Εφαρμογές της αυτο-οργανωσης και συγκρότησης υπερμοριaκών βιολογικών δομών (self-assembly) στην επιστήμη των υλικών (ΒΙΟΜΙΜΗΤΙΚΗ ΤΕΧΝΟΛΟΓΙΑ)

Μέγεθος: px
Εμφάνιση ξεκινά από τη σελίδα:

Download "Εφαρμογές της αυτο-οργανωσης και συγκρότησης υπερμοριaκών βιολογικών δομών (self-assembly) στην επιστήμη των υλικών (ΒΙΟΜΙΜΗΤΙΚΗ ΤΕΧΝΟΛΟΓΙΑ)"


1 Εφαρμογές της αυτο-οργανωσης και συγκρότησης υπερμοριaκών βιολογικών δομών (self-assembly) στην επιστήμη των υλικών (ΒΙΟΜΙΜΗΤΙΚΗ ΤΕΧΝΟΛΟΓΙΑ)

2 (self-assembly) Χρησιμοποίηση της ιδέας του lego

3 XAPAΚΤΗΡΙΣΤΙΚΑ ΤΩΝ ΒΙΟΛΟΓΙΚΩΝ ΥΛΙΚΩΝ - Διαδικασιες κατασκευης φιλικες προς το περιβαλλον - Ιεραρχημενη αρχιτεκτονικη δομων - Αυτο- οργανωση (self-assembly) - Οργανωση ανοργανων φασεων (κρυσταλλοι) από τις οργανικες (πρωτεινες) Κατασκευή υλικών bottom-up Σε αντίθεση με top-down

4 Κατασκευή υλικών bottom-up (αυθόρμητη αναγνώριση και αυτό-οργάνωση, τακτική που χρησιμοποιεί η φύση) Σε αντίθεση με top-down (τεχνολογίες κατασκευής που χρησιμοποιούνται από τον άνθρωπο)

5 Παράδειγμα κατασκευής bottom-up στην Βιολογία: η δομή μιας τρίχας μαλλιών Βασική δομική μονάδα: Άλφα-έλικες της κερατίνης Πλούσιες σε αμινοξέα κυστεϊνης, συνδεδεμένα με δισουλφιδικούς δεσμούς (-S-S-)

6 Παραδείγματα Οργάνωσης ανόργανων φάσεων (κρυσταλλοι) από τις οργανικές (πρωτεΐνες): Nacre (μάργαρο, σεντεφι) 95% Ανοργανη φαση=ανθρακικο ασβεστιο (αραγωνιτης, CaCO3) 5% οργανική φάση (πρωτεϊνες) 3000 φορες πιο ανθεκτικο στην θραυση από Τον καθαρο αραγωνιτη

7 Παραδείγματα Οργάνωσης ανόργανων φάσεων (κρύσταλλοι) από τις οργανικές (πρωτεΐνες): ΒΙΟΛΟΓΙΚΕΣ ΙΝΕΣ ΠΥΡΙΤΙΟΥ Αγκάθια του σφουγγαριού Euplectella aspergillum

8 Μικροδομή των αγκαθιών: μια κεντρική ίνα πρωτεϊνης (Organic Filament) Περιτυλιγμένη από έναν κεντρικό πυρήνα (Central Core) και παραπέρα Διαδοχικές ομόκεντρες στρώσεις (striated shell region) από πυρίτιο

9 Οι ικανότητες της 1) αυτοοργάνωσης και 2) διευθέτησης της ανόργανης ύλης Που χαρακτηρίζουν τις βιολογικές δομές μπορούν να χρησιμοποιηθούν για την διευθέτηση, συγκρότηση και κατασκευή καινοτόμων υλικών?

10 Μια πάστα από PbO και Ca (OH) 2, ph 12.5 τοποθετείται στα μαλλιά Διαμήκεις και εγκάρσιες τομές: A,D: 0 h B,E:6h C,F:72h Ποιος είναι ο μηχανισμός με τον οποίο Η τρίχα βάφεται μαύρη?

11 Το εξαιρετικά αλκαλικό περιβάλλον διασπά τους δεσμούς -S-S-, απελευθερώνοντας θείο νανοκρύσταλλοι PbS διαμέτρου 5 nm σχηματίζονται, απέχοντας μεταξύ τους 10 nm Η ανάπτυξη και τοποθέτηση των νανοκρυσταλλων καθορίζεται από την υπερμοριακη οργάνωση των κερατινων.

12 Χρησιμοποίηση της αυτό-οργάνωσης βιολογικών δομών για την διευθέτηση, συγκρότηση και κατασκευή καινοτόμων υλικών: Μπορούν να χρησιμοποιηθούν Και φυσιολογικές, και μη φυσιολογικές Υπερμοριακές δομές (πχ αμυλοειδή ινίδια)

13 Παραδείγματα χρησιμοποίησης βιολογικών δομών για την διευθέτηση, συγκρότηση και κατασκευή καινοτόμων υλικών: 1) Χρησιμοποίηση της αυτοοργανωσης των βιολογικών μορίων (DNA, πεπτιδίων, πρωτεϊνών.) για την κατασκευή καινοτόμων υλικών: νανοκαλωδιων, νανοσωληνων... 2) Ινώδεις ιοί, πρωτεϊνικοί κλωβοί και ιικα καψιδια σαν ικριώματα για την κατασκευή νανοκαλωδιων, υγρών κρύσταλλων, κλωβών,, etc

14 Χρησιμοποίηση της αυτο-οργάνωσης για την κατασκευή υλικών ιδιότητες των πεπτιδικών νανοδομών: -βιολογική συμβατότητα -αξιοσημείωτη θερμική και χημική σταθερότητα -δυνατότητα εύκολης σύνθεσης και τροποποίησης Αρα κατάλληλα για εφαρμογές νανοτεχνολογίας, Και ειδικά για εφαρμογές στα σύνθετα (βιολογικά-ανόργανα) υλικά

15 Χρησιμοποίηση της αυτο-οργάνωσης για την κατασκευή υλικών Αγώγιμα νανο - σύρματα σχηματισμένα από αμυλοειδη ινίδια και ελεγχόμενη εναπόθεση μετάλλων Scheibel et al., PNAS 2003, 100,

16 Αλληλουχία του πεπτιδίου Alzheimer (42 αμινοξέα) H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAL-COOH Αυτό-οργανώνεται σε αμυλοεϊδή ινίδια

17 Μικρότερες αλληλουχίες του πεπτιδίου Alzheimer (42 αμινοξέα) Μπορούν και σχηματίζουν επίσης αμυλοεϊδή ινίδια (πχ KLVFFAE) Το διπεπτίδιο της φαινυλαλανίνης (FF) σχηματίζει νανοσωλήνες

18 Νανοσωληνες (nanotubes) σχηματισμένοι Από το διπεπτίδιο FF του πεπτιδίου Alzheimer Reches and Gazit,, Science 2003, 300:

19 Οι νανοσωλήνες μπορούν να χρησιμοποιηθούν Σαν εκμαγείο (template) για την κατασκευή υλικών π.χ. Μεταλλικά καλώδια (nanowires) Τα μεταλλικά καλώδια (nanowires) έχουν διάμετρο 20 nm

20 Τα αυτο-οργανωμένα υλικά σχηματίζουν πηκτές (gels), λεπτά υμένια (thin films), κλπ Και μπορούν να χρησιμοποιηθούν για εφαρμογές στην μηχανική των ιστών

21 Σχηματισμός υμενίων από το πεπτίδιο (Ala-Glu-Ala-Glu-Ala-Lys-Ala-Lys)2, (EAK16)

22 Μηχανισμός αυτοοργανωσης:

23 Μηχανισμός αυτοοργανωσης:

24 Τα αυτο-οργανωμένα υλικά μπορούν να χρησιμοποιηθούν ως ικριώματα (scaffolds) για εφαρμογές στην μηχανική των ιστών SAPNS: Self-Assembling Peptide Nanoscaffold (PuraMatrix)

25 Αναγέννηση οπτικού νεύρου μετά από αποκοπή και τοπική εφαρμογή πηκτής αυτό-οργανωμένων πεπτιδίων Nano-Neuro Neuro knitting: Peptide nanofiber scaffold for brain repair And axon regeneration With functional return of vision Ellis-Behnke et al,, PNAS, 2006, 103:


27 Αναγέννηση οπτικού νεύρου μετά από αποκοπή και τοπική εφαρμογή πηκτής αυτό-οργανωμένων πεπτιδίων

28 Αναγέννηση οπτικού νεύρου μετά από αποκοπή και τοπική εφαρμογή πηκτής αυτό-οργανωμένων πεπτιδίων

