ΚΛΩΝΙΚΗ ΕΠΙΛΟΓΗ ΚΥΤΤΑΡΑ ΜΝΗΜΗΣ (ΕΠΙΒΙΩΣΗ ΕΚΑΕΤΙΕΣ)

Μέγεθος: px
Εμφάνιση ξεκινά από τη σελίδα:

Download "ΚΛΩΝΙΚΗ ΕΠΙΛΟΓΗ ΚΥΤΤΑΡΑ ΜΝΗΜΗΣ (ΕΠΙΒΙΩΣΗ ΕΚΑΕΤΙΕΣ)"

Transcript

1 ΚΛΩΝΙΚΗ ΕΠΙΛΟΓΗ ANTIΓΟΝΟ ΑΡΧΙΚΗ ΕΞΑΜΕΝΗ ΛΕΜΦΟΚΥΤΤΑΡΩΝ (ΑΝΕΞΆΡΤΗΤΗ ΑΝΤΙΓΟΝΟΥ} ΕΠΙΛΟΓΗ ΚΛΩΝΟΥ (ΠΑΡΟΥΣΙΑ ΑΝΤΙΓΟΝΟΥ) ΑΥΞΗΣΗ ΑΡΙΘΜΟΥ ΩΡΙΜΑΝΣΗ ΑΝΤΙΣΩΜΑ ΕΚΤΕΛΕΣΤΙΚΑ ΚΥΤΤΑΡΑ (ΕΠΙΒΙΩΣΗ ΜΕΡΙΚΕΣ ΜΕΡΕΣ) ΚΥΤΤΑΡΑ ΜΝΗΜΗΣ (ΕΠΙΒΙΩΣΗ ΕΚΑΕΤΙΕΣ) Το αντιγόνο επιλέγει τα κύτταρα µε την κατάλληλη εξειδίκευση και προκαλεί τον πολ/σµό τους και την παραγωγή των αντισωµάτων Προϋπόθεση λειτουργίας να υπάρχει µηχανισµός παραγωγής τεράστιου αριθµού διαφορετικών Igs απουσία δυνάµεων επιλογής

2 ΩΡΙΜΑΝΣΗ Β ΚΥΤΤΑΡΩΝ ΚΥΤΤΑΡΟ Έκφραση Ig Προγονικό αιµοποιητικό κύτταρο Όχι Mυελός των οστών Κύτταρο Λεµφικής Σειράς Μερικός ανασυνδυασµός γονιδίου βαριάς αλυσίδας Προ-προ Β κύτταρο (pro-b cell) Ολικός ανασυνδυασµός γονιδίου βαριάς αλυσίδας Προ-Β κύτταρο (pre-b cell) Ανασυνδυασµός γονιδίου ελαφριάς αλυσίδας Ανώριµο Β κύτταρο Αλλαγή στη συρραφή του RNA Ωριµο Β κύτταρο Όχι Όχι µ βαριά aλυσίδα +βοηθητική migm migm+migd

3 ΩΡΙΜΑΝΣΗ Β ΚΥΤΤΑΡΩΝ ΚΥΤΤΑΡΟ Έκφραση Ig Περιφερικά λεµφικά όργανα Ωριµο Β κύτταρο ιέγερση από αντιγόνο Ενεργοποίηση Β κυττάρου ιαφοροποίηση Πλασµατοκύτταρα που εκκρίνουν IgM Μετάπτωση τάξης migm+migd Πλασµατοκύτταρα που εκκρίνουν διάφορους ισότυπους Ig Β κύτταρα µνήµης

4 Ισότυπος Ab Υπότυποι Βαριά αλυσίδα Συγκέντρωση ορού Χρόνος Ηµιζωής (ηµέρες) Εκκρινόµενη µορφή Λειτουργία ΙgA IgA 1,2 α (1 ή 2) Μονο, δι, τριµερές Βλεννογονική ανοσία νεογνική παθητική ανοσία IgD - δ Ιχνη 3 Όχι Αντιγονικός Υποδοχέας παρθένων Β κυττάρων IgE - ε Αµεση υπερευαισθησία IgG IgG1-4 γ(1,2,3, ή 4) 13,5 23 Ωψωνινοποίηση, ADCC, νεογνική ανοσία, ενεργ. συµπληρώµατος IgM - µ 1,5 5 Αντιγονικός Υποδοχέας παρθένων Β κυττάρων, ενεργ. συµπληρώµατος

