτοποίηςη. Ανθρώπινου Δυναμικοφ. «ΠΙΣΟΠΟΙΗΗ ΑΝΘΡΩΠΙΝΟΤ ΔΤΝΑΜΙΚΟΤ Εξελίξεισ - Προοπτικέσ» ACTA A.E. Αριςτο Σέλεια Πιςτοποίηςη Ανθρώπινου Δυναμικοφ «ΠΙΣΟΠΟΙΗΗ ΑΝΘΡΩΠΙΝΟΤ ΔΤΝΑΜΙΚΟΤ Εξελίξεισ - Προοπτικέσ» Εταιρεία Ένταςησ Γνώςησ Αριςτοτελείου Πανεπιςτημίου Θεςςαλονίκησ Δια Βίου Μάθηςη Νόκνο:

Διαβάστε περισσότερα

Γενεηική Καρδιαγγειακών Παθήζεων

Γενεηική Καρδιαγγειακών Παθήζεων Γενεηική Καρδιαγγειακών Παθήζεων Νίκορ Ππωτονοτάπιορ, MD, FESC, Νάξορ Η γελεηηθή ησλ θαξδηαγγεηαθώλ παζήζεσλ έρεη εμειηρζεί νπζηαζηηθά θαηά ηα ηειεπηαία είθνζη ρξόληα. Σε απηό ην ρξνληθό δηάζηεκα εμειίρζεθε

Διαβάστε περισσότερα

1. Η απιή αξκνληθή ηαιάλησζε πνπ εθηειεί έλα κηθξό ζώκα κάδαο m = 1 kg έρεη πιάηνο Α = 20 cm θαη

1. Η απιή αξκνληθή ηαιάλησζε πνπ εθηειεί έλα κηθξό ζώκα κάδαο m = 1 kg έρεη πιάηνο Α = 20 cm θαη ΛΤΜΔΝΔ ΑΚΖΔΗ ΣΖΝ ΔΤΡΔΖ ΑΡΥΗΚΖ ΦΑΖ 1. Η αιή αξκνληθή ηαιάλησζε ν εθηειεί έλα κηθξό ζώκα κάδαο m = 1 kg έρεη ιάηνο Α = cm θαη ζρλόηεηα f = 5 Hz. Τε ρξνληθή ζηηγκή = ην κηθξό ζώκα δηέξρεηαη αό ηε ζέζε ανκάθξλζεο

Διαβάστε περισσότερα

Η Αξιολόγηζη ηηρ Πεπίλητηρ Κειμένος Παιδαγυγικό Ινζηιηούηο

Η Αξιολόγηζη ηηρ Πεπίλητηρ Κειμένος Παιδαγυγικό Ινζηιηούηο Η Αξιολόγηζη ηηρ Πεπίλητηρ Κειμένος Παιδαγυγικό Ινζηιηούηο Οδηγίες για ηη διδαζκαλία ηων θιλολογικών μαθημάηων ζηο Ενιαίο Λύκειο (απόζπαζμα) Αθήνα 2001 ΠΔΡΙΔΥΟΜΔΝΑ Α. Τν πεξηερόκελν ηεο πεξίιεςεο (0-12

Διαβάστε περισσότερα

ΙNCOFRUIT - (HELLAS).

ΙNCOFRUIT - (HELLAS). Πξνο ΟΛΑ ΤΑ ΜΔΛΗ Κε Σπλάδειθε Θέκα: Ιζπαλία & Γεξκαλία 5 ε ΔΒΓΟΜΑΓΑ 2011 (31 Ιαλ έσο 30 Φεβξ.2011) Παξαζέηνπκε θαησηέξσ: Αλαζθόπεζε ηεο 4 εο εβδνκάδνο 2011 κε ηηο ηηκέο ησλ εζπεξηδνεηδώλ πνπ δηακνξθώζεθαλ