29 Επιστροφή όρασης μετά από αποκοπή οπτικού νεύρου και τοπική εφαρμογή πηκτής αυτό-οργανωμένων πεπτιδίων

30 Εφαρμογές στην τεχνολογία βιοαισθητηρων με χρήση ηλεκτροδίων επικαλυμμένων με νανοσωληνες Yemini et al., Analytical Chemistry, 2005

31 Συγκεντρωτική εικόνα: Χρησιμοποίηση της αυτο-οργάνωσης πεπτιδίων για την κατασκευή νανο - βιουλικων Zhang, Nature Biotechnology 2003, 21:

32 Παραδείγματα χρησιμοποίησης βιολογικών δομών για την διευθέτηση, συγκρότηση και κατασκευή καινοτόμων υλικών: 1) Χρησιμοποίηση της αυτοοργανωσης των βιολογικών μορίων (DNA, πεπτιδίων, πρωτεϊνών.) για την κατασκευή καινοτόμων υλικών: νανοκαλωδιων, νανοσωληνων... 2) Ινώδεις ιοί, πρωτεϊνικοί κλωβοί και ιικα καψιδια σαν ικριώματα για την κατασκευή νανοκαλωδιων, υγρών κρύσταλλων, κλωβών,, etc

33 Οι ινώδεις ιοί σαν εκμαγεία για την αυτοοργανωση βιο - νανουλικων Πχ ιος της μωσαικης του καπνου

34 Αυτοσυγκρότηση υπερμοριακων δομών: Ινώδεις ιοί Ιός της μωσαϊκής του καπνού Πρωτεϊνικό κάλυμμα: αποτελείται από 2130 πανομοιότυπες πρωτεϊνικές υπομοναδες 158 αα η κάθε μια (μπλε) Γύρω από ένα μονόκλωνο μόριο RNA πού περιέχει 630 νουκλεοτίδια (κόκκινο) Μήκος=300, εξωτερική διάμετρος 18, εσωτερική 4 nm

35 Αυτοσυγκρότηση υπερμοριακων δομών: Ινώδεις ιοί Ιός της μωσαϊκής του καπνού

36 Οι ινώδεις ιοί σαν εκμαγεία για την αυτοοργανωση βιο - νανουλικων Πχ ιός της μωσαϊκής του καπνού Νανοσωματιδια χρυσού σχηματισμένα πάνω στην επιφάνεια του ιού της μωσαϊκής του καπνού Dujardin et al., Nanoletters,, 2003 Scale bar=50 nm

37 Οι ινώδεις ιοί σαν εκμαγεία για την αυτοοργανωση βιο - νανουλικων Ελάσσων (μολυσματική) πρωτεΐνη (giiip) 5 υπομοναδες Φαγος M13: μήκος 900 nm, διάμετρος 7nm 2700 υπομοναδες τηςκύριαςπρωτεΐνης (καλύμματος) του καψιδιου DNA Κύρια πρωτεΐνη (gviiip) Ελάσσων πρωτεΐνη Δυνατότητα ενσωμάτωσης εξωγενών πεπτιδίων (συνδυασμοί ~ 10 9 τυχαίων πεπτιδίων ) στις ελάσσονες πρωτεΐνες (βιβλιοθήκες παρουσίασης φαγων)

38 Παρένθεση: βιβλιοθήκες παρουσίασης φάγων Οι πρωτεϊνες / πεπτίδια συνήθως συντήκονται με την μολυσματική πρωτεϊνη Κατά την διάρκεια της συναρμολόγησης του ιού στα βακτήρια, Οι χιμαιρικές πρωτεϊνες ενσωματώνονται στον ιό Και εκτίθενται στη επιφάνεια του φάγου

39 Παρένθεση: βιβλιοθήκες παρουσίασης φάγων Επιλογή πεπτιδίων μέσω πρόσδεσης σε ακινητοποιημένο σε στερεή επιφάνεια υπόστρωμα

40 Επιλογή αλληλουχιών πεπτιδίων που προσδένονται σε ανόργανα υλικά με χρησιμοποίηση βιβλιοθηκών φαγων Whaley et al. Nature 2000, 405: Flynn et al. Acta Materialia 2003, 51: Prof. Angela Belcher s website:

41 Δεύτερο βήμα: χρησιμοποίηση των ιδιοτήτων σχηματισμού Φάσεων υγρών κρυστάλλων απο τα ιικα σωματίδια για την Κατασκευή νανοδομημενων υλικών Lee et al. Science 2002, 296:

42 Γενική προσέγγιση: οι αλληλουχίες που επιλεχθήκαν εισάγονται Στην κύρια πρωτεΐνη του καψιδίου δημιουργία εκμαγείου Για τον σχηματισμό ημιαγωγιμων νανοκαλωδιων Mao et al., Science 2004, 303:

43 Μελλοντικές προοπτικές : δυνατότητα χρησιμοποίησης μιας και μόνον ιικης δομής για την δημιουργία πολύπλοκων υλικών με ελεγχόμενες διαστάσεις (Flynn et al. Acta Materialia : ) 5880)

44 Παραδείγματα χρησιμοποίησης βιολογικών δομών για την διευθέτηση, συγκρότηση και κατασκευή καινοτόμων υλικών: 1) Χρησιμοποίηση της αυτοοργανωσης των βιολογικών μορίων (DNA, πεπτιδίων, πρωτεϊνών.) για την κατασκευή καινοτόμων υλικών: νανοκαλωδιων, νανοσωληνων... 2) Ινώδεις ιοί, πρωτεϊνικοί κλωβοί και ιικα καψιδια σαν ικριώματα για την κατασκευή νανοκαλωδιων, υγρών κρύσταλλων, κλωβών,, etc

45 Πρωτεϊνικοί «κλωβοί» Βιομιμητική σύνθεση μεταλλικών οξειδίων Το παράδειγμα της φερριτινης Source: Prof. Douglas web site: html

46 Αυτοσυγκροτηση υπερμοριακων δομων: Εικοσαεδρικοι ιοι και φαγοι Τα εικοσαεδρικα καψιδια αποτελούνται από εκατοντάδες όμοιες υπομοναδες πρωτεΐνης

47 -αντιστρεπτές δομικές αλλαγές επιτρέπουν ελεγχόμενη πρόσβαση στο εσωτερικό του καψιδιου -το εσωτερικό περιβάλλον μπορεί να μεταβληθεί με μεταλλαξογενεση -πιθανές εφαρμογές σε εγκαψιδιωση και στόχευση γονιδίων και φαρμάκων, σκιαγραφία, μεταλλωση Prof. Douglas web site:

48 Γενικό σχήμα που δείχνει τις δυνατότητες χρησιμοποίησης ιικων σωματιδίων για την κατασκευή νανοδομημενων υλικών (Flynn et al. Acta Materialia : )

49 ΑΡΘΡΑ ΕΠΙΣΚΟΠΗΣΗΣ -Dickerson et al., (2008) Protein and peptide-directed directed syntheses of inorganic nanomaterials Chemical Reviews 108 : Flynn et al. (2003) Viruses as vehicles for growth, organization and assembly of materials Acta Materialia 51: Gazit,, E. (2007). Self-assembled peptide nanostructures: the design of molecular building blocks and their technological utilization, Chemical Society Reviews, 36, pp Gazit,, E. (2007). Use of biomolecular templates for the fabrication of metal nanowires, Febs Journal, 274, pp Gelain,, F., Horii, A., and Zhang, S. G. (2007). Designer self-assembling peptide scaffolds for 3-D 3 D tissue cell cultures and regenerative medicine, Macromolecular Bioscience, 7, pp Gilead, S., and Gazit,, E. (2005). Self-organization of short peptide fragments: From amyloid fibrils to nanoscale supramolecular assemblies, Supramolecular Chemistry, 17, pp Hauser, C. A. E., and Zhang, S. G. (2010) Designer self-assembling peptide nanofiber biological materials, Chemical Society Reviews, 39, pp

50 ΒΙΒΛΙΟ There is plenty of room for Biology at the bottom.



