Εφαρμογές της αυτο-οργανωσης και συγκρότησης υπερμοριaκών βιολογικών δομών (self-assembly) στην επιστήμη των υλικών (ΒΙΟΜΙΜΗΤΙΚΗ ΤΕΧΝΟΛΟΓΙΑ)

Μέγεθος: px
Εμφάνιση ξεκινά από τη σελίδα:

Download "Εφαρμογές της αυτο-οργανωσης και συγκρότησης υπερμοριaκών βιολογικών δομών (self-assembly) στην επιστήμη των υλικών (ΒΙΟΜΙΜΗΤΙΚΗ ΤΕΧΝΟΛΟΓΙΑ)"


1 Εφαρμογές της αυτο-οργανωσης και συγκρότησης υπερμοριaκών βιολογικών δομών (self-assembly) στην επιστήμη των υλικών (ΒΙΟΜΙΜΗΤΙΚΗ ΤΕΧΝΟΛΟΓΙΑ)

2 (self-assembly) Χρησιμοποίηση της ιδέας του lego

3 XAPAΚΤΗΡΙΣΤΙΚΑ ΤΩΝ ΒΙΟΛΟΓΙΚΩΝ ΥΛΙΚΩΝ - Διαδικασιες κατασκευης φιλικες προς το περιβαλλον - Ιεραρχημενη αρχιτεκτονικη δομων - Αυτο- οργανωση (self-assembly) - Οργανωση ανοργανων φασεων (κρυσταλλοι) από τις οργανικες (πρωτεινες) Κατασκευή υλικών bottom-up Σε αντίθεση με top-down

4 Κατασκευή υλικών bottom-up (αυθόρμητη αναγνώριση και αυτό-οργάνωση, τακτική που χρησιμοποιεί η φύση) Σε αντίθεση με top-down (τεχνολογίες κατασκευής που χρησιμοποιούνται από τον άνθρωπο)

5 Παράδειγμα κατασκευής bottom-up στην Βιολογία: η δομή μιας τρίχας μαλλιών Βασική δομική μονάδα: Άλφα-έλικες της κερατίνης Πλούσιες σε αμινοξέα κυστεϊνης, συνδεδεμένα με δισουλφιδικούς δεσμούς (-S-S-)

6 Παραδείγματα Οργάνωσης ανόργανων φάσεων (κρυσταλλοι) από τις οργανικές (πρωτεΐνες): Nacre (μάργαρο, σεντεφι) 95% Ανοργανη φαση=ανθρακικο ασβεστιο (αραγωνιτης, CaCO3) 5% οργανική φάση (πρωτεϊνες) 3000 φορες πιο ανθεκτικο στην θραυση από Τον καθαρο αραγωνιτη

7 Παραδείγματα Οργάνωσης ανόργανων φάσεων (κρύσταλλοι) από τις οργανικές (πρωτεΐνες): ΒΙΟΛΟΓΙΚΕΣ ΙΝΕΣ ΠΥΡΙΤΙΟΥ Αγκάθια του σφουγγαριού Euplectella aspergillum

8 Μικροδομή των αγκαθιών: μια κεντρική ίνα πρωτεϊνης (Organic Filament) Περιτυλιγμένη από έναν κεντρικό πυρήνα (Central Core) και παραπέρα Διαδοχικές ομόκεντρες στρώσεις (striated shell region) από πυρίτιο

9 Οι ικανότητες της 1) αυτοοργάνωσης και 2) διευθέτησης της ανόργανης ύλης Που χαρακτηρίζουν τις βιολογικές δομές μπορούν να χρησιμοποιηθούν για την διευθέτηση, συγκρότηση και κατασκευή καινοτόμων υλικών?

10 Μια πάστα από PbO και Ca (OH) 2, ph 12.5 τοποθετείται στα μαλλιά Διαμήκεις και εγκάρσιες τομές: A,D: 0 h B,E:6h C,F:72h Ποιος είναι ο μηχανισμός με τον οποίο Η τρίχα βάφεται μαύρη?

11 Το εξαιρετικά αλκαλικό περιβάλλον διασπά τους δεσμούς -S-S-, απελευθερώνοντας θείο νανοκρύσταλλοι PbS διαμέτρου 5 nm σχηματίζονται, απέχοντας μεταξύ τους 10 nm Η ανάπτυξη και τοποθέτηση των νανοκρυσταλλων καθορίζεται από την υπερμοριακη οργάνωση των κερατινων.

12 Χρησιμοποίηση της αυτό-οργάνωσης βιολογικών δομών για την διευθέτηση, συγκρότηση και κατασκευή καινοτόμων υλικών: Μπορούν να χρησιμοποιηθούν Και φυσιολογικές, και μη φυσιολογικές Υπερμοριακές δομές (πχ αμυλοειδή ινίδια)

13 Παραδείγματα χρησιμοποίησης βιολογικών δομών για την διευθέτηση, συγκρότηση και κατασκευή καινοτόμων υλικών: 1) Χρησιμοποίηση της αυτοοργανωσης των βιολογικών μορίων (DNA, πεπτιδίων, πρωτεϊνών.) για την κατασκευή καινοτόμων υλικών: νανοκαλωδιων, νανοσωληνων... 2) Ινώδεις ιοί, πρωτεϊνικοί κλωβοί και ιικα καψιδια σαν ικριώματα για την κατασκευή νανοκαλωδιων, υγρών κρύσταλλων, κλωβών,, etc

14 Χρησιμοποίηση της αυτο-οργάνωσης για την κατασκευή υλικών ιδιότητες των πεπτιδικών νανοδομών: -βιολογική συμβατότητα -αξιοσημείωτη θερμική και χημική σταθερότητα -δυνατότητα εύκολης σύνθεσης και τροποποίησης Αρα κατάλληλα για εφαρμογές νανοτεχνολογίας, Και ειδικά για εφαρμογές στα σύνθετα (βιολογικά-ανόργανα) υλικά

15 Χρησιμοποίηση της αυτο-οργάνωσης για την κατασκευή υλικών Αγώγιμα νανο - σύρματα σχηματισμένα από αμυλοειδη ινίδια και ελεγχόμενη εναπόθεση μετάλλων Scheibel et al., PNAS 2003, 100,

16 Αλληλουχία του πεπτιδίου Alzheimer (42 αμινοξέα) H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAL-COOH Αυτό-οργανώνεται σε αμυλοεϊδή ινίδια

17 Μικρότερες αλληλουχίες του πεπτιδίου Alzheimer (42 αμινοξέα) Μπορούν και σχηματίζουν επίσης αμυλοεϊδή ινίδια (πχ KLVFFAE) Το διπεπτίδιο της φαινυλαλανίνης (FF) σχηματίζει νανοσωλήνες

18 Νανοσωληνες (nanotubes) σχηματισμένοι Από το διπεπτίδιο FF του πεπτιδίου Alzheimer Reches and Gazit,, Science 2003, 300:

19 Οι νανοσωλήνες μπορούν να χρησιμοποιηθούν Σαν εκμαγείο (template) για την κατασκευή υλικών π.χ. Μεταλλικά καλώδια (nanowires) Τα μεταλλικά καλώδια (nanowires) έχουν διάμετρο 20 nm

20 Τα αυτο-οργανωμένα υλικά σχηματίζουν πηκτές (gels), λεπτά υμένια (thin films), κλπ Και μπορούν να χρησιμοποιηθούν για εφαρμογές στην μηχανική των ιστών

21 Σχηματισμός υμενίων από το πεπτίδιο (Ala-Glu-Ala-Glu-Ala-Lys-Ala-Lys)2, (EAK16)

22 Μηχανισμός αυτοοργανωσης:

23 Μηχανισμός αυτοοργανωσης:

24 Τα αυτο-οργανωμένα υλικά μπορούν να χρησιμοποιηθούν ως ικριώματα (scaffolds) για εφαρμογές στην μηχανική των ιστών SAPNS: Self-Assembling Peptide Nanoscaffold (PuraMatrix)

25 Αναγέννηση οπτικού νεύρου μετά από αποκοπή και τοπική εφαρμογή πηκτής αυτό-οργανωμένων πεπτιδίων Nano-Neuro Neuro knitting: Peptide nanofiber scaffold for brain repair And axon regeneration With functional return of vision Ellis-Behnke et al,, PNAS, 2006, 103:


27 Αναγέννηση οπτικού νεύρου μετά από αποκοπή και τοπική εφαρμογή πηκτής αυτό-οργανωμένων πεπτιδίων

28 Αναγέννηση οπτικού νεύρου μετά από αποκοπή και τοπική εφαρμογή πηκτής αυτό-οργανωμένων πεπτιδίων

29 Επιστροφή όρασης μετά από αποκοπή οπτικού νεύρου και τοπική εφαρμογή πηκτής αυτό-οργανωμένων πεπτιδίων