Διαβάστε περισσότερα

ΤΠΟΓΟΥΔΑ Σ-ΛΔΜΦΟΚΤΣΣΑΡΟΤ

ΤΠΟΓΟΥΔΑ Σ-ΛΔΜΦΟΚΤΣΣΑΡΟΤ ΤΠΟΓΟΥΔΑ Σ-ΛΔΜΦΟΚΤΣΣΑΡΟΤ 6 Τα Τ-ιεκθνθύηηαξα παίδνπλ ζεκαληηθό ξόιν ζηελ αλνζηαθή απάληεζε έλαληη ηωλ πξωηεϊληθώλ αληηγόλωλ. Από ηε ζηηγκή πνπ όινη νη παζνγόλνη κηθξννξγαληζκνί πεξηέρνπλ πξωηεΐλεο, ηα

Διαβάστε περισσότερα

Π Ρ Ο Μ Η Θ Δ Ι Α Α Κ Ω Ν Α Π Ο Ρ Ρ Ι Μ Μ Α Σ Ω Ν

Π Ρ Ο Μ Η Θ Δ Ι Α Α Κ Ω Ν Α Π Ο Ρ Ρ Ι Μ Μ Α Σ Ω Ν Π Ρ Ο Μ Η Θ Δ Ι Α Α Κ Ω Ν Α Π Ο Ρ Ρ Ι Μ Μ Α Σ Ω Ν ΠΔΡΙΔΥΟΜΔΝΑ 1. Σερληθή Έθζεζε 2. Σερληθέο Πξνδηαγξαθέο 3. Δλδεηθηηθφο Πξνυπνινγηζκφο 4. Έληππν πξνζθνξάο ΘΔΜΑ : Πξνκήζεηα ζάθ σλ α π ν ξ- Σ Δ Υ Ν Ι Κ Η

Διαβάστε περισσότερα

10). ΣΤΠΟΠΟΙΗΜΕΝΕ ΠΑΡΟΥΕ ΜΣ ΚΑΙ ΥΣ

10). ΣΤΠΟΠΟΙΗΜΕΝΕ ΠΑΡΟΥΕ ΜΣ ΚΑΙ ΥΣ 10). ΣΤΠΟΠΟΙΗΜΕΝΕ ΠΑΡΟΥΕ ΜΣ ΚΑΙ ΥΣ Σσποποιημένες παροτές ΥΣ Γηα ηελ ειεθηξνδόηεζε θάζε εζωηεξηθήο εγθαηάζηαζεο θαηαζθεπάδεηαη κία από ηηο «ηππνπνηεκέλεο» παξνρέο πνπ αλαθέξνληαη παξαθάηω. Γηα θάζε ηππνπνηεκέλε

Διαβάστε περισσότερα

ΠΛΗ36. Άσκηση 1. Άσκηση 2. Οη δηεπζύλζεηο ησλ 4 σλ ππνδηθηύσλ είλαη νη αθόινπζεο. Υπνδίθηπν Α: 10.101.1.64/27 Υπνδίθηπν Β: 10.101.1.

ΠΛΗ36. Άσκηση 1. Άσκηση 2. Οη δηεπζύλζεηο ησλ 4 σλ ππνδηθηύσλ είλαη νη αθόινπζεο. Υπνδίθηπν Α: 10.101.1.64/27 Υπνδίθηπν Β: 10.101.1. Άσκηση 1 ΠΛΗ36 1. Η κόλε πεξίπησζε λα έρνπκε ζύγθξνπζε κεηαμύ παθέησλ ησλ δύν θόκβσλ είλαη λα ζηείιεη ν δεύηεξνο πξηλ πξνιάβεη λα πιεξνθνξεζεί γηα ηελ θαηάιεςε ηνπ δηάπινπ από ηνλ άιιν. Από ηε ζηηγκή πνπ

Διαβάστε περισσότερα

ΣΟ ΤΣΖΜΑ ΔΛΑΣΖΡΗΟ - ΩΜΑ

ΣΟ ΤΣΖΜΑ ΔΛΑΣΖΡΗΟ - ΩΜΑ ΣΟ ΤΣΖΜΑ ΔΛΑΣΖΡΗΟ - ΩΜΑ Σε όια ηα πξνβιήκαηα πνπ ζα αληηκεηωπίζνπκε, ην ειαηήξην ζα είλαη αβαξέο θαη ζα ηθαλνπνηεί ην λόκν ηνπ Hooke (ηδαληθό ειαηήξην), δειαδή ε δύλακε πνπ αζθεί έλα ηδαληθό ειαηήξην έρεη