5 Αναδιάταξη των γονιδίων των ανοσοσφαιρινών: πειραµατική προσέγγιση

6 Mεταβλητότητα αµινοξέων στη µεταβλητή V περιοχή VH CH VL CL FR1 FR2 FR3 FR4 CDR1 CDR2 CDR3 FR: Framework Region = περιοχή πλαισίου CDR: Complementarity Determining region =περιοχή που καθορίζει συµπληρωµατικότητα

7 Mεταβλητότητα αµινοξέων στη µεταβλητή V περιοχή Ελαφριά αλυσίδα ss s FR1 CDR1 FR2 CDR2 FR3 CDR3 FR4 Βαριά αλυσίδα ss s FR1 CDR1 FR2 CDR2 FR3 CDR3 FR4 I II III IV V CDR1 CDR EVGLVESGGGLVGQPGGSLRLSCAASGFTFSTSAVVWVRGARGKGLEWVGWRVEGSSLTHYAVSVG L S D M A K QEA NS F DT M D K AWMK V V QVVELAF N N A G TSRT EF VG AIS D L RVLSF SG LNA NL F A I II III IV V CDR GRFTISRNDSKNTLYLQMLSLEPZBTAVYYCARVTPAAASLTFSAVWGQGTLV NR A FRQ FVQ [--] FD F I VT VVST[---] SMD P A NTG A TR GGY[---] D QA LSVT V[---] AFD

8 Τοποθέτηση των γονιδίων των ανοσοσφαιρινών στα χρωµοσώµατα ΧΡΩΜΟΣΩΜΑΤΑ Γονίδιο Ανθρωπος Ποντίκι λ ελαφριά αλυσίδα κ ελαφριά αλυσίδα 2 6 Βαριά αλυσίδα 14 12

9 ΗΜΙΟΥΡΓΙΑ ΠΟΙΚΙΛΟΤΗΤΑΣ ΑΝΤΙΣΩΜΑΤΩΝ (ΡΕΠΕΡΤΟΡΙΟ Β ΚΥΤΤΑΡΩΝ) 1. Οργάνωση των γονιδίων των ανοσοσφαιρινών 2. Σωµατικός ανασυνδυασµός Αναδιάταξη γονιδίων 3. Μεταβλητός ανασυνδυασµός (Junctional diversity) 4. Προσθήκη Ν-νουκλεοτιδικής περιοχής 5. Σωµατικές µεταλλαγές (Somatic mutations) 6. Συνδυασµός αλυσίδων

10 ΗΜΙΟΥΡΓΙΑ ΠΟΙΚΙΛΟΤΗΤΑΣ ΑΝΤΙΣΩΜΑΤΩΝ (ΡΕΠΕΡΤΟΡΙΟ Β ΚΥΤΤΑΡΩΝ) 1. Οργάνωση των γονιδίων των ανοσοσφαιρινών

11 Οργάνωση γονιδίων ανοσοσφαιρινών Γενετικός τόπος βαριών H αλυσίδων (χρωµόσωµα 14) S1 VH1 SLn VHn D JH Cµ C δ Cγ3 Cγ1 Cγ2b 5 Cγ2a Cε Cα 3 CH1 CH2 CH3 CH4 SC Γενετικός τόπος κ ελαφριών αλυσίδων (χρωµόσωµα 2) S1 V κ1 Sn Vκn J κ C κ 5 3 Γενετικός τόπος λ ελαφριών αλυσίδων (χρωµόσωµα 22) S1 Vλ1 Sn Vλn Jλ1 C λ1...jλ6 C λ6 5 3 S=πεπτίδιο οδηγός, n= ~100 V= µεταβλητό γονιδιακό τµήµα, D=γονιδιακό τµήµα ετερογένειας J= συνδετικό γονιδιακό τµήµα, C= γονιδιακό τµήµα σταθερής περιοχής