30 Εφαρμογές στην τεχνολογία βιοαισθητηρων με χρήση ηλεκτροδίων επικαλυμμένων με νανοσωληνες Yemini et al., Analytical Chemistry, 2005

31 Συγκεντρωτική εικόνα: Χρησιμοποίηση της αυτο-οργάνωσης πεπτιδίων για την κατασκευή νανο - βιουλικων Zhang, Nature Biotechnology 2003, 21:

32 Παραδείγματα χρησιμοποίησης βιολογικών δομών για την διευθέτηση, συγκρότηση και κατασκευή καινοτόμων υλικών: 1) Χρησιμοποίηση της αυτοοργανωσης των βιολογικών μορίων (DNA, πεπτιδίων, πρωτεϊνών.) για την κατασκευή καινοτόμων υλικών: νανοκαλωδιων, νανοσωληνων... 2) Ινώδεις ιοί, πρωτεϊνικοί κλωβοί και ιικα καψιδια σαν ικριώματα για την κατασκευή νανοκαλωδιων, υγρών κρύσταλλων, κλωβών,, etc

33 Οι ινώδεις ιοί σαν εκμαγεία για την αυτοοργανωση βιο - νανουλικων Πχ ιος της μωσαικης του καπνου

34 Αυτοσυγκρότηση υπερμοριακων δομών: Ινώδεις ιοί Ιός της μωσαϊκής του καπνού Πρωτεϊνικό κάλυμμα: αποτελείται από 2130 πανομοιότυπες πρωτεϊνικές υπομοναδες 158 αα η κάθε μια (μπλε) Γύρω από ένα μονόκλωνο μόριο RNA πού περιέχει 630 νουκλεοτίδια (κόκκινο) Μήκος=300, εξωτερική διάμετρος 18, εσωτερική 4 nm

35 Αυτοσυγκρότηση υπερμοριακων δομών: Ινώδεις ιοί Ιός της μωσαϊκής του καπνού

36 Οι ινώδεις ιοί σαν εκμαγεία για την αυτοοργανωση βιο - νανουλικων Πχ ιός της μωσαϊκής του καπνού Νανοσωματιδια χρυσού σχηματισμένα πάνω στην επιφάνεια του ιού της μωσαϊκής του καπνού Dujardin et al., Nanoletters,, 2003 Scale bar=50 nm

37 Οι ινώδεις ιοί σαν εκμαγεία για την αυτοοργανωση βιο - νανουλικων Ελάσσων (μολυσματική) πρωτεΐνη (giiip) 5 υπομοναδες Φαγος M13: μήκος 900 nm, διάμετρος 7nm 2700 υπομοναδες τηςκύριαςπρωτεΐνης (καλύμματος) του καψιδιου DNA Κύρια πρωτεΐνη (gviiip) Ελάσσων πρωτεΐνη Δυνατότητα ενσωμάτωσης εξωγενών πεπτιδίων (συνδυασμοί ~ 10 9 τυχαίων πεπτιδίων ) στις ελάσσονες πρωτεΐνες (βιβλιοθήκες παρουσίασης φαγων)

38 Παρένθεση: βιβλιοθήκες παρουσίασης φάγων Οι πρωτεϊνες / πεπτίδια συνήθως συντήκονται με την μολυσματική πρωτεϊνη Κατά την διάρκεια της συναρμολόγησης του ιού στα βακτήρια, Οι χιμαιρικές πρωτεϊνες ενσωματώνονται στον ιό Και εκτίθενται στη επιφάνεια του φάγου

39 Παρένθεση: βιβλιοθήκες παρουσίασης φάγων Επιλογή πεπτιδίων μέσω πρόσδεσης σε ακινητοποιημένο σε στερεή επιφάνεια υπόστρωμα

40 Επιλογή αλληλουχιών πεπτιδίων που προσδένονται σε ανόργανα υλικά με χρησιμοποίηση βιβλιοθηκών φαγων Whaley et al. Nature 2000, 405: Flynn et al. Acta Materialia 2003, 51: Prof. Angela Belcher s website:

41 Δεύτερο βήμα: χρησιμοποίηση των ιδιοτήτων σχηματισμού Φάσεων υγρών κρυστάλλων απο τα ιικα σωματίδια για την Κατασκευή νανοδομημενων υλικών Lee et al. Science 2002, 296:

42 Γενική προσέγγιση: οι αλληλουχίες που επιλεχθήκαν εισάγονται Στην κύρια πρωτεΐνη του καψιδίου δημιουργία εκμαγείου Για τον σχηματισμό ημιαγωγιμων νανοκαλωδιων Mao et al., Science 2004, 303:

43 Μελλοντικές προοπτικές : δυνατότητα χρησιμοποίησης μιας και μόνον ιικης δομής για την δημιουργία πολύπλοκων υλικών με ελεγχόμενες διαστάσεις (Flynn et al. Acta Materialia : ) 5880)

44 Παραδείγματα χρησιμοποίησης βιολογικών δομών για την διευθέτηση, συγκρότηση και κατασκευή καινοτόμων υλικών: 1) Χρησιμοποίηση της αυτοοργανωσης των βιολογικών μορίων (DNA, πεπτιδίων, πρωτεϊνών.) για την κατασκευή καινοτόμων υλικών: νανοκαλωδιων, νανοσωληνων... 2) Ινώδεις ιοί, πρωτεϊνικοί κλωβοί και ιικα καψιδια σαν ικριώματα για την κατασκευή νανοκαλωδιων, υγρών κρύσταλλων, κλωβών,, etc

45 Πρωτεϊνικοί «κλωβοί» Βιομιμητική σύνθεση μεταλλικών οξειδίων Το παράδειγμα της φερριτινης Source: Prof. Douglas web site: html

46 Αυτοσυγκροτηση υπερμοριακων δομων: Εικοσαεδρικοι ιοι και φαγοι Τα εικοσαεδρικα καψιδια αποτελούνται από εκατοντάδες όμοιες υπομοναδες πρωτεΐνης

47 -αντιστρεπτές δομικές αλλαγές επιτρέπουν ελεγχόμενη πρόσβαση στο εσωτερικό του καψιδιου -το εσωτερικό περιβάλλον μπορεί να μεταβληθεί με μεταλλαξογενεση -πιθανές εφαρμογές σε εγκαψιδιωση και στόχευση γονιδίων και φαρμάκων, σκιαγραφία, μεταλλωση Prof. Douglas web site:

48 Γενικό σχήμα που δείχνει τις δυνατότητες χρησιμοποίησης ιικων σωματιδίων για την κατασκευή νανοδομημενων υλικών (Flynn et al. Acta Materialia : )

49 ΑΡΘΡΑ ΕΠΙΣΚΟΠΗΣΗΣ -Dickerson et al., (2008) Protein and peptide-directed directed syntheses of inorganic nanomaterials Chemical Reviews 108 : Flynn et al. (2003) Viruses as vehicles for growth, organization and assembly of materials Acta Materialia 51: Gazit,, E. (2007). Self-assembled peptide nanostructures: the design of molecular building blocks and their technological utilization, Chemical Society Reviews, 36, pp Gazit,, E. (2007). Use of biomolecular templates for the fabrication of metal nanowires, Febs Journal, 274, pp Gelain,, F., Horii, A., and Zhang, S. G. (2007). Designer self-assembling peptide scaffolds for 3-D 3 D tissue cell cultures and regenerative medicine, Macromolecular Bioscience, 7, pp Gilead, S., and Gazit,, E. (2005). Self-organization of short peptide fragments: From amyloid fibrils to nanoscale supramolecular assemblies, Supramolecular Chemistry, 17, pp Hauser, C. A. E., and Zhang, S. G. (2010) Designer self-assembling peptide nanofiber biological materials, Chemical Society Reviews, 39, pp

50 ΒΙΒΛΙΟ There is plenty of room for Biology at the bottom.