Διαβάστε περισσότερα

ΦΤΛΛΟ ΔΡΓΑΙΑ 1 Βαζηθέο Έλλνηεο & Καηεγνξίεο Γηθηύσλ Τπνινγηζηώλ

ΦΤΛΛΟ ΔΡΓΑΙΑ 1 Βαζηθέο Έλλνηεο & Καηεγνξίεο Γηθηύσλ Τπνινγηζηώλ ΦΤΛΛΟ ΔΡΓΑΙΑ 1 Βαζηθέο Έλλνηεο & Καηεγνξίεο Γηθηύσλ Τπνινγηζηώλ Γξαζηεξηόηεηα 1ε αο δίλεηαη ν ελλνηνινγηθφο ράξηεο "Γίθηπα Τπνινγηζηψλ - Βαζηθέο Έλλνηεο" πνπ αθνξά ζηελ θεληξηθή έλλνηα "Γίθηπα Τπνινγηζηψλ".

Διαβάστε περισσότερα

ΚΤΠΡΙΑΚΗ ΜΑΘΗΜΑΣΙΚΗ ΕΣΑΙΡΕΙΑ ΜΑΘΗΜΑΣΙΚΗ ΚΤΣΑΛΟΓΡΟΜΙΑ 2007 ΓΙΑ ΣΟ ΓΤΜΝΑΙΟ Παπασκευή 26 Ιανουαπίου 2007 Σάξη: Γ Γυμνασίου ΥΟΛΕΙΟ..

ΚΤΠΡΙΑΚΗ ΜΑΘΗΜΑΣΙΚΗ ΕΣΑΙΡΕΙΑ ΜΑΘΗΜΑΣΙΚΗ ΚΤΣΑΛΟΓΡΟΜΙΑ 2007 ΓΙΑ ΣΟ ΓΤΜΝΑΙΟ Παπασκευή 26 Ιανουαπίου 2007 Σάξη: Γ Γυμνασίου ΥΟΛΕΙΟ.. ΜΑΘΗΜΑΣΙΚΗ ΚΤΣΑΛΟΓΡΟΜΙΑ 2007 ΓΙΑ ΣΟ ΓΤΜΝΑΙΟ Παπασκευή 26 Ιανουαπίου 2007 Σάξη: Γ Γυμνασίου ιήμεο 11.00 Κάπνηνο άξρηζε λα δηαβάδεη έλα βηβιίν ηελ 1 ε Δεθεκβξίνπ. Κάζε κέξα δηάβαδε ηνλ ίδην αξηζκό ζειίδσλ

Διαβάστε περισσότερα

ΑΛΔΞΑΝΓΡΔΗΟ ΣΔΥΝΟΛΟΓΗΚΟ ΔΚΠΑΗΓΔΤΣΗΚΟ ΗΓΡΤΜΑ ΘΔΑΛΟΝΗΚΖ ΥΟΛΖ ΣΔΥΝΟΛΟΓΗΚΧΝ ΔΦΑΡΜΟΓΧΝ ΣΜΖΜΑ ΠΛΖΡΟΦΟΡΗΚΖ. Πηπρηαθή εξγαζία BIG DATA SECURITY

ΑΛΔΞΑΝΓΡΔΗΟ ΣΔΥΝΟΛΟΓΗΚΟ ΔΚΠΑΗΓΔΤΣΗΚΟ ΗΓΡΤΜΑ ΘΔΑΛΟΝΗΚΖ ΥΟΛΖ ΣΔΥΝΟΛΟΓΗΚΧΝ ΔΦΑΡΜΟΓΧΝ ΣΜΖΜΑ ΠΛΖΡΟΦΟΡΗΚΖ. Πηπρηαθή εξγαζία BIG DATA SECURITY ΑΛΔΞΑΝΓΡΔΗΟ ΣΔΥΝΟΛΟΓΗΚΟ ΔΚΠΑΗΓΔΤΣΗΚΟ ΗΓΡΤΜΑ ΘΔΑΛΟΝΗΚΖ ΥΟΛΖ ΣΔΥΝΟΛΟΓΗΚΧΝ ΔΦΑΡΜΟΓΧΝ ΣΜΖΜΑ ΠΛΖΡΟΦΟΡΗΚΖ Πηπρηαθή εξγαζία BIG DATA SECURITY Γνιηθίδεο Μάξηνο νπιετκάλεο Μαλψιεο Θεζζαλονίκη 2015 χκβνπινο θαζεγεηήο