12 ΗΜΙΟΥΡΓΙΑ ΠΟΙΚΙΛΟΤΗΤΑΣ ΑΝΤΙΣΩΜΑΤΩΝ (ΡΕΠΕΡΤΟΡΙΟ Β ΚΥΤΤΑΡΩΝ) 1. Οργάνωση των γονιδίων των ανοσοσφαιρινών 2. Σωµατικός ανασυνδυασµός Αναδιάταξη γονιδίων

13 Αναδιάταξη των γονιδίων των βαριών αλυσίδων στα B κύτταρα. DNA βλαστικών κυττάρων (Stem cell) 5 S1 VH1 Sn VHn D JH CHµ... CΗα 3 D -J αναδιάταξη DNA B κυττάρων α. 5 S1 VH1 Sn VHn D JH CHµ... CΗα 3 V-DJ αναδιάταξη β. 5 S1 VH1D JH CHµ... CΗα 3 Μεταγραφή hmrna 5 S1 VH1D JH CHµ... CΗα 3 Συρραφή RNA (splicing) mrna S VH DJ Cµ AAA Μετάφραση πρωτεΐνη

14 Αναδιάταξη των γονιδίων των ελαφριών κ αλυσίδων στα Β κύτταρα S1 Vκ1 Sn Vκn J κ Cκ S1 Vκ1 Jκ V-J αναδιάταξη Cκ 3 Μεταγραφή hmrna 5 S1 Vκ1 Jκ Cκ 3 Συρραφή RNA (splicing) mrna S Vκ J πρωτεΐνη C Μετάφραση AAA

15 AΛΛΗΛΟΥΧΙΕΣ ΑΝΑΓΝΩΡΙΣΗΣ ΑΝΑΣΥΝ YΑΣΜΟΥ (Recombination Signal Sequences - RSS) 1. Nουκλεοτιδική αλληλουχία των RSSs: είναι συντηρηµένες παλίνδροµες αλληλουχίες αποτελούν θέσεις πρόσδεσης δύο υποµονάδων ανασυνδυάσης 2-στροφές στην έλικα του DNA 1-στροφή στην έλικα του DNA

16 AΛΛΗΛΟΥΧΙΕΣ ΑΝΑΓΝΩΡΙΣΗΣ ΑΝΑΣΥΝ YΑΣΜΟΥ (Recombination Signal Sequences - RSS)

17 Κανόνας 23/12 5 Vλ Jλ CACAGTG ACAAAAACC GGTTTTTGT CACTGTG 3 7-µερές 9-µερές C --- G C --- G A --- T A --- T A --- T A --- T A --- T C --- G A --- T 9-µερές 7-µερές Vλ G --- C T --- A G --- C A --- T C --- G A --- T C --- G Jλ 3

18 Mηχανισµοί V-J αναδιάταξης Eλλειπτικός Αντιστροφή V J V J V 9 9 V J J V J V J 9 V J 5 3 V J 5 3

19 Αποµόνωση κυκλικού DNA από θυµοκύτταρα στα οποία το DNA που κωδικοποιεί τις αλυσίδες του TCR υφίσταται V-D-J και V-J γονιδιακή αναδιάταξη

20 ΗΜΙΟΥΡΓΙΑ ΠΟΙΚΙΛΟΤΗΤΑΣ ΑΝΤΙΣΩΜΑΤΩΝ (ΡΕΠΕΡΤΟΡΙΟ Β ΚΥΤΤΑΡΩΝ) 1. Οργάνωση των γονιδίων των ανοσοσφαιρινών 2. Σωµατικός ανασυνδυασµός Αναδιάταξη γονιδίων 3. Μεταβλητός ανασυνδυασµός (Junctional diversity)

21 3. Μεταβλητός ανασυνδυασµός (Junctional diversity)