Διαβάστε περισσότερα



Διαβάστε περισσότερα



Διαβάστε περισσότερα



Διαβάστε περισσότερα


ΒΙΟΛΟΓΙΚΕΣ ΙΝΕΣ ΜΕΤΑΞΙ ΙΣΤΟΙ ΑΡΑΧΝΩΝ ΒΙΟΛΟΓΙΚΕΣ ΙΝΕΣ ΜΕΤΑΞΙ ΙΣΤΟΙ ΑΡΑΧΝΩΝ Βιοσυνθεση του μεταξιου (πρωτεινη) -δυο κυριες πρωτεινες > φιβροινη+σερισινη Κατά την διαρκεια του περασματος από τον αδενα του μεταξοσκωληκα, οι πολυπεπτιδικες αλυσιδες

Διαβάστε περισσότερα


ΦΑΡΜΑΚΕΥΤΙΚΗ ΜΙΚΡΟΒΙΟΛΟΓΙΑ ΦΑΡΜΑΚΕΥΤΙΚΗ ΜΙΚΡΟΒΙΟΛΟΓΙΑ H ΒΙΟΛΟΓΙΑ ΤΩΝ IΩΝ ΙΟΙ ΓΕΝΙΚΕΣ ΙΔΙΟΤΗΤΕΣ Είναι ΔΟΜΕΣ στο όριο μεταξύ ζωντανού και μη ζωντανού. Χρησιμοποιούμε τον όρο ενεργοί-μη ενεργοί παρά ζωντανοί-νεκροί Δεν έχουν κυτταρική

Διαβάστε περισσότερα

BIO111 Μικροβιολογια ιαλεξη 11 Oι Ιοι

BIO111 Μικροβιολογια ιαλεξη 11 Oι Ιοι BIO111 Μικροβιολογια ιαλεξη 11 Oι Ιοι Οι Ιοι= Eγωïστικό DNA/RΝΑ προς αναζήτηση ξενιστή ΠΕΡΙΕΧΟΜΕΝΑ 1. Οι ιοί είναι µικροί αλλά δεν είναι οργανισµοί. Γενικα χαρακτηριστικα. 2. Μορφολογια-Μικροφωτογραφιες

Διαβάστε περισσότερα



Διαβάστε περισσότερα

ΑΠΑΝΤΗΣΕΙΣ. ΘΕΜΑ Α Α1. β Α2. β Α3. δ Α4. γ Α5. γ. ΘΕΜΑ Β Β1. Στήλη Ι Στήλη ΙΙ 1 Α 2 Γ 3 Α 4 Β 5 Α 6 Α 7 Γ


Διαβάστε περισσότερα

ΜΕΤΑΓΡΑΦΗ ΤΟΥ DNA Περετσή Χριστίνα Πιτσικάλη Παναγιώτα

ΜΕΤΑΓΡΑΦΗ ΤΟΥ DNA Περετσή Χριστίνα Πιτσικάλη Παναγιώτα Εργασία στη Βιολογία ΜΕΤΑΓΡΑΦΗ ΤΟΥ DNA Περετσή Χριστίνα Πιτσικάλη Παναγιώτα ΜΕΤΑΓΡΑΦΗ ΤΟΥ DNA Η ροή της πληροφορίας για το σχηματισμό των πρωτεϊνών, προϋποθέτει τη μεταφορά της από το DNA στο RNA (ΜΕΤΑΓΡΑΦΗ).

Διαβάστε περισσότερα



Διαβάστε περισσότερα



Διαβάστε περισσότερα



Διαβάστε περισσότερα

Γενική Μικροβιολογία. Ενότητα 11 η ΕΙΣΑΓΩΓΗ ΣΤΗΝ ΙΟΛΟΓΙΑ

Γενική Μικροβιολογία. Ενότητα 11 η ΕΙΣΑΓΩΓΗ ΣΤΗΝ ΙΟΛΟΓΙΑ Γενική Μικροβιολογία Ενότητα 11 η ΕΙΣΑΓΩΓΗ ΣΤΗΝ ΙΟΛΟΓΙΑ Όνομα καθηγητή: Δ. ΓΕΩΡΓΑΚΟΠΟΥΛΟΣ Όνομα καθηγητή: Γ. ΖΕΡΒΑΚΗΣ Όνομα καθηγητή: ΑΝ. ΤΑΜΠΑΚΑΚΗ Τμήμα: ΕΠΙΣΤΗΜΗΣ ΦΥΤΙΚΗΣ ΠΑΡΑΓΩΓΗΣ ΣΤΟΧΟΙ ΤΟΥ ΜΑΘΗΜΑΤΟΣ

Διαβάστε περισσότερα

Νανο-τεχνολογία. Νανο-Επιστήμη. Προσέγγιση από κάτω προς τα πάνω

Νανο-τεχνολογία. Νανο-Επιστήμη. Προσέγγιση από κάτω προς τα πάνω Νανο-τεχνολογία Ο σχεδιασμός, ο χαρακτηρισμός, η παραγωγή και η εφαρμογή των δομών, συσκευών και συστημάτων, ελέγχοντας τη μορφή και το μέγεθος σε κλίμακα νανόμετρου Νανο-Επιστήμη Η μελέτη των φαινομένων

Διαβάστε περισσότερα

Γενική Μικροβιολογία. Ενότητα 12 η ΕΙΣΑΓΩΓΗ ΣΤΗΝ ΙΟΛΟΓΙΑ

Γενική Μικροβιολογία. Ενότητα 12 η ΕΙΣΑΓΩΓΗ ΣΤΗΝ ΙΟΛΟΓΙΑ Γενική Μικροβιολογία Ενότητα 12 η ΕΙΣΑΓΩΓΗ ΣΤΗΝ ΙΟΛΟΓΙΑ Όνομα καθηγητή: Δ. ΓΕΩΡΓΑΚΟΠΟΥΛΟΣ Όνομα καθηγητή: Γ. ΖΕΡΒΑΚΗΣ Όνομα καθηγητή: ΑΝ. ΤΑΜΠΑΚΑΚΗ Τμήμα: ΕΠΙΣΤΗΜΗΣ ΦΥΤΙΚΗΣ ΠΑΡΑΓΩΓΗΣ ΣΤΟΧΟΙ ΤΟΥ ΜΑΘΗΜΑΤΟΣ

Διαβάστε περισσότερα

ΚΑΤΑΛΥΤΙΚΆ ΥΛΙΚΆ. 1. Η Δομή των Στερεών Καταλυτών. 2. Παρασκευή μη Στηριγμένων Καταλυτών

ΚΑΤΑΛΥΤΙΚΆ ΥΛΙΚΆ. 1. Η Δομή των Στερεών Καταλυτών. 2. Παρασκευή μη Στηριγμένων Καταλυτών ΚΑΤΑΛΥΤΙΚΆ ΥΛΙΚΆ 1. Η Δομή των Στερεών Καταλυτών 2. Παρασκευή μη Στηριγμένων Καταλυτών Οργάνωση της στερεάς ύλης Άτομα-Ιόντα Μόρια (Διαστάσεις στην περιοχή των Å) Συγκροτήματα ατόμων-ιόντων-μορίων / κρυσταλλικά

Διαβάστε περισσότερα

Γενική Μικροβιολογία. Ενότητα 11 η ΕΙΣΑΓΩΓΗ ΣΤΗΝ ΙΟΛΟΓΙΑ

Γενική Μικροβιολογία. Ενότητα 11 η ΕΙΣΑΓΩΓΗ ΣΤΗΝ ΙΟΛΟΓΙΑ Γενική Μικροβιολογία Ενότητα 11 η ΕΙΣΑΓΩΓΗ ΣΤΗΝ ΙΟΛΟΓΙΑ Όνομα καθηγητή: Δ. ΓΕΩΡΓΑΚΟΠΟΥΛΟΣ Όνομα καθηγητή: Γ. ΖΕΡΒΑΚΗΣ Όνομα καθηγητή: ΑΝ. ΤΑΜΠΑΚΑΚΗ Τμήμα: ΕΠΙΣΤΗΜΗΣ ΦΥΤΙΚΗΣ ΠΑΡΑΓΩΓΗΣ ΣΤΟΧΟΙ ΤΟΥ ΜΑΘΗΜΑΤΟΣ

Διαβάστε περισσότερα

Βιολογία Γ Γενικού Λυκείου Θετικής κατεύθυνσης. Κεφάλαιο 1α Το Γενετικό Υλικό

Βιολογία Γ Γενικού Λυκείου Θετικής κατεύθυνσης. Κεφάλαιο 1α Το Γενετικό Υλικό Βιολογία Γ Γενικού Λυκείου Θετικής κατεύθυνσης Κεφάλαιο 1α Το Γενετικό Υλικό Το DNA είναι το γενετικό υλικό Αρχικά οι επιστήμονες θεωρούσαν ότι οι πρωτεΐνες αποτελούσαν το γενετικό υλικό των οργανισμών.

Διαβάστε περισσότερα

) 4 x 10 5 ) 2 x 10 5

) 4 x 10 5 ) 2 x 10 5 1 & ( ) 27 2016 - : ( ) ( ) : (5) 1 5,,,. 1.. DNA. DNA. DNA. RNA. 2.. 46... DNA 1,5 x 10 9. 3. Dolly. DNA.. 1. DNA. 4. (ADA),. AIDS.... 1 5 2 & 5. Ti. Agrobacterium tumefaciens. T 2. DNA.. 1. N,,,. 1.