Διαβάστε περισσότερα

Στοίχιση Ακολουθιών. Μέθοδοι σύγκρισης ακολουθιών. Είδος στοίχισης. match. gap. mismatch

Στοίχιση Ακολουθιών. Μέθοδοι σύγκρισης ακολουθιών. Είδος στοίχισης. match. gap. mismatch Οµολογία ΣΤΟΙΧΙΣΗ ΑΚΟΛΟΥΘΙΩΝ ΑΝΑ ΖΕΥΓΗ Σελίδα 1 Σελίδα 2 Οµολογία Οµολογία Οµολογία κοινή εξελικτική καταγωγή Ορθόλογα γονίδια ειδογένεση συνήθως, ίδια βιολογική λειτουργία Παράλογα γονίδια γονιδιακός

Διαβάστε περισσότερα

Αναμόπθωζη Ππογπάμμαηορ Πποπηςσιακών Σποςδών

Αναμόπθωζη Ππογπάμμαηορ Πποπηςσιακών Σποςδών Αναμόπθωζη Ππογπάμμαηορ Πποπηςσιακών Σποςδών Ζ Σπλέιεπζε (Σ) ηνπ Τκήκαηνο Βηνκεραληθήο Γηνίθεζεο θαη Τερλνινγίαο ηεο 18/5/2015 ελέθξηλε ηελ αλακόξθσζε ηνπ Πξνγξάκκαηνο Πξνπηπρηαθώλ Σπνπδώλ. Παξαθαινύληαη

Διαβάστε περισσότερα

Βιομησανικόρ ζσεδιαζμόρ πποϊόνηων από ανακςκλωμένερ ζςζκεςαζίερ

Βιομησανικόρ ζσεδιαζμόρ πποϊόνηων από ανακςκλωμένερ ζςζκεςαζίερ Βιομησανικόρ ζσεδιαζμόρ πποϊόνηων από ανακςκλωμένερ ζςζκεςαζίερ ΤΕΙ Δσηικής Μακεδονίας Τμήμα Βιομητανικού Στεδιαζμού Εργαζηήριο C 3 www.c3.teiwm.gr C 3 LAB www.c3.teiwm.gr 1 Εηζαγσγή Πεπιεσόμενα ύκβνια

Διαβάστε περισσότερα

ΙΣΤΟΡΙΑ ΤΟΥ ΑΡΧΑΙΟΥ ΚΟΣΜΟΥ

ΙΣΤΟΡΙΑ ΤΟΥ ΑΡΧΑΙΟΥ ΚΟΣΜΟΥ ΙΣΤΟΡΙΑ ΤΟΥ ΑΡΧΑΙΟΥ ΚΟΣΜΟΥ Α ΛΤΚΕΙΟΤ ΓΕΝΙΚΗ ΠΑΙΔΕΙΑ Σχολικό έτος: 2011-2012 Καθηγήτριες: Κεφαλληνού Λουκία- Καλλία Αθηνά ΙΙ. ΟΙ ΑΧΑΙΟΙ ΕΛΛΗΝΕΣ ΑΠΟ ΣΟΤ ΠΡΟΙΣΟΡΙΚΟΤ ΥΡΟΝΟΤ ΕΩ ΚΑΙ ΣΟ Μ. ΑΛΕΞΑΝΔΡΟ 1. ΕΛΛΗΝΙΚΗ