Διαβάστε περισσότερα



Διαβάστε περισσότερα



Διαβάστε περισσότερα



Διαβάστε περισσότερα


ΒΙΟΛΟΓΙΚΕΣ ΙΝΕΣ ΜΕΤΑΞΙ ΙΣΤΟΙ ΑΡΑΧΝΩΝ ΒΙΟΛΟΓΙΚΕΣ ΙΝΕΣ ΜΕΤΑΞΙ ΙΣΤΟΙ ΑΡΑΧΝΩΝ Βιοσυνθεση του μεταξιου (πρωτεινη) -δυο κυριες πρωτεινες > φιβροινη+σερισινη Κατά την διαρκεια του περασματος από τον αδενα του μεταξοσκωληκα, οι πολυπεπτιδικες αλυσιδες

Διαβάστε περισσότερα



Διαβάστε περισσότερα



Διαβάστε περισσότερα

Νανο-τεχνολογία. Νανο-Επιστήμη. Προσέγγιση από κάτω προς τα πάνω

Νανο-τεχνολογία. Νανο-Επιστήμη. Προσέγγιση από κάτω προς τα πάνω Νανο-τεχνολογία Ο σχεδιασμός, ο χαρακτηρισμός, η παραγωγή και η εφαρμογή των δομών, συσκευών και συστημάτων, ελέγχοντας τη μορφή και το μέγεθος σε κλίμακα νανόμετρου Νανο-Επιστήμη Η μελέτη των φαινομένων

Διαβάστε περισσότερα



Διαβάστε περισσότερα

Γενική Μικροβιολογία. Ενότητα 12 η ΕΙΣΑΓΩΓΗ ΣΤΗΝ ΙΟΛΟΓΙΑ

Γενική Μικροβιολογία. Ενότητα 12 η ΕΙΣΑΓΩΓΗ ΣΤΗΝ ΙΟΛΟΓΙΑ Γενική Μικροβιολογία Ενότητα 12 η ΕΙΣΑΓΩΓΗ ΣΤΗΝ ΙΟΛΟΓΙΑ Όνομα καθηγητή: Δ. ΓΕΩΡΓΑΚΟΠΟΥΛΟΣ Όνομα καθηγητή: Γ. ΖΕΡΒΑΚΗΣ Όνομα καθηγητή: ΑΝ. ΤΑΜΠΑΚΑΚΗ Τμήμα: ΕΠΙΣΤΗΜΗΣ ΦΥΤΙΚΗΣ ΠΑΡΑΓΩΓΗΣ ΣΤΟΧΟΙ ΤΟΥ ΜΑΘΗΜΑΤΟΣ

Διαβάστε περισσότερα

Γενική Μικροβιολογία. Ενότητα 11 η ΕΙΣΑΓΩΓΗ ΣΤΗΝ ΙΟΛΟΓΙΑ

Γενική Μικροβιολογία. Ενότητα 11 η ΕΙΣΑΓΩΓΗ ΣΤΗΝ ΙΟΛΟΓΙΑ Γενική Μικροβιολογία Ενότητα 11 η ΕΙΣΑΓΩΓΗ ΣΤΗΝ ΙΟΛΟΓΙΑ Όνομα καθηγητή: Δ. ΓΕΩΡΓΑΚΟΠΟΥΛΟΣ Όνομα καθηγητή: Γ. ΖΕΡΒΑΚΗΣ Όνομα καθηγητή: ΑΝ. ΤΑΜΠΑΚΑΚΗ Τμήμα: ΕΠΙΣΤΗΜΗΣ ΦΥΤΙΚΗΣ ΠΑΡΑΓΩΓΗΣ ΣΤΟΧΟΙ ΤΟΥ ΜΑΘΗΜΑΤΟΣ

Διαβάστε περισσότερα

Βιολογία Γ Γενικού Λυκείου Θετικής κατεύθυνσης. Κεφάλαιο 1α Το Γενετικό Υλικό

Βιολογία Γ Γενικού Λυκείου Θετικής κατεύθυνσης. Κεφάλαιο 1α Το Γενετικό Υλικό Βιολογία Γ Γενικού Λυκείου Θετικής κατεύθυνσης Κεφάλαιο 1α Το Γενετικό Υλικό Το DNA είναι το γενετικό υλικό Αρχικά οι επιστήμονες θεωρούσαν ότι οι πρωτεΐνες αποτελούσαν το γενετικό υλικό των οργανισμών.

Διαβάστε περισσότερα

Τμήμα Βιολογίας Μάθημα: ΒΙΟΛΟΓΙΑ ΚΥΤΤΑΡΟΥ Γ εξάμηνο 2014-2015 Διαλέξεις κάθε Τρίτη 13-15 μ.μ. και Παρασκευή 11-13

Τμήμα Βιολογίας Μάθημα: ΒΙΟΛΟΓΙΑ ΚΥΤΤΑΡΟΥ Γ εξάμηνο 2014-2015 Διαλέξεις κάθε Τρίτη 13-15 μ.μ. και Παρασκευή 11-13 Τμήμα Βιολογίας Μάθημα: ΒΙΟΛΟΓΙΑ ΚΥΤΤΑΡΟΥ Γ εξάμηνο 2014-2015 Διαλέξεις κάθε Τρίτη 13-15 μ.μ. και Παρασκευή 11-13 Ισιδώρα Παπασιδέρη, Καθηγήτρια...για περισσότερα... http://kyttariki.biol.uoa.gr, ttp://multimedia.biol.uoa.gr

Διαβάστε περισσότερα

ΘΕΜΑ Α Α1. γ Α2. γ Α3. α Α4. β Α5. β ΘΕΜΑ B B1. B2.

ΘΕΜΑ Α Α1. γ Α2. γ Α3. α Α4. β Α5. β ΘΕΜΑ B B1. B2. ΘΕΜΑ Α Α1. γ (το πριμόσωμα) Α2. γ (οι υποκινητές και οι μεταγραφικοί παράγοντες κάθε γονιδίου) Α3. α (μεταφέρει ένα συγκεκριμένο αμινοξύ στο ριβόσωμα) Α4. β (αποδιάταξη των δύο συμπληρωματικών αλυσίδων)

Διαβάστε περισσότερα

ΑΠΑΝΤΗΣΕΙΣ. ΘΕΜΑ 1ο 1. γ 2. γ 3. β 4. α 5. δ


Διαβάστε περισσότερα

ΑΠΑΝΤΗΣΕΙΣ. ΘΕΜΑ Α Α1. β Α2. γ Α3. δ Α4. γ Α5. β


Διαβάστε περισσότερα



Διαβάστε περισσότερα


ΑΠΑΝΤΗΣΕΙΣ ΣΤΗ ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ 24 ΜΑΪΟΥ 2013 ΑΠΑΝΤΗΣΕΙΣ ΣΤΗ ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ 24 ΜΑΪΟΥ 2013 ΘΕΜΑ Α Α1. γ Α2. β Α3. α Α4. δ Α5. α ΘΕΜΑ Β Β1. Σελ. 123 124 σχολ. βιβλίου: «Η διαδικασία που ακολουθείται παράγουν το ένζυμο ADA». Β2. Σελ. 133 σχολ.

Διαβάστε περισσότερα



Διαβάστε περισσότερα

Μάθηµα: Κίνηση πρωτεινών

Μάθηµα: Κίνηση πρωτεινών Μάθηµα: Κίνηση πρωτεινών ιάλεξη 1:Σύνθεση πρωτεινών- Ριβόσωµα Κώστας Τοκατλίδης Η σύνθεση πρωτεινών απαιτεί την µετάφραση αλληλουχίας νουκλεοτιδίων σε αλληλουχία αµινοξέων Οι συνθετάσες των αµινοακυλο-trna

Διαβάστε περισσότερα

Βιοϋλικά. Ενότητα 5: Πρωτεΐνες, Κύτταρα, Ιστοί Αλληλεπίδραση με Βιοϋλικά. Ελευθέριος Αμανατίδης Πολυτεχνική Σχολή Τμήμα Χημικών Μηχανικών

Βιοϋλικά. Ενότητα 5: Πρωτεΐνες, Κύτταρα, Ιστοί Αλληλεπίδραση με Βιοϋλικά. Ελευθέριος Αμανατίδης Πολυτεχνική Σχολή Τμήμα Χημικών Μηχανικών Βιοϋλικά Ενότητα 5: Πρωτεΐνες, Κύτταρα, Ιστοί Αλληλεπίδραση με Βιοϋλικά Ελευθέριος Αμανατίδης Πολυτεχνική Σχολή Τμήμα Χημικών Μηχανικών Περιεχόμενα ενότητας Πρωτεΐνες Δομή και είδη Λειτουργίες πρωτεϊνών

Διαβάστε περισσότερα

Γ1. Το γνώρισμα για το μέγεθος των φτερών ελέγχεται από αυτοσωμικό γονίδιο.