Διαβάστε περισσότερα


ΜΕΘΟΔΟΛΟΓΙΑ ΑΣΚΗΣΕΩΝ ΣΤΟ 1 ο ΚΕΦΑΛΑΙΟ ΜΕΘΟΔΟΛΟΓΙΑ ΑΣΚΗΣΕΩΝ ΣΤΟ 1 ο ΚΕΦΑΛΑΙΟ Τα προβλήματα αυτού του κεφαλαίου αναφέρονται στον υπολογισμό : 1. νουκλεοτιδίων ή αζωτούχων βάσεων ή πεντοζών ή φωσφορικών ομάδων 2. φωσφοδιεστερικών δεσμών ή μορίων

Διαβάστε περισσότερα

Τμήμα Βιολογίας Μάθημα: ΒΙΟΛΟΓΙΑ ΚΥΤΤΑΡΟΥ Γ εξάμηνο 2014-2015 Διαλέξεις κάθε Τρίτη 13-15 μ.μ. και Παρασκευή 11-13

Τμήμα Βιολογίας Μάθημα: ΒΙΟΛΟΓΙΑ ΚΥΤΤΑΡΟΥ Γ εξάμηνο 2014-2015 Διαλέξεις κάθε Τρίτη 13-15 μ.μ. και Παρασκευή 11-13 Τμήμα Βιολογίας Μάθημα: ΒΙΟΛΟΓΙΑ ΚΥΤΤΑΡΟΥ Γ εξάμηνο 2014-2015 Διαλέξεις κάθε Τρίτη 13-15 μ.μ. και Παρασκευή 11-13 Ισιδώρα Παπασιδέρη, Καθηγήτρια...για περισσότερα... http://kyttariki.biol.uoa.gr, ttp://multimedia.biol.uoa.gr

Διαβάστε περισσότερα

ΘΕΜΑ Α Α1. γ Α2. γ Α3. α Α4. β Α5. β ΘΕΜΑ B B1. B2.

ΘΕΜΑ Α Α1. γ Α2. γ Α3. α Α4. β Α5. β ΘΕΜΑ B B1. B2. ΘΕΜΑ Α Α1. γ (το πριμόσωμα) Α2. γ (οι υποκινητές και οι μεταγραφικοί παράγοντες κάθε γονιδίου) Α3. α (μεταφέρει ένα συγκεκριμένο αμινοξύ στο ριβόσωμα) Α4. β (αποδιάταξη των δύο συμπληρωματικών αλυσίδων)

Διαβάστε περισσότερα


ΠΡΟΓΡΑΜΜΑ ΔΙΑ ΒΙΟΥ ΜΑΘΗΣΗΣ ΑΕΙ ΓΙΑ ΤΗΝ ΕΠΙΚΑΙΡΟΠΟΙΗΣΗ ΓΝΩΣΕΩΝ ΑΠΟΦΟΙΤΩΝ ΑΕΙ (ΠΕΓΑ) ΠΡΟΓΡΑΜΜΑ ΔΙΑ ΒΙΟΥ ΜΑΘΗΣΗΣ ΑΕΙ ΓΙΑ ΤΗΝ ΕΠΙΚΑΙΡΟΠΟΙΗΣΗ ΓΝΩΣΕΩΝ ΑΠΟΦΟΙΤΩΝ ΑΕΙ (ΠΕΓΑ) «Οι σύγχρονες τεχνικές βιο-ανάλυσης στην υγεία, τη γεωργία, το περιβάλλον και τη διατροφή» Department of Biochemistry

Διαβάστε περισσότερα



Διαβάστε περισσότερα

Αρχιτεκτονική της τρισδιάστατης δομής πρωτεϊνών

Αρχιτεκτονική της τρισδιάστατης δομής πρωτεϊνών Αρχιτεκτονική της τρισδιάστατης δομής πρωτεϊνών Βασίλης Προμπονάς, PhD Ερευνητικό Εργαστήριο Βιοπληροφορικής Τμήμα Βιολογικών Επιστημών Νέα Παν/πολη, Γραφείο B161 Πανεπιστήμιο Κύπρου Ταχ.Κιβ. 20537 1678,

Διαβάστε περισσότερα

ΑΠΑΝΤΗΣΕΙΣ. ΘΕΜΑ 1ο 1. γ 2. γ 3. β 4. α 5. δ


Διαβάστε περισσότερα

Γενική Μικροβιολογία. Ενότητα 24 η ΙΟΙ ΒΑΚΤΗΡΙΩΝ, ΦΥΤΩΝ ΚΑΙ ΖΩΩΝ

Γενική Μικροβιολογία. Ενότητα 24 η ΙΟΙ ΒΑΚΤΗΡΙΩΝ, ΦΥΤΩΝ ΚΑΙ ΖΩΩΝ Γενική Μικροβιολογία Ενότητα 24 η ΙΟΙ ΒΑΚΤΗΡΙΩΝ, ΦΥΤΩΝ ΚΑΙ ΖΩΩΝ Όνομα καθηγητή: Δ. ΓΕΩΡΓΑΚΟΠΟΥΛΟΣ Όνομα καθηγητή: Γ. ΖΕΡΒΑΚΗΣ Όνομα καθηγητή: ΑΝ. ΤΑΜΠΑΚΑΚΗ Τμήμα: ΕΠΙΣΤΗΜΗΣ ΦΥΤΙΚΗΣ ΠΑΡΑΓΩΓΗΣ ΣΤΟΧΟΙ ΤΟΥ

Διαβάστε περισσότερα

ρ ε υ ν α Οι ανάγκες για ενέργεια παγκοσμίως αυξάνονται συνεχώς και εκτιμάται ότι θα διπλασιασθούν

ρ ε υ ν α Οι ανάγκες για ενέργεια παγκοσμίως αυξάνονται συνεχώς και εκτιμάται ότι θα διπλασιασθούν Οργανικά Φωτοβολταϊκά Τμήμα Ηλεκτρολογίας & Κέντρο Τεχνολογίας Υλικών και Λέιζερ, ΤΕΙ Κρήτης των Δρ. Εμμανουήλ Κουδουμά, Δρ. Εμμανουηλ Κυμάκη Οι ανάγκες για ενέργεια παγκοσμίως αυξάνονται συνεχώς και εκτιμάται

Διαβάστε περισσότερα



Διαβάστε περισσότερα



Διαβάστε περισσότερα

ΑΠΑΝΤΗΣΕΙΣ. ΘΕΜΑ Α Α1. β Α2. γ Α3. δ Α4. γ Α5. β


Διαβάστε περισσότερα

β) Σχολικό βιβλίο σελ. 96: «Αν κατά τη διάρκεια της µείωσης...τρισωµία», σελ. 97: «Η έλλειψη είναι η απώλεια γενετικού

β) Σχολικό βιβλίο σελ. 96: «Αν κατά τη διάρκεια της µείωσης...τρισωµία», σελ. 97: «Η έλλειψη είναι η απώλεια γενετικού ΠΡΟΣΟΜΟΙΩΣΗ ΑΠΟΛΥΤΗΡΙΩΝ ΕΞΕΤΑΣΕΩΝ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΚΥΡΙΑΚΗ 4 ΜΑΪΟΥ 2014 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ Α Α1. α, Α2. β, Α3. δ, Α4. β, Α5. β ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ Β Β1.

Διαβάστε περισσότερα

Σας αποστέλλουμε τις προτεινόμενες απαντήσεις που αφορούν τα θέματα της Βιολογίας Θετικής Κατεύθυνσης των Εσπερινών Γενικών Λυκείων.

Σας αποστέλλουμε τις προτεινόμενες απαντήσεις που αφορούν τα θέματα της Βιολογίας Θετικής Κατεύθυνσης των Εσπερινών Γενικών Λυκείων. Αθήνα, 27/05/2016 ΠΑΝΕΛΛΗΝΙΑ ΕΝΩΣΗ ΒΙΟΕΠΙΣΤΗΜΟΝΩΝ Σας αποστέλλουμε τις προτεινόμενες απαντήσεις που αφορούν τα θέματα της Βιολογίας Θετικής Κατεύθυνσης των Εσπερινών Γενικών Λυκείων. Η Επιτροπή Παιδείας

Διαβάστε περισσότερα



Διαβάστε περισσότερα


ΙΑΓΩΝΙΣΜΑ ΒΙΟΛΟΓΙΑΣ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΙΑΓΩΝΙΣΜΑ ΒΙΟΛΟΓΙΑΣ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΚΕΦΑΛΑΙΟ 1: Το γενετικό υλικό ΘΕΜΑ: 1 ο (Μονάδες 25 ) Να επιλέξετε τη σωστή απάντηση στις παρακάτω ερωτήσεις. 1. Το πείραµα των Hershey και Chase ήταν:

Διαβάστε περισσότερα

Η δοµή και η λειτουργία του κυτταροσκελετού: Ο κυτταροσκελετός είναι ένα δίκτυο από ινίδια που εκτείνονται σε όλο το κυτταρόπλασµα και σχηµατίζουν

Η δοµή και η λειτουργία του κυτταροσκελετού: Ο κυτταροσκελετός είναι ένα δίκτυο από ινίδια που εκτείνονται σε όλο το κυτταρόπλασµα και σχηµατίζουν Η δοµή και η λειτουργία του κυτταροσκελετού: Ο κυτταροσκελετός είναι ένα δίκτυο από ινίδια που εκτείνονται σε όλο το κυτταρόπλασµα και σχηµατίζουν ένα δυναµικό σκελετό που χρησιµεύει στη στήριξη και την