22 Ελλείψεις νουκλεοτιδίων στις συνδέσεις Aλληλουχία βλαστικής σειράς (germline) Vk21 C C C C C C T G G Jk1 C C C C C C T G G C C C T G G Pro-Try Αλληλουχία κατά την έκφραση C C C C C C T G G C C C C G G Pro-Arg C C C C C C T G G C C C C C G Pro-Pro C C C C C C T G G C C C C C C Pro-Pro Αλληλουχία εκτός πλαισίου ανάγνωσης C C C C C C T G G C C C C T G G V1 D J C V1 D J C Αφαίρεση νουκλεοτιδίων από νουκλεάσες

23 Παραγωγικές και µη-παραγωγικές αναδιατάξεις RSS C A C T G T G Jk G T G G A C T A G G G A G G A T G C T C C Vk C A C T G T G RSS Glu Asp Ala Thr Arg 1 G A G G A T G C G A C T A G G Παραγωγική αναδιάταξη 2 3 Glu Asp Gly Thr Arg G A G G A T G G C G A C T A G Glu Asp Trp Thr Arg G A G G A T T G G A C T A G G Μη-παραγωγική αναδιάταξη 4 5 Glu Asp Ala Asp stop G A G G A T G C G G A C T A G Glu Val Asp stop G A G G T G G A C T A G

24 Κατά τον αλληλικό αποκλεισµό στο κύτταρο εκφράζονται µόνο η µια βαριά και η µια ελαφριά αλυσίδα της ανοσοσφαιρίνης από τον ένα γονέα. Το Β κύτταρο έχει µια µόνο αντιγονική ειδικότητα.

25 Αλληλικός αποκλεισµός

26 ΗΜΙΟΥΡΓΙΑ ΠΟΙΚΙΛΟΤΗΤΑΣ ΑΝΤΙΣΩΜΑΤΩΝ (ΡΕΠΕΡΤΟΡΙΟ Β ΚΥΤΤΑΡΩΝ) 1. Οργάνωση των γονιδίων των ανοσοσφαιρινών 2. Σωµατικός ανασυνδυασµός Αναδιάταξη γονιδίων 3. Μεταβλητός ανασυνδυασµός (Junctional diversity) 4. Προσθήκη Ν-νουκλεοτιδικής περιοχής

27 Μηχανισµός Προσθήκης P- νουκλεοτιδίων

28 Μηχανισµός Προσθήκης N- νουκλεοτιδίων Ακροτελική δεοξυνουκλεοτιδυλοτρανσφεράση (ΤdΤ)

29 Περιοχή προσθήκης Ν νουκλεοτιδίων Αλληλουχία βλαστικής σειράς (germline) VH Τ C Α C C + C C A Τ G A C D H Noυκλεοτίδια Ν περιοχής Αλληλουχία κατά την έκφραση VH Τ C Α C C C C A Τ G A C D H Ser-Pro-His-Asp V1 D J C V1 D J C Προσθήκη νουκλεοτιδίων ή περιοχή Ν

30 ΗΜΙΟΥΡΓΙΑ ΠΟΙΚΙΛΟΤΗΤΑΣ ΑΝΤΙΣΩΜΑΤΩΝ (ΡΕΠΕΡΤΟΡΙΟ Β ΚΥΤΤΑΡΩΝ) 1. Οργάνωση των γονιδίων των ανοσοσφαιρινών 2. Σωµατικός ανασυνδυασµός Αναδιάταξη γονιδίων 3. Μεταβλητός ανασυνδυασµός (Junctional diversity) 4. Προσθήκη Ν-νουκλεοτιδικής περιοχής 5. Σωµατικές µεταλλαγές (Somatic mutations)

31 Σωµατικές µεταλλαγές στα V γονίδια των ανοσοσφαιρινών (Somatic mutations)