Γ1. Το γνώρισμα για το μέγεθος των φτερών ελέγχεται από αυτοσωμικό γονίδιο. ΠΑΝΕΛΛΗΝΙΕΣ ΒΙΟΛΟΓΙΑΣ ΚΑΤΕΥΘΥΝΣΗΣ 2013 AΠΑΝΤΗΣΕΙΣ ΘΕΜΑ Α Α1.γ Α2.β Α3.α Α4.δ Α5.α ΘΕΜΑ Β Β1. Η γονιδιακή θεραπεία εφαρμόστηκε για πρώτη φορά το 1990 σε ένα κορίτσι που έπασχε από έλλειψη της απαμινάσης

Διαβάστε περισσότερα

Αρχιτεκτονική της τρισδιάστατης δομής πρωτεϊνών

Αρχιτεκτονική της τρισδιάστατης δομής πρωτεϊνών Αρχιτεκτονική της τρισδιάστατης δομής πρωτεϊνών Βασίλης Προμπονάς, PhD Ερευνητικό Εργαστήριο Βιοπληροφορικής Τμήμα Βιολογικών Επιστημών Νέα Παν/πολη, Γραφείο B161 Πανεπιστήμιο Κύπρου Ταχ.Κιβ. 20537 1678,

Διαβάστε περισσότερα



Διαβάστε περισσότερα



Διαβάστε περισσότερα


ΘΕΜΑ 1 Ο ΜΑΘΗΜΑ / ΤΑΞΗ : ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΣΕΙΡΑ: ΗΜΕΡΟΜΗΝΙΑ: 22/09/2013 ΜΑΘΗΜΑ / ΤΑΞΗ : ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΣΕΙΡΑ: ΗΜΕΡΟΜΗΝΙΑ: 22/09/2013 ΘΕΜΑ 1 Ο Να επιλέξετε την φράση που συμπληρώνει ορθά κάθε μία από τις ακόλουθες προτάσεις: 1. Το ζεύγος των φυλετικών

Διαβάστε περισσότερα

(αδρές αποικίες) Θέρμανση (λείες αποικίες) ζωντανά ποντίκια ζωντανά ποντίκια νεκρά ποντίκια

(αδρές αποικίες) Θέρμανση (λείες αποικίες) ζωντανά ποντίκια ζωντανά ποντίκια νεκρά ποντίκια Το DNA είναι το γενετικό υλικό 1. Πείραμα Griffith (1928) Βακτήριο πνευμονιόκοκκου (Diplococcus pneumoniae) Χωρίς κάλυμμα Με κάλυμμα (αδρές αποικίες) Θέρμανση (λείες αποικίες) ζωντανά ποντίκια ζωντανά

Διαβάστε περισσότερα

Η ασβεστοποίηση ως προηγμένη επεξεργασία για τηνεξυγίανση ξγ ητης λυματολάσπης και την μείωση των οσμών

Η ασβεστοποίηση ως προηγμένη επεξεργασία για τηνεξυγίανση ξγ ητης λυματολάσπης και την μείωση των οσμών Η ασβεστοποίηση ως προηγμένη επεξεργασία για τηνεξυγίανση ξγ ητης λυματολάσπης και την μείωση των οσμών ημητριάδης Γεώργιος 2310688380 caohellas@the.forthnet.gr Λυματολάσπη Στόχοι της επεξεργασίας της

Διαβάστε περισσότερα



Διαβάστε περισσότερα

Το κεντρικό δόγμα (The central dogma)

Το κεντρικό δόγμα (The central dogma) Οι βασικές μοριακές γενετικές διαδικασίες Αντιγραφή Μεταγραφή Μετάφραση ΠΡΩΤΕΪΝΗ Το κεντρικό δόγμα (The central dogma) Σύσταση νουκλεοτιδίων του DNA και του RNA Α 5 -άκρο Θυμίνη (Θ) Β 5 άκρο Αδενίνη (Α)

Διαβάστε περισσότερα

Νικόλαος Σιαφάκας Λέκτορας Διαγνωστικής Ιολογίας Εργαστήριο Κλινικής Μικροβιολογίας ΠΓΝ «ΑΤΤΙΚΟΝ»

Νικόλαος Σιαφάκας Λέκτορας Διαγνωστικής Ιολογίας Εργαστήριο Κλινικής Μικροβιολογίας ΠΓΝ «ΑΤΤΙΚΟΝ» Νικόλαος Σιαφάκας Λέκτορας Διαγνωστικής Ιολογίας Εργαστήριο Κλινικής Μικροβιολογίας ΠΓΝ «ΑΤΤΙΚΟΝ» DNA RNA: ΑΝΤΙΓΡΑΦΗ, ΜΕΤΑΓΡΑΦΗ, ΜΕΤΑΦΡΑΣΗ DNA RNA: Βασικά Χαρακτηριστικά Ρόλος Κεντικό Δόγμα της Βιολογίας:

Διαβάστε περισσότερα

ΤΑ ΜΟΡΙΑ ΤΗΣ ΖΩΗΣ. Τι γνωρίζετε για τους υδατάνθρακες;

ΤΑ ΜΟΡΙΑ ΤΗΣ ΖΩΗΣ. Τι γνωρίζετε για τους υδατάνθρακες; 1 ΤΑ ΜΟΡΙΑ ΤΗΣ ΖΩΗΣ Το κύτταρο αποτελείται από χηµικές ενώσεις, στις οποίες περιλαµβάνονται τα µικρά βιολογικά µόρια και τα βιολογικά µακροµόρια. Στα µικρά βιολογικά µόρια ανήκουν, τα ανόργανα στοιχεία

Διαβάστε περισσότερα



Διαβάστε περισσότερα



Διαβάστε περισσότερα


ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ 22 ΜΑΪΟΥ 2015 ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ Α Α1. Β Α2. Γ Α3. Α Α4. Α5. Γ ΘΕΜΑ Β ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ 22 ΜΑΪΟΥ 2015 ΑΠΑΝΤΗΣΕΙΣ B1. Α (Σωµατικά κύτταρα στην αρχή της µεσόφασης): 1, 4, 5, 6 Β (Γαµέτες): 2, 3, 7, 8 Β2. (Κάθε

Διαβάστε περισσότερα

Ενδεικτικές απαντήσεις βιολογίας κατεύθυνσης 2014

Ενδεικτικές απαντήσεις βιολογίας κατεύθυνσης 2014 Θέμα Α Α1. δ Α2. γ Α3. β Α4. γ Α5. β Θέμα Β ΑΓ.ΚΩΝΣΤΑΝΤΙΝΟΥ 11 -- ΠΕΙΡΑΙΑΣ -- 18532 -- ΤΗΛ. 210-4224752, 4223687 Ενδεικτικές απαντήσεις βιολογίας κατεύθυνσης 2014 Β1. 4 2 1 6 3 5 Β2. α. DNA πολυμεράση

Διαβάστε περισσότερα

Τράπεζα Θεμάτων Βιολογίας Β' Λυκείου 2014-2015 Κεφάλαιο 1 ΚΕΦΑΛΑΙΟ 1

Τράπεζα Θεμάτων Βιολογίας Β' Λυκείου 2014-2015 Κεφάλαιο 1 ΚΕΦΑΛΑΙΟ 1 ΓΗ_Β_ΒΙΟ_0_14306 - Β1 ΚΕΦΑΛΑΙΟ 1 Ι. Στην ακόλουθη εικόνα παρουσιάζονται σχηματικά δύο χημικές αντιδράσεις. Να απαντήσετε στις ερωτήσεις: α) Πώς χαρακτηρίζονται τα χημικά μόρια Α και Β; Πώς χαρακτηρίζεται

Διαβάστε περισσότερα

Η ζητούμενη σειρά έχει ως εξής: αδενίνη < νουκλεοτίδιο < νουκλεόσωμα < γονίδιο < χρωματίδα < χρωμόσωμα < γονιδίωμα.