Διαβάστε περισσότερα


Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗ ΚΑΤΕΥΘΥΝΣΗ ΒΙΟΛΟΓΙΑ ΑΠΑΝΤΗΣΕΙΣ ÏÅÖÅ 1 Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗ ΚΑΤΕΥΘΥΝΣΗ ΒΙΟΛΟΓΙΑ ΘΕΜΑ 1 ο Α. 1 - Γ 2 - Β 3-4 - Γ 5 - Β. 1 - Σ 2 - Λ 3 - Λ 4 - Λ 5 - Σ ΘΕΜΑ 2 ο ΑΠΑΝΤΗΣΕΙΣ 1. Κάθε είδος αντισώµατος που αναγνωρίζει έναν αντιγονικό καθοριστή παράγεται

Διαβάστε περισσότερα


ΑΠΑΝΤΗΣΕΙΣ ΣΤΗ ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ 24 ΜΑΪΟΥ 2013 ΑΠΑΝΤΗΣΕΙΣ ΣΤΗ ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ 24 ΜΑΪΟΥ 2013 ΘΕΜΑ Α Α1. γ Α2. β Α3. α Α4. δ Α5. α ΘΕΜΑ Β Β1. Σελ. 123 124 σχολ. βιβλίου: «Η διαδικασία που ακολουθείται παράγουν το ένζυμο ADA». Β2. Σελ. 133 σχολ.

Διαβάστε περισσότερα

Βιοϋλικά. Ενότητα 5: Πρωτεΐνες, Κύτταρα, Ιστοί Αλληλεπίδραση με Βιοϋλικά. Ελευθέριος Αμανατίδης Πολυτεχνική Σχολή Τμήμα Χημικών Μηχανικών

Βιοϋλικά. Ενότητα 5: Πρωτεΐνες, Κύτταρα, Ιστοί Αλληλεπίδραση με Βιοϋλικά. Ελευθέριος Αμανατίδης Πολυτεχνική Σχολή Τμήμα Χημικών Μηχανικών Βιοϋλικά Ενότητα 5: Πρωτεΐνες, Κύτταρα, Ιστοί Αλληλεπίδραση με Βιοϋλικά Ελευθέριος Αμανατίδης Πολυτεχνική Σχολή Τμήμα Χημικών Μηχανικών Περιεχόμενα ενότητας Πρωτεΐνες Δομή και είδη Λειτουργίες πρωτεϊνών

Διαβάστε περισσότερα

Γ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΠΡΟΣΑΝΑΤΟΛΙΣΜΟΥ ΘΕΤΙΚΩΝ ΣΠΟΥΔΩΝ. Ημερομηνία: Κυριακή 23 Οκτωβρίου 2016 Διάρκεια Εξέτασης: 3 ώρες ΕΚΦΩΝΗΣΕΙΣ

Γ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΠΡΟΣΑΝΑΤΟΛΙΣΜΟΥ ΘΕΤΙΚΩΝ ΣΠΟΥΔΩΝ. Ημερομηνία: Κυριακή 23 Οκτωβρίου 2016 Διάρκεια Εξέτασης: 3 ώρες ΕΚΦΩΝΗΣΕΙΣ ΤΑΞΗ: ΜΑΘΗΜΑ: Γ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΠΡΟΣΑΝΑΤΟΛΙΣΜΟΥ ΘΕΤΙΚΩΝ ΣΠΟΥΔΩΝ Ημερομηνία: Κυριακή 23 Οκτωβρίου 2016 Διάρκεια Εξέτασης: 3 ώρες ΕΚΦΩΝΗΣΕΙΣ ΘΕΜΑ Α Στις ημιτελείς προτάσεις Α1 Α4 να γράψετε στο

Διαβάστε περισσότερα

σύγχρονο προπαρασκευή για Α.Ε.Ι. & Τ.Ε.Ι. & Group µαθητικό φροντιστήριο Γραβιάς 85 ΚΗΠΟΥΠΟΛΗ

σύγχρονο προπαρασκευή για Α.Ε.Ι. & Τ.Ε.Ι. & Group µαθητικό φροντιστήριο Γραβιάς 85 ΚΗΠΟΥΠΟΛΗ σύγχρονο Φάσµα & Group προπαρασκευή για Α.Ε.Ι. & Τ.Ε.Ι. µαθητικό φροντιστήριο Γραβιάς 85 ΚΗΠΟΥΠΟΛΗ 210 50 51 557 210 50 56 296 25ης Μαρτίου 111 ΠΕΤΡΟΥΠΟΛΗ 210 50 20 990 210 50 27 990 25ης Μαρτίου 74 ΠΕΤΡΟΥΠΟΛΗ

Διαβάστε περισσότερα

Μάθηµα: Κίνηση πρωτεινών

Μάθηµα: Κίνηση πρωτεινών Μάθηµα: Κίνηση πρωτεινών ιάλεξη 1:Σύνθεση πρωτεινών- Ριβόσωµα Κώστας Τοκατλίδης Η σύνθεση πρωτεινών απαιτεί την µετάφραση αλληλουχίας νουκλεοτιδίων σε αλληλουχία αµινοξέων Οι συνθετάσες των αµινοακυλο-trna

Διαβάστε περισσότερα

πρωτεϊνες νουκλεϊκά οξέα Βιολογικά Μακρομόρια υδατάνθρακες λιπίδια

πρωτεϊνες νουκλεϊκά οξέα Βιολογικά Μακρομόρια υδατάνθρακες λιπίδια πρωτεϊνες νουκλεϊκά οξέα Βιολογικά Μακρομόρια υδατάνθρακες λιπίδια Περιγραφή μαθήματος Επανάληψη σημαντικών εννοιών από την Οργανική Χημεία Χημική σύσταση των κυττάρων Μονοσακχαρίτες Αμινοξέα Νουκλεοτίδια

Διαβάστε περισσότερα


ΘΕΜΑ 1 Ο ΜΑΘΗΜΑ / ΤΑΞΗ : ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΣΕΙΡΑ: ΗΜΕΡΟΜΗΝΙΑ: 22/09/2013 ΜΑΘΗΜΑ / ΤΑΞΗ : ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΣΕΙΡΑ: ΗΜΕΡΟΜΗΝΙΑ: 22/09/2013 ΘΕΜΑ 1 Ο Να επιλέξετε την φράση που συμπληρώνει ορθά κάθε μία από τις ακόλουθες προτάσεις: 1. Το ζεύγος των φυλετικών

Διαβάστε περισσότερα

Γ1. Το γνώρισμα για το μέγεθος των φτερών ελέγχεται από αυτοσωμικό γονίδιο.

Γ1. Το γνώρισμα για το μέγεθος των φτερών ελέγχεται από αυτοσωμικό γονίδιο. ΠΑΝΕΛΛΗΝΙΕΣ ΒΙΟΛΟΓΙΑΣ ΚΑΤΕΥΘΥΝΣΗΣ 2013 AΠΑΝΤΗΣΕΙΣ ΘΕΜΑ Α Α1.γ Α2.β Α3.α Α4.δ Α5.α ΘΕΜΑ Β Β1. Η γονιδιακή θεραπεία εφαρμόστηκε για πρώτη φορά το 1990 σε ένα κορίτσι που έπασχε από έλλειψη της απαμινάσης

Διαβάστε περισσότερα



Διαβάστε περισσότερα

ΚΕΦΑΛΑΙΟ 1. Γενική επισκόπηση των κυττάρων και της κυτταρικής βιολογικής έρευνας. Ακαδημαϊκές Εκδόσεις 2011 Το κύτταρο-μια Μοριακή Προσέγγιση 1

ΚΕΦΑΛΑΙΟ 1. Γενική επισκόπηση των κυττάρων και της κυτταρικής βιολογικής έρευνας. Ακαδημαϊκές Εκδόσεις 2011 Το κύτταρο-μια Μοριακή Προσέγγιση 1 ΚΕΦΑΛΑΙΟ 1 Γενική επισκόπηση των κυττάρων και της κυτταρικής βιολογικής έρευνας Ακαδημαϊκές Εκδόσεις 2011 Το κύτταρο-μια Μοριακή Προσέγγιση 1 ΠΙΝΑΚΑΣ 1.1 Προκαρυωτικά και ευκαρυωτικά κύτταρα Ακαδημαϊκές