Διαβάστε περισσότερα

ΔΛΔΓΥΟ ΔΜΒΟΛΙΑΣΙΚΗ ΚΑΛΤΦΗ Δ ΠΑΙΓΙΑ ΠΡΟΥΟΛΙΚΗ ΚΑΙ ΥΟΛΙΚΗ ΗΛΙΚΙΑ ΣΟΤ ΝΟΜΟΤ ΚΔΡΚΤΡΑ

ΔΛΔΓΥΟ ΔΜΒΟΛΙΑΣΙΚΗ ΚΑΛΤΦΗ Δ ΠΑΙΓΙΑ ΠΡΟΥΟΛΙΚΗ ΚΑΙ ΥΟΛΙΚΗ ΗΛΙΚΙΑ ΣΟΤ ΝΟΜΟΤ ΚΔΡΚΤΡΑ ΔΛΔΓΥΟ ΔΜΒΟΛΙΑΣΙΚΗ ΚΑΛΤΦΗ Δ ΠΑΙΓΙΑ ΠΡΟΥΟΛΙΚΗ ΚΑΙ ΥΟΛΙΚΗ ΗΛΙΚΙΑ ΣΟΤ ΝΟΜΟΤ ΚΔΡΚΤΡΑ 24 ο ΠΑΝΔΛΛΗΝΙΟ ΤΝΔΓΡΙΟ ΔΛΛΗΝΙΚΗ ΔΣΑΙΡΔΙΑ ΚΟΙΝΧΝΙΚΗ ΠΑΙΓΙΑΣΡΙΚΗ ΚΑΙ ΠΡΟΑΓΧΓΗ ΣΗ ΤΓΔΙΑ ΠΙΝΟΤΛΑ ΔΤΡΤΓΙΚΗ ΒΑΡΚΑΡΗ ΠΟΛΤΚΡΙΣΗ

Διαβάστε περισσότερα

ΑΣΚΗΣΔΙΣ ΦΥΣΙΚΗΣ ΚΑΤΑΣΤΑΣΗΣ ΣΤΟ ΓΗΠΔΓΟ

ΑΣΚΗΣΔΙΣ ΦΥΣΙΚΗΣ ΚΑΤΑΣΤΑΣΗΣ ΣΤΟ ΓΗΠΔΓΟ Α. Αεπόβια ικανόηηηα: ΑΣΚΗΣΔΙΣ ΦΥΣΙΚΗΣ ΚΑΤΑΣΤΑΣΗΣ ΣΤΟ ΓΗΠΔΓΟ 1. Φόλλοος ζηα δύο καλάθια: νη αζιεηέο είλαη απέλαληη από ηα ηακπιώ ζε δπν γξακκέο. Οη πξώηνη έρνπλ από κηα κπάια. Με ην ζύλζεκα θάλνπλ θόιιννπ

Διαβάστε περισσότερα

ΠΑΡΔΜΒΑΔΙ ΔΤΑΙΘΗΣΟΠΟΙΗΗ ΚΑΙ ΠΡΟΛΗΨΗ ΓΙΑ ΣΟΝ HIV/AIDS ΣΗΝ ΑΚΣΟΓΡΑΜΜΗ ΣΩΝ ΠΔΡΙΦΔΡΔΙΑΚΩΝ ΔΝΟΣΗΣΩΝ ΣΗ ΚΔΝΣΡΙΚΗ ΜΑΚΔΓΟΝΙΑ ΑΤΓΟΤΣΟ 2014

ΠΑΡΔΜΒΑΔΙ ΔΤΑΙΘΗΣΟΠΟΙΗΗ ΚΑΙ ΠΡΟΛΗΨΗ ΓΙΑ ΣΟΝ HIV/AIDS ΣΗΝ ΑΚΣΟΓΡΑΜΜΗ ΣΩΝ ΠΔΡΙΦΔΡΔΙΑΚΩΝ ΔΝΟΣΗΣΩΝ ΣΗ ΚΔΝΣΡΙΚΗ ΜΑΚΔΓΟΝΙΑ ΑΤΓΟΤΣΟ 2014 ΠΑΡΔΜΒΑΔΙ ΔΤΑΙΘΗΣΟΠΟΙΗΗ ΚΑΙ ΠΡΟΛΗΨΗ ΓΙΑ ΣΟΝ HIV/AIDS ΣΗΝ ΑΚΣΟΓΡΑΜΜΗ ΣΩΝ ΠΔΡΙΦΔΡΔΙΑΚΩΝ ΔΝΟΣΗΣΩΝ ΣΗ ΚΔΝΣΡΙΚΗ ΜΑΚΔΓΟΝΙΑ ΑΤΓΟΤΣΟ 2014 Σν ΚΔ.ΔΛ.Π.ΝΟ., Γξαθείν Θεζζαινλίθεο θαη ε Γηεύζπλζε Γεκόζηαο Τγείαο ηεο