Η ζητούμενη σειρά έχει ως εξής: αδενίνη < νουκλεοτίδιο < νουκλεόσωμα < γονίδιο < χρωματίδα < χρωμόσωμα < γονιδίωμα. ΚΕΦ. 1 ο ΕΡΩΤΗΣΕΙΣ ΚΡΙΣΕΩΣ 1. Να κατατάξετε σε σειρά αυξανόμενου μεγέθους τις παρακάτω έννοιες που σχετίζονται με το γενετικό υλικό των οργανισμών: νουκλεόσωμα, χρωμόσωμα, αδενίνη, νουκλεοτίδιο, γονίδιο

Διαβάστε περισσότερα



Διαβάστε περισσότερα


ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ Α Α1 δ Α2 γ Α3 β Α4 γ Α5 β ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ Β Β1. 4 2 1 6 3 5 Β2. α. DNA πολυμεράση β. πριμόσωμα γ. DNA δεσμάση δ. DNA ελκάση ε. RNA πολυμεράση Β3. Σχολικό βιβλίο, Σελ.: 98: «Η διάγνωση των

Διαβάστε περισσότερα

Πανελλήνιες Εξετάσεις Ημερήσιων Γενικών Λυκείων. Εξεταζόμενο Μάθημα: Βιολογία Θετικής Κατεύθυνσης, Ημ/νία: 24 Μαΐου 2013. Απαντήσεις Θεμάτων

Πανελλήνιες Εξετάσεις Ημερήσιων Γενικών Λυκείων. Εξεταζόμενο Μάθημα: Βιολογία Θετικής Κατεύθυνσης, Ημ/νία: 24 Μαΐου 2013. Απαντήσεις Θεμάτων Πανελλήνιες Εξετάσεις Ημερήσιων Γενικών Λυκείων Εξεταζόμενο Μάθημα: Βιολογία Θετικής Κατεύθυνσης, Ημ/νία: 24 Μαΐου 2013 Απαντήσεις Θεμάτων ΘΕΜΑ Α Α1. Βασική μονάδα οργάνωσης αποτελεί το Γ. νουκλεόσωμα

Διαβάστε περισσότερα


ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ Α. Α1. δ Α2. γ Α3. β Α4. γ Α5. β ΘΕΜΑ Β. Β1. 4-2-1-6-3-5 Β2. α) DNA πολυμεράσες β) πριμόσωμα γ) DNA δεσμάσεις δ) DNA ελικάσες ε) RNA πολυμεράσες Β3. σελ 98:

Διαβάστε περισσότερα


Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗ ΚΑΤΕΥΘΥΝΣΗ ΒΙΟΛΟΓΙΑ ΑΠΑΝΤΗΣΕΙΣ ÏÅÖÅ 1 Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗ ΚΑΤΕΥΘΥΝΣΗ ΒΙΟΛΟΓΙΑ ΘΕΜΑ 1 ο 1 γ 2 δ 3 β 4 α 5 γ ΘΕΜΑ 2 ο ΑΠΑΝΤΗΣΕΙΣ Μονάδες 25 (5Χ5) Α. ιαγονιδιακά ζώα ονοµάζονται εκείνα στα οποία το γενετικό τους υλικό έχει τροποποιηθεί µε την

Διαβάστε περισσότερα



Διαβάστε περισσότερα

8. Σε στέλεχος του βακτηρίου E.coli δε λειτουργεί το γονίδιο που παράγει τον καταστολέα του οπερόνιου της λακτόζης. Ποιο είναι το αποτέλεσμα σε σχέση

8. Σε στέλεχος του βακτηρίου E.coli δε λειτουργεί το γονίδιο που παράγει τον καταστολέα του οπερόνιου της λακτόζης. Ποιο είναι το αποτέλεσμα σε σχέση Γονιδιακή ρύθμιοη 1. Εντοπίστε δύο διαφορές στον έλεγχο της γονιδιακής έκφρασης ανάμεσα στους προκαρυωτικούς και στους ευκαρυωτικούς οργανισμούς. Α. Η ρύθμιση της γσνιδιακής έκφρασης στους προκαρυωτικούς

Διαβάστε περισσότερα

Θέματα πριν τις εξετάσεις. Καλό διάβασμα Καλή επιτυχία

Θέματα πριν τις εξετάσεις. Καλό διάβασμα Καλή επιτυχία Θέματα πριν τις εξετάσεις Καλό διάβασμα Καλή επιτυχία 2013-2014 Θέματα πολλαπλής επιλογής Μετουσίωση είναι το φαινόμενο α. κατά το οποίο συνδέονται δύο αμινοξέα για τον σχηματισμό μιας πρωτεΐνης β. κατά

Διαβάστε περισσότερα


ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΘΕΜΑ 1ο Να γράψετε στο τετράδιό σας τον αριθμό καθεμιάς από τις παρακάτω ημιτελείς προτάσεις 1 έως 5 και δίπλα το γράμμα που αντιστοιχεί στη λέξη ή τη φράση, η οποία

Διαβάστε περισσότερα

Ποιες είναι οι ομοιότητες και οι διαφορές μεταξύ της αντιγραφής και της

Ποιες είναι οι ομοιότητες και οι διαφορές μεταξύ της αντιγραφής και της ΚΕΦ. 2 ο ΕΡΩΤΗΣΕΙΣ ΚΡΙΣΕΩΣ Ποιες είναι οι ομοιότητες και οι διαφορές μεταξύ της αντιγραφής και της μεταγραφής; Διαφορές Αντιγραφή Μεταγραφή 1. Διατηρείται και μεταβιβάζεται η 1. Μεταβιβάζεται η γενετική

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΟΝΟΜΑΤΕΠΩΝΥΜΟ: ΤΜΗΜΑ: ΘΕΜΑ 1 Ο. 3. Το DNA των μιτοχονδρίων έχει μεγαλύτερο μήκος από αυτό των χλωροπλαστών.

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΟΝΟΜΑΤΕΠΩΝΥΜΟ: ΤΜΗΜΑ: ΘΕΜΑ 1 Ο. 3. Το DNA των μιτοχονδρίων έχει μεγαλύτερο μήκος από αυτό των χλωροπλαστών. ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΟΝΟΜΑΤΕΠΩΝΥΜΟ: ΤΜΗΜΑ: ΘΕΜΑ 1 Ο Α. Να γράψετε τον αριθμό της καθεμιάς από τις παρακάτω προτάσεις 1-5 και δίπλα του τη λέξη Σωστό, αν η πρόταση είναι σωστή, ή Λάθος, αν η πρόταση

Διαβάστε περισσότερα


ΟΜΟΣΠΟΝ ΙΑ ΕΚΠΑΙ ΕΥΤΙΚΩΝ ΦΡΟΝΤΙΣΤΩΝ ΕΛΛΑ ΟΣ (Ο.Ε.Φ.Ε.) ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ 2014 ΤΑΞΗ: ΚΑΤΕΥΘΥΝΣΗ: ΜΑΘΗΜΑ: Γ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗ ΒΙΟΛΟΓΙΑ Ηµεροµηνία: Παρασκευή 25 Απριλίου 2014 ιάρκεια Εξέτασης: 3 ώρες ΕΚΦΩΝΗΣΕΙΣ ΘΕΜΑ Α Να γράψετε στο τετράδιό σας τον αριθµό καθεµιάς από τις παρακάτω

Διαβάστε περισσότερα


ΠΑΝΕΛΛΗΝΙΕΣ 2013 ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ Α. Α1 γ Α2 β Α3 α Α4 δ Α5 α ΘΕΜΑ Β. ΠΑΝΕΛΛΗΝΙΕΣ 2013 ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΑΠΑΝΤΗΣΕΙΣ Β1. Σελ 123 σχολ. Βιβλίου: Από «Η γονιδιακή θεραπεία εφαρμόστηκε για πρώτη φορά το Σεπτέμβριο του 1990»

Διαβάστε περισσότερα

Nανοσωλήνες άνθρακα. Ηλεκτρονική δομή ηλεκτρικές ιδιότητες. Εφαρμογές στα ηλεκτρονικά

Nανοσωλήνες άνθρακα. Ηλεκτρονική δομή ηλεκτρικές ιδιότητες. Εφαρμογές στα ηλεκτρονικά Nανοσωλήνες άνθρακα Ηλεκτρονική δομή ηλεκτρικές ιδιότητες Εφαρμογές στα ηλεκτρονικά Νανοσωλήνες άνθρακα ιστορική αναδρομή Από το γραφίτη στους Νανοσωλήνες άνθρακα Στο γραφίτη τα άτομα C συνδέονται ισχυρά

Διαβάστε περισσότερα

ΘΕΜΑ Α ΘΕΜΑ Β ΘΕΜΑ Γ. Α1. δ. Α2. γ. Α3. β. Α4. γ. Α5. β Β1. Η σωστή σειρά είναι: 4,2,1,6,3,5. Β2. α. DNA πολυμεράση. β. Πριμόσωμα. γ.