Διαβάστε περισσότερα



Διαβάστε περισσότερα

ΚΕΦΑΛΑΙΟ 29 Σύνθεση πρωτεϊνών

ΚΕΦΑΛΑΙΟ 29 Σύνθεση πρωτεϊνών ΚΕΦΑΛΑΙΟ 29 Σύνθεση πρωτεϊνών Αφού είδαμε πως το DNA αντιγράφεται και μεταγράφεται, τώρα θα εξετάσουμε τη διαδικασία με την παράγονται οι πρωτεϊνες Στην ουσία θα πρέπει να συνδυαστεί ο κώδικας δύο βιβλιοθηκών,

Διαβάστε περισσότερα

πρωτεΐνες πολυμερείς ουσίες δομούν λειτουργούν λευκώματα 1.Απλές πρωτεΐνες 2.Σύνθετες πρωτεΐνες πρωτεΐδια μη πρωτεϊνικό μεταλλοπρωτεΐνες

πρωτεΐνες πολυμερείς ουσίες δομούν λειτουργούν λευκώματα 1.Απλές πρωτεΐνες 2.Σύνθετες πρωτεΐνες πρωτεΐδια μη πρωτεϊνικό μεταλλοπρωτεΐνες ΠΡΩΤΕΙΝΕΣ Οι πρωτεΐνες είναι πολυμερείς ουσίες με κυρίαρχο και πρωταρχικό ρόλο στη ζωή. Πρωτεΐνες είναι οι ουσίες που κυρίως δομούν και λειτουργούν τους οργανισμούς. Λέγονται και λευκώματα λόγω του λευκού

Διαβάστε περισσότερα

3. Σε ένα σωματικό κύτταρο ανθρώπου που βρίσκεται στη μεσόφαση πριν την αντιγραφή υπάρχουν:

3. Σε ένα σωματικό κύτταρο ανθρώπου που βρίσκεται στη μεσόφαση πριν την αντιγραφή υπάρχουν: ΜΑΘΗΜΑ / ΤΑΞΗ : ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΣΕΙΡΑ: ΗΜΕΡΟΜΗΝΙΑ: ΘΕΜΑ 1 Ο Α. Να επιλέξετε τη φράση που συμπληρώνει ορθά κάθε μία από τις ακόλουθες προτάσεις: 1. Στο οπερόνιο της λακτόζης: Α. Η πρωτεΐνη καταστολέας

Διαβάστε περισσότερα



Διαβάστε περισσότερα


ΝΑΝΟΤΕΧΝΟΛΟΓΙΑ ΣΤΗΝ ΚΑΘΗΜΕΡΙΝΗ ΖΩΗ ΝΑΝΟΤΕΧΝΟΛΟΓΙΑ ΣΤΗΝ ΚΑΘΗΜΕΡΙΝΗ ΖΩΗ Επιβλέπων καθηγητής: Μαρράς Σωτήρης Τάξη: Α Λυκείου Έτος: 2013-2014 Περίγραμμα παρουσίασης Οι βασικές αρχές της νανοτεχνολογίας Η νανοτεχνολογία στην ιατρική Επίδραση

Διαβάστε περισσότερα

Η ασβεστοποίηση ως προηγμένη επεξεργασία για τηνεξυγίανση ξγ ητης λυματολάσπης και την μείωση των οσμών

Η ασβεστοποίηση ως προηγμένη επεξεργασία για τηνεξυγίανση ξγ ητης λυματολάσπης και την μείωση των οσμών Η ασβεστοποίηση ως προηγμένη επεξεργασία για τηνεξυγίανση ξγ ητης λυματολάσπης και την μείωση των οσμών ημητριάδης Γεώργιος 2310688380 caohellas@the.forthnet.gr Λυματολάσπη Στόχοι της επεξεργασίας της

Διαβάστε περισσότερα

Μάθημα 23 ο. Μεταλλικός Δεσμός Θεωρία Ζωνών- Ημιαγωγοί Διαμοριακές Δυνάμεις

Μάθημα 23 ο. Μεταλλικός Δεσμός Θεωρία Ζωνών- Ημιαγωγοί Διαμοριακές Δυνάμεις Μάθημα 23 ο Μεταλλικός Δεσμός Θεωρία Ζωνών- Ημιαγωγοί Διαμοριακές Δυνάμεις Μεταλλικός Δεσμός Μοντέλο θάλασσας ηλεκτρονίων Πυρήνες σε θάλασσα e -. Μεταλλική λάμψη. Ολκιμότητα. Εφαρμογή δύναμης Γενική και

Διαβάστε περισσότερα


ΠΡΟΣΟΜΟΙΩΤΙΚΟ ΔΙΑΓΩΝΙΣΜΑ ΒΙΟΛΟΓΙΑΣ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Κεφάλαια: 1 o 2 o ΑΠΑΝΤΗΣΕΙΣ ΠΡΟΣΟΜΟΙΩΤΙΚΟ ΔΙΑΓΩΝΙΣΜΑ ΒΙΟΛΟΓΙΑΣ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Κεφάλαια: 1 o 2 o ΑΠΑΝΤΗΣΕΙΣ ΖΗΤΗΜΑ 1 ο Να επιλέξτε το γράμμα που αντιστοιχεί στη σωστή απάντηση ή στη φράση που συμπληρώνει σωστά την πρόταση. 1.

Διαβάστε περισσότερα

Το κεντρικό δόγμα (The central dogma)

Το κεντρικό δόγμα (The central dogma) Οι βασικές μοριακές γενετικές διαδικασίες Αντιγραφή Μεταγραφή Μετάφραση ΠΡΩΤΕΪΝΗ Το κεντρικό δόγμα (The central dogma) Σύσταση νουκλεοτιδίων του DNA και του RNA Α 5 -άκρο Θυμίνη (Θ) Β 5 άκρο Αδενίνη (Α)

Διαβάστε περισσότερα



Διαβάστε περισσότερα



Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ. Παραδόσεις του μαθήματος γενικής παιδείας (Β λυκείου) Επιμέλεια: ΑΡΓΥΡΗΣ ΙΩΑΝΝΗΣ Βιολόγος M.Sc. Καθηγητής 3 ου λυκ.

ΒΙΟΛΟΓΙΑ. Παραδόσεις του μαθήματος γενικής παιδείας (Β λυκείου) Επιμέλεια: ΑΡΓΥΡΗΣ ΙΩΑΝΝΗΣ Βιολόγος M.Sc. Καθηγητής 3 ου λυκ. ΒΙΟΛΟΓΙΑ Παραδόσεις του μαθήματος γενικής παιδείας (Β λυκείου) Επιμέλεια: ΑΡΓΥΡΗΣ ΙΩΑΝΝΗΣ Βιολόγος M.Sc. Καθηγητής 3 ου λυκ. Ηλιούπολης Κεφάλαιο 1ο ΒΙΟΛΟΓΙΚΑ ΜΑΚΡΟΜΟΡΙΑ Η ΙΕΡΑΡΧΙΑ ΤΩΝ ΒΙΟΜΟΡΙΩΝ ΠΡΟΔΡΟΜΕΣ

Διαβάστε περισσότερα

Βιολογία Γενικής Παιδείας Β Λυκείου

Βιολογία Γενικής Παιδείας Β Λυκείου Απρίλιος Μάιος 12 Βιολογία Γενικής Παιδείας Β Λυκείου Βιολογία Γενικής Παιδείας Β Λυκείου (Ερωτήσεις που παρουσιάζουν ενδιαφέρον) 1. Τι είναι τα βιομόρια και ποια είναι τα βασικά χαρακτηριστικά τους; Βιομόρια

Διαβάστε περισσότερα

Βιολογία. Θετικής Κατεύθυνσης

Βιολογία. Θετικής Κατεύθυνσης Βιολογία Θετικής Κατεύθυνσης Κεφάλαιο 4ο ΤΕΧΝΟΛΟΓΊΑ ΤΟΥ ΑΝΑΣΥΝΔΥΑΣΜΈΝΟΥ DNA Γενετική Μηχανική 3 Είναι ο κλάδος της Βιολογίας που περιλαμβάνει τις τεχνικές με τις οποίες ο άνθρωπος επεμβαίνει στο γενετικό

Διαβάστε περισσότερα

1. Ο Griffith στα πειράματά του χρησιμοποίησε:

1. Ο Griffith στα πειράματά του χρησιμοποίησε: ΜΑΘΗΜΑ / ΤΑΞΗ : ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΣΕΙΡΑ: ΧΕΙΜΕΡΙΝΑ ΗΜΕΡΟΜΗΝΙΑ: 27/11/11 ΘΕΜΑ 1 Ο Α. Να επιλέξετε τη φράση που συμπληρώνει ορθά κάθε μία από τις ακόλουθες προτάσεις: 1. Ο Griffith στα πειράματά