ΘΕΜΑ Α ΘΕΜΑ Β ΘΕΜΑ Γ. Α1. δ. Α2. γ. Α3. β. Α4. γ. Α5. β Β1. Η σωστή σειρά είναι: 4,2,1,6,3,5. Β2. α. DNA πολυμεράση. β. Πριμόσωμα. γ. ΘΕΜΑ Α ΠΑΝΕΛΛΑ ΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΚΑΙ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΚΑΙ ΕΠΑΛ(ΟΜΑ Α Β ) ΤΕΤΑΡΤΗ 4 ΙΟΥΝΙΟΥ 2014 - ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Α1. δ Α2. γ Α3. β Α4. γ Α5. β ΘΕΜΑ Β Β1. Η σωστή

Διαβάστε περισσότερα

οµή και λειτουργία των µεγάλων βιολογικών µορίων

οµή και λειτουργία των µεγάλων βιολογικών µορίων οµή και λειτουργία των µεγάλων βιολογικών µορίων οµή και λειτουργία των µεγάλων βιολογικών µορίων κατηγορίες υδατάνθρακες πρωτεΐνες νουκλεϊνικά οξέα λιπίδια Οι πρωτεΐνες, υδατάνθρακες, νουκλεϊνικά οξέα

Διαβάστε περισσότερα



Διαβάστε περισσότερα



Διαβάστε περισσότερα

Χαρίλαος Μέγας Ελένη Φωτάκη Ελευθέριος Νεοφύτου

Χαρίλαος Μέγας Ελένη Φωτάκη Ελευθέριος Νεοφύτου Χαρίλαος Μέγας Ελένη Φωτάκη Ελευθέριος Νεοφύτου Απαντήσεις στις ερωτήσεις: Πρόλογος Το βιβλίο αυτό γράφτηκε για να βοηθήσει το μαθητή της Γ Γυμνασίου στην κατανόηση των θεμελιωδών γνώσεων της Βιολογίας

Διαβάστε περισσότερα


ΛΥΣΗ ΤΗΣ ΑΣΚΗΣΗΣ ΕΠΑΝΑΛΗΨΗΣ ΛΥΣΗ ΤΗΣ ΑΣΚΗΣΗΣ ΕΠΑΝΑΛΗΨΗΣ 1. Ο γενετικός κώδικας είναι ένας κώδικας αντιστοίχισης των κωδικονίων του mrna με αμινοξέα στην πολυπεπτιδική αλυσίδα. Σύμφωνα με αυτόν η 3 μετάφραση όλων των mrna αρχίζει

Διαβάστε περισσότερα


ΒΙΟΛΟΓΙΑ Γ ΤΑΞΗΣ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 2003 ΒΙΟΛΟΓΙΑ Γ ΤΑΞΗΣ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 2003 ΘΕΜΑ 1ο Α. Να γράψετε τον αριθµό της καθεµιάς από τις παρακάτω προτάσεις 1-5 και δίπλα του τη λέξη Σωστό, αν η πρόταση είναι σωστή, ή Λάθος, αν η πρόταση είναι

Διαβάστε περισσότερα


ΒΙΟΛΟΓΙΑ Γ ΤΑΞΗΣ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 2003 ΒΙΟΛΟΓΙΑ Γ ΤΑΞΗΣ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 2003 ΕΚΦΩΝΗΣΕΙΣ ΘΕΜΑ 1ο Α. Να γράψετε τον αριθµό της καθεµιάς από τις παρακάτω προτάσεις 1-5 και δίπλα του τη λέξη Σωστό, αν η πρόταση είναι σωστή, ή Λάθος, αν η πρόταση

Διαβάστε περισσότερα


ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΘΕΜΑ Α Να γράψετε στο τετράδιό σας τον αριθμό καθεμιάς από τις παρακάτω ημιτελείς προτάσεις Α1 έως Α5 και δίπλα το γράμμα που αντιστοιχεί στη λέξη

Διαβάστε περισσότερα

Θέματα Πανελλαδικών 2000-2013

Θέματα Πανελλαδικών 2000-2013 Θέματα Πανελλαδικών 2000-2013 ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΗΜΕΡΗΣΙΩΝ ΛΥΚΕΙΩΝ ΕΣΠΕΡΙΝΩΝ ΛΥΚΕΙΩΝ ΕΠΑΝΑΛΗΠΤΙΚΕΣ Κεφάλαιο 1 ΚΕΦΑΛΑΙΟ 1 ΘΕΜΑ 1 ο Γράψτε τον αριθμό καθεμιάς από τις παρακάτω προτάσεις και δίπλα το γράμμα

Διαβάστε περισσότερα

Ημερομηνία Ώρα Αίθουσα Δράση Διάλεξη Τίτλος Διδάσκοντες

Ημερομηνία Ώρα Αίθουσα Δράση Διάλεξη Τίτλος Διδάσκοντες Ημερομηνία Ώρα Αίθουσα Δράση Διάλεξη Τίτλος Διδάσκοντες Διάρκεια σε ώρες Δευ 8 Ιουν 015 16:00-0:00 Ε10 1 1 Εισαγωγή στην Τεχνολογία των Υλικών Βελώνια Τρι 9 Ιουν 015 Εφαρμογές υπολογιστικών μεθόδων στην

Διαβάστε περισσότερα


ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ 24 ΜΑΪΟΥ 2013 ΑΠΑΝΤΗΣΕΙΣ ÍÅÏ ΘΕΜΑ Α Α1: γ Α2: β Α3: α Α4: δ Α5: α ΘΕΜΑ B ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ 24 ΜΑΪΟΥ 2013 ΑΠΑΝΤΗΣΕΙΣ Β1. Η γονιδιακή θεραπεία εφαρµόστηκε για πρώτη φορά το Σεπτέµβριο του 1990 σε ένα τετράχρονο

Διαβάστε περισσότερα


ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ Α Α1 γ Α2 β Α3 α Α4 δ Α5 α ΘΕΜΑ Β Β1. Σχολικό βιβλίο, Σελ.: 123-124: «Η διαδικασία που ακολουθείται με ενδοφλέβια ένεση στον οργανισμό». Β2. Σχολικό βιβλίο, Σελ.: 133: «Διαγονιδιακά

Διαβάστε περισσότερα

Απαντήσεις Θεμάτων Πανελληνίων Εξετάσεων Ημερησίων Γενικών Λυκείων

Απαντήσεις Θεμάτων Πανελληνίων Εξετάσεων Ημερησίων Γενικών Λυκείων 4 Ιουνίου 2014 ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Απαντήσεις Θεμάτων Πανελληνίων Εξετάσεων Ημερησίων Γενικών Λυκείων ΘΕΜΑ Α Α.1δ Α.2 γ Α.3 β Α.4 γ Α.5 β ΘΕΜΑ Β B.1 4 2 1 6 3 5 B.2 α. DNAπολυμεράση β. πριμόσωμα

Διαβάστε περισσότερα


ΠΡΟΤΕΙΝΟΜΕΝΕΣ ΛΥΣΕΙΣ ΔΙΑΓΩΝΙΣΜΑΤΟΣ ΒΙΟΛΟΓΙΑΣ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΠΡΟΤΕΙΝΟΜΕΝΕΣ ΛΥΣΕΙΣ ΔΙΑΓΩΝΙΣΜΑΤΟΣ ΒΙΟΛΟΓΙΑΣ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ Α Α. 1. β 2. β 3. γ 4. β Β. Ζύμωση: Διαδικασία ανάπτυξης μικροοργανισμών σε υγρό θρεπτικό υλικό κάτω από οποιεσδήποτε συνθήκες Υβριδοποίηση:

Διαβάστε περισσότερα


ΔΙΑΦΟΡΕΣ ΑΣΚΗΣΕΙΣ ΣΤΟ 1 ΚΕΦΑΛΑΙΟ 1 ΔΙΑΦΟΡΕΣ ΑΣΚΗΣΕΙΣ ΣΤΟ 1 ΚΕΦΑΛΑΙΟ Το μόριο DNA μιας χρωματίδας μεταφασικού χωμοσώματος ενός φυσιολογικού ευκαρυωτικού κυττάρου περιέχει το 29% των νουκλεoτιδίων του με αζωτούχα βάση την T. a. Ποιο είναι

Διαβάστε περισσότερα

ΑΠΑΝΤΗΣΕΙΣ. ΘΕΜΑ Α Α1. β Α2. γ Α3. γ Α4. α Α5. δ


Διαβάστε περισσότερα


ΒΙΟΛΟΓΙΑ Γ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 2008 ΒΙΟΛΟΓΙΑ Γ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 2008 ΕΚΦΩΝΗΣΕΙΣ ΘΕΜΑ 1ο Να γράψετε στο τετράδιό σας τον αριθµό καθεµιάς από τις παρακάτω ηµιτελείς προτάσεις 1 έως 5 και δίπλα το γράµµα που αντιστοιχεί στη λέξη

Διαβάστε περισσότερα

γ ρ α π τ ή ε ξ έ τ α σ η σ τ ο μ ά θ η μ α ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ

γ ρ α π τ ή ε ξ έ τ α σ η σ τ ο μ ά θ η μ α ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ γ ρ α π τ ή ε ξ έ τ α σ η σ τ ο μ ά θ η μ α ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ' ΛΥΚΕΙΟΥ Τάξη: Γ Λυκείου Τμήμα: Βαθμός: Ονοματεπώνυμο: Καθηγητές: Θ Ε Μ Α A 1. Να επιλέξετε τη σωστή απάντηση: Α1. Το γονίδιο

Διαβάστε περισσότερα

ΕΞΕΤΑΣΕΙΣ. σύγχρονο. Θέμα Α. Α.1. δ. Α.2. γ. Α.3. β. Α.4. γ. Α.5. β. Θέμα Β.

ΕΞΕΤΑΣΕΙΣ. σύγχρονο. Θέμα Α. Α.1. δ. Α.2. γ. Α.3. β. Α.4. γ. Α.5. β. Θέμα Β. Θέμα Α. Α.1. δ Α.2. γ Α.3. β Α.4. γ Α.5. β Θέμα Β. TETAPTH 4 OYNIOY 2014 - ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: Β.1. 4 2 1-6 3-5 B.2. α.) ) DNA πολυμεράσες β.) ) πριμόσωμα γ.) ) DNA δεσμάση δ.) ) DNA ελικάσες ε.) ) RNA

Διαβάστε περισσότερα

Εφαρμογές των Laser στην Φ/Β τεχνολογία: πιο φτηνό ρεύμα από τον ήλιο

Εφαρμογές των Laser στην Φ/Β τεχνολογία: πιο φτηνό ρεύμα από τον ήλιο Εφαρμογές των Laser στην Φ/Β τεχνολογία: πιο φτηνό ρεύμα από τον ήλιο Μιχάλης Κομπίτσας Εθνικό Ίδρυμα Ερευνών, Ινστιτούτο Θεωρ./Φυσικής Χημείας (www.laser-applications.eu) 1 ΠΕΡΙΕΧΟΜΕΝΑ ΤΗΣ ΟΜΙΛΙΑΣ 1.

Διαβάστε περισσότερα

A5. Μονάδες 5 ΘΕΜΑ B B1. Μονάδες 8 B2. Μονάδες 6 B3. Μονάδες 6 B4. Μονάδες 5 ΘΕΜΑ Γ Γ1. Μονάδες 18


Διαβάστε περισσότερα

5. ΤΟ ΠΥΡΙΤΙΟ. Επιμέλεια παρουσίασης Παναγιώτης Αθανασόπουλος Δρ - Χημικός

5. ΤΟ ΠΥΡΙΤΙΟ. Επιμέλεια παρουσίασης Παναγιώτης Αθανασόπουλος Δρ - Χημικός 5. ΤΟ ΠΥΡΙΤΙΟ Επιμέλεια παρουσίασης Παναγιώτης Αθανασόπουλος Δρ - Χημικός Σκοπός του μαθήματος: Να εντοπίζουμε τη θέση του πυριτίου στον περιοδικό πίνακα Να αναφέρουμε τη χρήση του πυριτίου σε υλικά όπως

Διαβάστε περισσότερα

Α2. Το αντικωδικόνιο είναι τριπλέτα νουκλεοτιδίων του α. mrna β. snrna γ. trna δ. rrna Μονάδες 5

Α2. Το αντικωδικόνιο είναι τριπλέτα νουκλεοτιδίων του α. mrna β. snrna γ. trna δ. rrna Μονάδες 5 ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ Α Να γράψετε στο τετράδιό σας τον αριθμό καθεμιάς από τις παρακάτω ημιτελείς προτάσεις Α1 έως Α5 και δίπλα στο γράμμα που αντιστοιχεί στη λέξη ή στη φράση, η οποία συμπληρώνει

Διαβάστε περισσότερα


ΔΙΑΓΩΝΙΣΜΑ ΒΙΟΛΟΓΙΑΣ ΠΡΟΣΑΝΑΤΟΛΙΣΜΟΥ ΚΕΦΑΛΑΙΑ 1 ΚΑΙ 2 ΔΙΑΓΩΝΙΣΜΑ ΒΙΟΛΟΓΙΑΣ ΠΡΟΣΑΝΑΤΟΛΙΣΜΟΥ ΚΕΦΑΛΑΙΑ 1 ΚΑΙ 2 ΘΕΜΑ 1 ο Α. Στις ερωτήσεις 1-5 να γράψετε στο τετράδιό σας τον αριθμό της ερώτησης και δίπλα του το γράμμα που αντιστοιχεί στη σωστή απάντηση. 1. Το

Διαβάστε περισσότερα


ÍÅÏ ÄÕÍÁÌÉÊÏ ÓÔÁÕÑÏÕÐÏËÇ 1 ΘΕΜΑ 1 o Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΕΚΦΩΝΗΣΕΙΣ ΒΙΟΛΟΓΙΑ Α. Για τις ερωτήσεις 1 5 να γράψετε στο τετράδιό σας τον αριθµό της ερώτησης και δίπλα του το γράµµα, που αντιστοιχεί στη σωστή απάντηση. 1.

Διαβάστε περισσότερα

ιδάσκων: Λευτέρης Λοιδωρίκης Π1 0-7146

ιδάσκων: Λευτέρης Λοιδωρίκης Π1 0-7146 Φωτονικά Υλικά ιδάσκων: Λευτέρης Λοιδωρίκης Π1 0-7146 Τεχνολογίες φωτός σήμερα Το φώς έχει εισχωρήσει προ πολλού στη ζωή μας Ηλεκτρομαγνητική ακτινοβολία Καλύπτει πολύ μεγάλο φάσμα Συστατικά τεχνολογίας

Διαβάστε περισσότερα

ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ 2014. Ηµεροµηνία: Παρασκευή 25 Απριλίου 2014 ιάρκεια Εξέτασης: 3 ώρες ΑΠΑΝΤΗΣΕΙΣ

ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ 2014. Ηµεροµηνία: Παρασκευή 25 Απριλίου 2014 ιάρκεια Εξέτασης: 3 ώρες ΑΠΑΝΤΗΣΕΙΣ ΤΑΞΗ: ΚΑΤΕΥΘΥΝΣΗ: ΜΑΘΗΜΑ: Γ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗ ΒΙΟΛΟΓΙΑ Ηµεροµηνία: Παρασκευή 25 Απριλίου 2014 ιάρκεια Εξέτασης: 3 ώρες ΘΕΜΑ Α A1. α Α2. γ Α3. α Α4. α Α5. δ ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ Β Β1. α. Τα πολυπεπτίδια

Διαβάστε περισσότερα


ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΘΕΜΑ 1ο Να γράψετε στο τετράδιό σας τον αριθμό καθεμιάς από τις παρακάτω ημιτελείς προτάσεις 1 έως 5 και δίπλα το γράμμα που αντιστοιχεί στη λέξη ή τη φράση, η οποία

Διαβάστε περισσότερα


ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ 22 ΜΑΪΟΥ 2015 ΕΚΦΩΝΗΣΕΙΣ ΘΕΜΑ Α ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ 22 ΜΑΪΟΥ 2015 ΕΚΦΩΝΗΣΕΙΣ Να γράψετε στο τετράδιό σας τον αριθµό καθεµίας από τις παρακάτω ηµιτελείς προτάσεις Α1 έως Α5 και δίπλα το γράµµα που αντιστοιχεί

Διαβάστε περισσότερα

Osteogenesis Imperfecta (Ατελής Οστεογένεση ) Ομάδα: Πατρασκάκη Μυρτώ Τσιτσικλή Μαγδαληνή

Osteogenesis Imperfecta (Ατελής Οστεογένεση ) Ομάδα: Πατρασκάκη Μυρτώ Τσιτσικλή Μαγδαληνή Osteogenesis Imperfecta (Ατελής Οστεογένεση ) Ομάδα: Πατρασκάκη Μυρτώ Τσιτσικλή Μαγδαληνή Osteogenesis imperfecta Μενδελικό Νόσημα Συχνότητα στον πληθυσμό: 1:20.000 80-95% αυτοσωμικό επικρατές 10-15% αυτοσωμικό

Διαβάστε περισσότερα



Διαβάστε περισσότερα


ΣΥΝΘΕΣΗ ΝΑΝΟΠΟΡΩΔΩΝ ΔΟΜΩΝ ΟΞΕΙΔΙΟΥ ΤΟΥ ΑΛΟΥΜΙΝΙΟΥ ΜΕ ΤΗ ΜΕΘΟΔΟ ΤΗΣ ΑΝΟΔΙΩΣΗΣ. Ν. Λυμπέρη, Σ. Σπανού, Ε.Α. Παυλάτου ΣΥΝΘΕΣΗ ΝΑΝΟΠΟΡΩΔΩΝ ΔΟΜΩΝ ΟΞΕΙΔΙΟΥ ΤΟΥ ΑΛΟΥΜΙΝΙΟΥ ΜΕ ΤΗ ΜΕΘΟΔΟ ΤΗΣ ΑΝΟΔΙΩΣΗΣ Ν. Λυμπέρη, Σ. Σπανού, Ε.Α. Παυλάτου Εργαστήριο Γενικής Χημείας, Σχολή Χημικών Μηχανικών, Εθνικό Μετσόβιο Πολυτεχνείο, Ηρώων