Διαβάστε περισσότερα



Διαβάστε περισσότερα

Βιολογία Κατεύθυνσης Γ Λυκείου

Βιολογία Κατεύθυνσης Γ Λυκείου Βιολογία Κατεύθυνσης Γ Λυκείου 2013-2014 ΓΕ.Λ. ΣΟΡΩΝΗΣ ΜΑΣΤΗ ΧΡΙΣΤΙΝΑ Κεφάλαιο 1 ΤΟ ΓΕΝΕΤΙΚΟ ΥΛΙΚΟ Ταξίδι στο χρόνο 1869 Απομονώνεται DNA από τον κυτταρικό πυρήνα 1903 Αποδεικνύεται ότι τα χρωμοσώματα

Διαβάστε περισσότερα



Διαβάστε περισσότερα

Τύποι νουκλεϊκών οξέων

Τύποι νουκλεϊκών οξέων Τύποι νουκλεϊκών οξέων DNA ένας τύπος, μια λειτουργία RNA - 4 τύποι, 4 λειτουργίες Ριβοσωμικό RNA Αγγελιαφόρο RNA Μεταφορικό RNA Καταλυτικό RNA Βιοχημεία Ι Δ-1 Βιοχημεία Ι Δ-2 3 5 φωσφοδιεστερικός δεσμός

Διαβάστε περισσότερα

(αδρές αποικίες) Θέρμανση (λείες αποικίες) ζωντανά ποντίκια ζωντανά ποντίκια νεκρά ποντίκια

(αδρές αποικίες) Θέρμανση (λείες αποικίες) ζωντανά ποντίκια ζωντανά ποντίκια νεκρά ποντίκια Το DNA είναι το γενετικό υλικό 1. Πείραμα Griffith (1928) Βακτήριο πνευμονιόκοκκου (Diplococcus pneumoniae) Χωρίς κάλυμμα Με κάλυμμα (αδρές αποικίες) Θέρμανση (λείες αποικίες) ζωντανά ποντίκια ζωντανά

Διαβάστε περισσότερα

Ενδεικτικές απαντήσεις βιολογίας κατεύθυνσης 2014

Ενδεικτικές απαντήσεις βιολογίας κατεύθυνσης 2014 Θέμα Α Α1. δ Α2. γ Α3. β Α4. γ Α5. β Θέμα Β ΑΓ.ΚΩΝΣΤΑΝΤΙΝΟΥ 11 -- ΠΕΙΡΑΙΑΣ -- 18532 -- ΤΗΛ. 210-4224752, 4223687 Ενδεικτικές απαντήσεις βιολογίας κατεύθυνσης 2014 Β1. 4 2 1 6 3 5 Β2. α. DNA πολυμεράση

Διαβάστε περισσότερα


ΝΑΝΟΚΛΙΜΑΚΑ ΚΑΙ ΝΑΝΟΤΕΧΝΟΛΟΓΙΑ NTSE - Nan Technlgy Science Educatin Prject N: 511787-LLP-1-2010-1-TR-KA3-KA3MP ΟΔΗΓΙΕΣ ΓΙΑ ΜΑΘΗΤΕΣ ΝΑΝΟΚΛΙΜΑΚΑ ΚΑΙ ΝΑΝΟΤΕΧΝΟΛΟΓΙΑ Εικονικό εργαστήριο: http://vlab.ntse-nantech.eu/nanvirtuallab/ 1 ΜΕΛΕΤΗ

Διαβάστε περισσότερα

ΤΑ ΜΟΡΙΑ ΤΗΣ ΖΩΗΣ. Τι γνωρίζετε για τους υδατάνθρακες;

ΤΑ ΜΟΡΙΑ ΤΗΣ ΖΩΗΣ. Τι γνωρίζετε για τους υδατάνθρακες; 1 ΤΑ ΜΟΡΙΑ ΤΗΣ ΖΩΗΣ Το κύτταρο αποτελείται από χηµικές ενώσεις, στις οποίες περιλαµβάνονται τα µικρά βιολογικά µόρια και τα βιολογικά µακροµόρια. Στα µικρά βιολογικά µόρια ανήκουν, τα ανόργανα στοιχεία

Διαβάστε περισσότερα

Δομή πρωτεϊνών: Τριτοταγής διαμόρφωση της δομής

Δομή πρωτεϊνών: Τριτοταγής διαμόρφωση της δομής Δομή πρωτεϊνών: Τριτοταγής διαμόρφωση της δομής - Αναφέρεται στην αναδίπλωση της πολυπεπτιδικής αλυσίδας πάνω στον εαυτό της και στο τελικό σχήμα που θα πάρει στο χώρο -Σ αυτή τη διαμόρφωση σημαντικό ρόλο

Διαβάστε περισσότερα

Νικόλαος Σιαφάκας Λέκτορας Διαγνωστικής Ιολογίας Εργαστήριο Κλινικής Μικροβιολογίας ΠΓΝ «ΑΤΤΙΚΟΝ»

Νικόλαος Σιαφάκας Λέκτορας Διαγνωστικής Ιολογίας Εργαστήριο Κλινικής Μικροβιολογίας ΠΓΝ «ΑΤΤΙΚΟΝ» Νικόλαος Σιαφάκας Λέκτορας Διαγνωστικής Ιολογίας Εργαστήριο Κλινικής Μικροβιολογίας ΠΓΝ «ΑΤΤΙΚΟΝ» DNA RNA: ΑΝΤΙΓΡΑΦΗ, ΜΕΤΑΓΡΑΦΗ, ΜΕΤΑΦΡΑΣΗ DNA RNA: Βασικά Χαρακτηριστικά Ρόλος Κεντικό Δόγμα της Βιολογίας:

Διαβάστε περισσότερα



Διαβάστε περισσότερα


ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ 22 ΜΑΪΟΥ 2015 ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ Α Α1. Β Α2. Γ Α3. Α Α4. Α5. Γ ΘΕΜΑ Β ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ 22 ΜΑΪΟΥ 2015 ΑΠΑΝΤΗΣΕΙΣ B1. Α (Σωµατικά κύτταρα στην αρχή της µεσόφασης): 1, 4, 5, 6 Β (Γαµέτες): 2, 3, 7, 8 Β2. (Κάθε

Διαβάστε περισσότερα

Ποιες είναι οι ομοιότητες και οι διαφορές μεταξύ της αντιγραφής και της

Ποιες είναι οι ομοιότητες και οι διαφορές μεταξύ της αντιγραφής και της ΚΕΦ. 2 ο ΕΡΩΤΗΣΕΙΣ ΚΡΙΣΕΩΣ Ποιες είναι οι ομοιότητες και οι διαφορές μεταξύ της αντιγραφής και της μεταγραφής; Διαφορές Αντιγραφή Μεταγραφή 1. Διατηρείται και μεταβιβάζεται η 1. Μεταβιβάζεται η γενετική

Διαβάστε περισσότερα

Βιολογία Θετικής Κατεύθυνσης. 4 ο Κεφάλαιο - Τεχνολογία του ανασυνδυασμένου DNA

Βιολογία Θετικής Κατεύθυνσης. 4 ο Κεφάλαιο - Τεχνολογία του ανασυνδυασμένου DNA Βιολογία Θετικής Κατεύθυνσης 4 ο Κεφάλαιο - Τεχνολογία του ανασυνδυασμένου DNA Τεχνολογία ανασυνδυασμένου DNA Αναπτύχθηκε λόγω της ανακάλυψης: i. Περιοριστικών ενδονουκλεασών ii. Ειδικών φορέων DNA Έδωσε

Διαβάστε περισσότερα



Διαβάστε περισσότερα



Διαβάστε περισσότερα

Η ζητούμενη σειρά έχει ως εξής: αδενίνη < νουκλεοτίδιο < νουκλεόσωμα < γονίδιο < χρωματίδα < χρωμόσωμα < γονιδίωμα.

Η ζητούμενη σειρά έχει ως εξής: αδενίνη < νουκλεοτίδιο < νουκλεόσωμα < γονίδιο < χρωματίδα < χρωμόσωμα < γονιδίωμα. ΚΕΦ. 1 ο ΕΡΩΤΗΣΕΙΣ ΚΡΙΣΕΩΣ 1. Να κατατάξετε σε σειρά αυξανόμενου μεγέθους τις παρακάτω έννοιες που σχετίζονται με το γενετικό υλικό των οργανισμών: νουκλεόσωμα, χρωμόσωμα, αδενίνη, νουκλεοτίδιο, γονίδιο

Διαβάστε περισσότερα



Διαβάστε περισσότερα

ΚεφάΠαιο 4 ΤεχνοΠογία ίου ανασυνουασμένου DNA

ΚεφάΠαιο 4 ΤεχνοΠογία ίου ανασυνουασμένου DNA ΚεφάΠαιο 4 ΤεχνοΠογία ίου ανασυνουασμένου DNA 1. Γιατί οι περιοριστικές ενδονουκλεάσες και οι φορείς κλωνοποίησης είναι απαραίτητα εργαλεία για τη Γενετική Μηχανική; Οι περιοριστικές ενδονουκλεάσες είναι