Διαβάστε περισσότερα


ΥΛΙΚΑ ΠΑΡΟΝ ΚΑΙ ΜΕΛΛΟΝ ΥΛΙΚΑ ΠΑΡΟΝ ΚΑΙ ΜΕΛΛΟΝ Ι 2 Κατηγορίες Υλικών ΠΑΝΕΠΙΣΤΗΜΙΟ ΚΡΗΤΗΣ ΤΜΗΜΑ ΕΠΙΣΤΗΜΗΣ ΚΑΙ ΤΕΧΝΟΛΟΓΙΑΣ ΥΛΙΚΩΝ Παραδείγματα Το πεντάγωνο των υλικών Κατηγορίες υλικών 1 Ορυκτά Μέταλλα Φυσικές πηγές Υλικάπουβγαίνουναπότηγημεεξόρυξηήσκάψιμοή

Διαβάστε περισσότερα



Διαβάστε περισσότερα



Διαβάστε περισσότερα

Για το χρώµα σπέρµατος επικρατής είναι η ιδιότητα κίτρινο και η υπολειπόµενη το πράσινο. Συµβολίζουµε: Κ:Κίτρινο κ: Πράσινο Κ>κ

Για το χρώµα σπέρµατος επικρατής είναι η ιδιότητα κίτρινο και η υπολειπόµενη το πράσινο. Συµβολίζουµε: Κ:Κίτρινο κ: Πράσινο Κ>κ Απαντήσεις Βιολογία Κατεύθυνσης 2011 ΘΕΜΑ Α Α1 α Α2 δ Α3 γ Α4 β Α5 β ΘΕΜΑ Β Β1 Σελ. 13 «Το 1928 γίνεται αυτό» Β2 Σελ 101 «βλάβες στους επιδιορθωτικά ένζυµα» (Χωρίς να απαιτείται θα θεωρηθεί σωστό να γίνει

Διαβάστε περισσότερα

Τα ορμονικά μόρια και η διαχείριση τους μέσα στο φυτό

Τα ορμονικά μόρια και η διαχείριση τους μέσα στο φυτό Φυσιολογία Φυτών Διαχείριση ορμονικών μορίων Τα ορμονικά μόρια και η διαχείριση τους μέσα στο φυτό Φυσιολογία Φυτών 3 ου Εξαμήνου Δ. Μπουράνης, Σ. Χωριανοπούλου 1 Φυσιολογία Φυτών Διαχείριση ορμονικών

Διαβάστε περισσότερα

Νανοεπιστήμη & Νανοτεχνολογία

Νανοεπιστήμη & Νανοτεχνολογία Νανοεπιστήμη & Νανοτεχνολογία Η νανοεπιστήμη ανακαλύπτει νέες συμπεριφορές και ιδιότητες των υλικών σε διαστάσεις νανοκλίμακας που κυμαίνεται κατά προσέγγιση από 1 έως 100 νανόμετρα (nm). Η νανοτεχνολογία

Διαβάστε περισσότερα

Φυσική Στερεών στις Πρωτεΐνες

Φυσική Στερεών στις Πρωτεΐνες Φυσική Στερεών στις Πρωτεΐνες Νίκος Απ. Παπανδρέου Τ.Ε.Ι. Πειραιά Φεβρουάριος 2010 Ένα ελικοϊδές μονοπάτι Χημική δομή μίας πρωτεΐνης Μήκος αλυσίδας ~30 έως ~1000 αµινοξέα Συνολικός αριθµός ατόµων έως ~

Διαβάστε περισσότερα

Εργαλεία Μοριακής Γενετικής

Εργαλεία Μοριακής Γενετικής Εργαλεία Μοριακής Γενετικής Αρχές Μοριακής κλωνοποίησης Τα περιοριστικά ένζυμα: αναγνωρίζουν αλληλουχίες (θέσεις περιορισμού). 2 τύποι ενζύμων: -Τύπος I = Κόβουν κοντά στη θέση περιορισμού -σπάνια χρησιμοποιούνται.

Διαβάστε περισσότερα


ΚΕΦΑΛΑΙΟ IV ΜΕΤΑΒΟΛΙΣΜΟΣ ΤΩΝ ΒΑΚΤΗΡΙΩΝ ΚΕΦΑΛΑΙΟ IV 1 V ΜΕΤΑΒΟΛΙΣΜΟΣ ΤΩΝ ΒΑΚΤΗΡΙΩΝ ΚΕΦΑΛΑΙΟ IV 1 V ΜΕΤΑΒΟΛΙΣΜΟΣ ΤΩΝ ΒΑΚΤΗΡΙΩΝ ΚΕΦΑΛΑΙΟ IV ΜΕΤΑΒΟΛΙΣΜΟΣ ΤΩΝ ΒΑΚΤΗΡΙΩΝ I. Γενικότητες Αναλόγως των τροφικών τους απαιτήσεων τα µικρόβια διαιρούνται σε κατηγορίες: - αυτότροφα που χρησιµοποιούν

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ 16-2-2014 ΘΕΜΑ 1 ο Α. Να βάλετε σε κύκλο το γράμμα που αντιστοιχεί στη σωστή απάντηση. (Μονάδες 25)

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ 16-2-2014 ΘΕΜΑ 1 ο Α. Να βάλετε σε κύκλο το γράμμα που αντιστοιχεί στη σωστή απάντηση. (Μονάδες 25) ΤΣΙΜΙΣΚΗ &ΚΑΡΟΛΟΥ ΝΤΗΛ ΓΩΝΙΑ THΛ: 270727 222594 ΑΡΤΑΚΗΣ 12 - Κ. ΤΟΥΜΠΑ THΛ: 919113 949422 ΕΠΩΝΥΜΟ:... ΟΝΟΜΑ:... ΤΜΗΜΑ:... ΗΜΕΡΟΜΗΝΙΑ:... ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ 16-2-2014 ΘΕΜΑ 1 ο Α. Να βάλετε σε

Διαβάστε περισσότερα


ΦΥΛΛΟ ΕΡΓΑΣΙΑΣ ΣΤΗ ΒΙΟΛΟΓΙΑ Γ ΛΥΚΕΙΟΥ ΦΥΛΛΟ ΕΡΓΑΣΙΑΣ ΣΤΗ ΒΙΟΛΟΓΙΑ Γ ΛΥΚΕΙΟΥ ΕΝΟΤΗΤΑ: ΕΝΖΥΜΑ ΚΑΘΗΓΗΤΗΣ: ΠΑΤΗΡ ΑΝΑΣΤΑΣΙΟΣ ΙΣΑΑΚ 1. Να εξηγήσετε γιατί πολλές βιταμίνες, παρά τη μικρή συγκέντρωσή τους στον οργανισμό, είναι πολύ σημαντικές για

Διαβάστε περισσότερα

Θέματα Πανελλαδικών 2000-2013

Θέματα Πανελλαδικών 2000-2013 Θέματα Πανελλαδικών 2000-2013 ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΗΜΕΡΗΣΙΩΝ ΛΥΚΕΙΩΝ ΕΣΠΕΡΙΝΩΝ ΛΥΚΕΙΩΝ ΕΠΑΝΑΛΗΠΤΙΚΕΣ Κεφάλαιο 4 ΚΕΦΑΛΑΙΟ 4 ΘΕΜΑ 1 ο Γράψτε τον αριθμό καθεμιάς από τις παρακάτω προτάσεις και δίπλα το γράμμα

Διαβάστε περισσότερα



Διαβάστε περισσότερα


Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΒΙΟΛΟΓΙΑ ΑΠΑΝΤΗΣΕΙΣ ÏÅÖÅ 1 Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΒΙΟΛΟΓΙΑ ΘΕΜΑ 1 o 1 Β 2 3 Γ 4 5 Β. ΘΕΜΑ 2 o ΑΠΑΝΤΗΣΕΙΣ Α. Όπως στο σχολικό, σελίδα 20: «Κάθε φυσιολογικό µεταφασικό ως προς τη θέση του κεντροµεριδίου» και σελίδα «Κατά

Διαβάστε περισσότερα

γ ρ α π τ ή ε ξ έ τ α σ η σ τ ο μ ά θ η μ α

γ ρ α π τ ή ε ξ έ τ α σ η σ τ ο μ ά θ η μ α γ ρ α π τ ή ε ξ έ τ α σ η σ τ ο μ ά θ η μ α ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ' ΛΥΚΕΙΟΥ Τάξη: Γ Λυκείου Τμήμα: Βαθμός: Ονοματεπώνυμο: Καθηγητές: Θ Ε Μ Α Να επιλέξετε τη σωστή απάντηση: Α1. Στην τεχνολογία

Διαβάστε περισσότερα