Διαβάστε περισσότερα


ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ Α Α1 δ Α2 γ Α3 β Α4 γ Α5 β ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ Β Β1. 4 2 1 6 3 5 Β2. α. DNA πολυμεράση β. πριμόσωμα γ. DNA δεσμάση δ. DNA ελκάση ε. RNA πολυμεράση Β3. Σχολικό βιβλίο, Σελ.: 98: «Η διάγνωση των

Διαβάστε περισσότερα

Πανελλήνιες Εξετάσεις Ημερήσιων Γενικών Λυκείων. Εξεταζόμενο Μάθημα: Βιολογία Θετικής Κατεύθυνσης, Ημ/νία: 24 Μαΐου 2013. Απαντήσεις Θεμάτων

Πανελλήνιες Εξετάσεις Ημερήσιων Γενικών Λυκείων. Εξεταζόμενο Μάθημα: Βιολογία Θετικής Κατεύθυνσης, Ημ/νία: 24 Μαΐου 2013. Απαντήσεις Θεμάτων Πανελλήνιες Εξετάσεις Ημερήσιων Γενικών Λυκείων Εξεταζόμενο Μάθημα: Βιολογία Θετικής Κατεύθυνσης, Ημ/νία: 24 Μαΐου 2013 Απαντήσεις Θεμάτων ΘΕΜΑ Α Α1. Βασική μονάδα οργάνωσης αποτελεί το Γ. νουκλεόσωμα

Διαβάστε περισσότερα



Διαβάστε περισσότερα

Τα χημικά στοιχεία που είναι επικρατέστερα στους οργανισμούς είναι: i..

Τα χημικά στοιχεία που είναι επικρατέστερα στους οργανισμούς είναι: i.. ΦΥΛΛΟ ΕΡΓΑΣΙΑΣ ΣΤΟ 1 ο ΚΕΦΑΛΑΙΟ «XHMIKH ΣΥΣΤΑΣΗ ΤΟΥ ΚΥΤΤΑΡΟΥ» ΕΙΣΑΓΩΓΗ ΚΑΙ Η ΧΗΜΕΙΑ ΤΗΣ ΖΩΗΣ Α. ΔΡΑΣΤΗΡΙΟΤΗΤΕΣ ΜΕΣΑ ΣΤΗΝ ΤΑΞΗ 1. Όταν αναφερόμαστε στον όρο «Χημική Σύσταση του Κυττάρου», τί νομίζετε ότι

Διαβάστε περισσότερα


ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ Α. Α1. δ Α2. γ Α3. β Α4. γ Α5. β ΘΕΜΑ Β. Β1. 4-2-1-6-3-5 Β2. α) DNA πολυμεράσες β) πριμόσωμα γ) DNA δεσμάσεις δ) DNA ελικάσες ε) RNA πολυμεράσες Β3. σελ 98:

Διαβάστε περισσότερα


ΟΜΟΣΠΟΝ ΙΑ ΕΚΠΑΙ ΕΥΤΙΚΩΝ ΦΡΟΝΤΙΣΤΩΝ ΕΛΛΑ ΟΣ (Ο.Ε.Φ.Ε.) ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ 2014 ΤΑΞΗ: ΚΑΤΕΥΘΥΝΣΗ: ΜΑΘΗΜΑ: Γ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗ ΒΙΟΛΟΓΙΑ Ηµεροµηνία: Παρασκευή 25 Απριλίου 2014 ιάρκεια Εξέτασης: 3 ώρες ΕΚΦΩΝΗΣΕΙΣ ΘΕΜΑ Α Να γράψετε στο τετράδιό σας τον αριθµό καθεµιάς από τις παρακάτω

Διαβάστε περισσότερα

KΕΦΑΛΑΙΟ 1ο Χημική σύσταση του κυττάρου. Να απαντήσετε σε καθεμιά από τις παρακάτω ερωτήσεις με μια πρόταση:

KΕΦΑΛΑΙΟ 1ο Χημική σύσταση του κυττάρου. Να απαντήσετε σε καθεμιά από τις παρακάτω ερωτήσεις με μια πρόταση: KΕΦΑΛΑΙΟ 1ο Χημική σύσταση του κυττάρου Ενότητα 1.1: Χημεία της ζωής Ενότητα 2.1: Μακρομόρια Να απαντήσετε σε καθεμιά από τις παρακάτω ερωτήσεις με μια πρόταση: 1. Για ποιο λόγο θεωρείται αναγκαία η σταθερότητα

Διαβάστε περισσότερα

1.Μαθησιακοί στόχοι του μαθήματος

1.Μαθησιακοί στόχοι του μαθήματος BIOXHMEIA, TOMOΣ I ΠANEΠIΣTHMIAKEΣ EKΔOΣEIΣ KPHTHΣ 1.Μαθησιακοί στόχοι του μαθήματος της ΒΙΟΧΗΜΕΙΑΣ (ΕΤΥ-232) 1)εξοικείωση των φοιτητών με τον μοριακό σχεδιασμό της ζωής 2)εμπέδωση της δομής και λειτουργίας

Διαβάστε περισσότερα

ΠΑΝΕΛΛΗΝΙΕΣ Απαντήσεις Βιολογίας κατεύθυνσης (ΗΜΕΡΗΣΙΟ)

ΠΑΝΕΛΛΗΝΙΕΣ Απαντήσεις Βιολογίας κατεύθυνσης (ΗΜΕΡΗΣΙΟ) ΠΑΝΕΛΛΗΝΙΕΣ 2016 Απαντήσεις Βιολογίας κατεύθυνσης (ΗΜΕΡΗΣΙΟ) Μιχάλης Χαλικιόπουλος ΘΕΜΑ Α Α1 β Α2 β Α3 δ Α4 γ Α5 γ ΘΕΜΑ Β Β1 Β2 1 Α 2 Γ 3 Α 4 Β 5 Α 6 Α 7 Γ Τα μεταφασικά χρωμοσώματα ενός κυττάρου διαφέρουν

Διαβάστε περισσότερα


Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗ ΚΑΤΕΥΘΥΝΣΗ ΒΙΟΛΟΓΙΑ ΑΠΑΝΤΗΣΕΙΣ ÏÅÖÅ 1 Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗ ΚΑΤΕΥΘΥΝΣΗ ΒΙΟΛΟΓΙΑ ΘΕΜΑ 1 ο 1 γ 2 δ 3 β 4 α 5 γ ΘΕΜΑ 2 ο ΑΠΑΝΤΗΣΕΙΣ Μονάδες 25 (5Χ5) Α. ιαγονιδιακά ζώα ονοµάζονται εκείνα στα οποία το γενετικό τους υλικό έχει τροποποιηθεί µε την

Διαβάστε περισσότερα



Διαβάστε περισσότερα



Διαβάστε περισσότερα

8. Σε στέλεχος του βακτηρίου E.coli δε λειτουργεί το γονίδιο που παράγει τον καταστολέα του οπερόνιου της λακτόζης. Ποιο είναι το αποτέλεσμα σε σχέση

8. Σε στέλεχος του βακτηρίου E.coli δε λειτουργεί το γονίδιο που παράγει τον καταστολέα του οπερόνιου της λακτόζης. Ποιο είναι το αποτέλεσμα σε σχέση Γονιδιακή ρύθμιοη 1. Εντοπίστε δύο διαφορές στον έλεγχο της γονιδιακής έκφρασης ανάμεσα στους προκαρυωτικούς και στους ευκαρυωτικούς οργανισμούς. Α. Η ρύθμιση της γσνιδιακής έκφρασης στους προκαρυωτικούς

Διαβάστε περισσότερα


ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ 1 ο Να επιλέξετε τη σωστή απάντηση: 1. Σιωπηλή μετάλλαξη λόγω αντικατάστασης βάσης δε μπορεί να επιτευχθεί στο κωδικόνιο που κωδικοποιεί: α. τη βαλίνη γ. τη μεθειονίνη

Διαβάστε περισσότερα

Μετάφραση - Translation Μετα-μεταφραστικές τροποποιήσεις

Μετάφραση - Translation Μετα-μεταφραστικές τροποποιήσεις Μετάφραση Πρωτεϊνοσύνθεση Μετάφραση - Translation Διαδικασία κατά την οποία η γενετική πληροφορία μετατρέπεται σε λειτουργικά μόρια, τις πρωτεΐνες. Μετα-μεταφραστικές τροποποιήσεις Post-translational modifications

Διαβάστε περισσότερα

Θέματα πριν τις εξετάσεις. Καλό διάβασμα Καλή επιτυχία

Θέματα πριν τις εξετάσεις. Καλό διάβασμα Καλή επιτυχία Θέματα πριν τις εξετάσεις Καλό διάβασμα Καλή επιτυχία 2013-2014 Θέματα πολλαπλής επιλογής Μετουσίωση είναι το φαινόμενο α. κατά το οποίο συνδέονται δύο αμινοξέα για τον σχηματισμό μιας πρωτεΐνης β. κατά

Διαβάστε περισσότερα