32 Σωµατικές µεταλλαγές στα V γονίδια των ανοσοσφαιρινών (Somatic mutations) Ανοσιακή απάντηση 7η µέρα Πρωτογενής VH CDR1 CDR2 CDR3 J3 J3 J3 J3 J3 J4 J4 J4 J2 VL CDR1 CDR2 CDR3 KD 10-7 M η µέρα Πρωτογενής J3 J3 J3 J J3 0.9 J4 ευτερογενής J Τριτογενής D J ιαφορετικό νουκλεοτίδιο Mεταλλαγές: Σε όλες τις βάσεις Μεταλλαγή µετάπτωσης (transition): Pu Pu, Py Py (A G, C T) Μεταλλαγή µετατροπής (transversion): Pu Py, Py Pu Eνθέσεις Ελλείψεις J4 J4 J3 <0.03 <0.03 <0.03 Μεταλλαγή που οδηγεί σε διαφορετικό αµινοξύ

33

34 ΗΜΙΟΥΡΓΙΑ ΠΟΙΚΙΛΟΤΗΤΑΣ ΑΝΤΙΣΩΜΑΤΩΝ (ΡΕΠΕΡΤΟΡΙΟ Β ΚΥΤΤΑΡΩΝ) 1. Οργάνωση των γονιδίων των ανοσοσφαιρινών 2. Σωµατικός ανασυνδυασµός Αναδιάταξη γονιδίων 3. Μεταβλητός ανασυνδυασµός (Junctional diversity) 4. Προσθήκη Ν-νουκλεοτιδικής περιοχής 5. Σωµατικές µεταλλαγές (Somatic mutations) 6. Συνδυασµός αλυσίδων

35 ΣΥΝ ΥΑΣΤΙΚΗ ΣΥΝ ΕΣΗ ΑΛΥΣΙ ΩΝ Π.χ. Εαν υπάρχουν 10 4 διαφορετικές ελαφριές αλυσίδες και 10 4 διαφορετικές βαριές αλυσίδες µπορούν να παραχθούν θεωρητικά 10 8 διαφορετικά αντισώµατα

36 ΡΕΠΕΡΤΟΡΙΟ Β ΚΥΤΤΑΡΩΝ Στο ποντίκι Ελαφριά αλυσίδα Μηχανισµός ποικιλότητας Βαριά αλυσίδα κ λ Αριθµός γονιδιακών τµηµάτων 1. Πολλαπλά γονιδιακά τµήµατα V D J Πιθανός αριθµός ανασυνδυασµών 2. Αναδιάταξη V-J και V-D-J 300 Χ 13 Χ 4 =1.6 Χ Χ 4=1.2 Χ Χ 3 = 6 3. Μεταβλητός ανασυνδυασµός Προσθήκη Ν νουκλεοτιδίων Σωµατική µεταλλαγή Συνδυαστική σύνδεση >1.6 Χ 10 4 Χ (>1.2 Χ >6) =>>1.9 Χ 10 7

37 Locations of promoters, enhancers, & silencers in mouse heavy chain, κ chain and λ light chain germline DNA. Variable gene rearrangement moves an enhancer close enough to a promoter to activate transcription from the promoter. Hence, DNA rearrangement greatly accelerates immunoglobulin gene transcription Transcription factors that are important for immunoglobulin gene expression Oct 2 B-cell specific transcription factor E2A alternatively spliced to give rise to two collaborating proteins. E2A proteins are essential for B- cell development. No B cells in E2A knock-out mice. Expression of E2A in a T-cell line results in a dramatic increase in the transcription of µ chain mrna and induction of T cells to undergo DHJH joining.

38 Proposed mechanism for class switching induced by IL-4 in rearranged immunoglobulin heavy chain genes

39 Expression of membrane & secreted forms of immunoglobulin heavy chain

40 Alternative splicing regulates production of membrane-bound versus secreted µ heavy chain

41 Μαγικές σφαίρες = αντισώµατα Ο Paul Ehrlich, στις αρχές του προηγούµενου αιώνα, διετύπωσε τη θεωρία των υποδοχέων (σήµερα γνωστοί ως αντισώµατα) που εκκρίνονται από κύτταρα του ανοσοποιητικού συστήµατος ως απάντηση σ ένα ξένο αντιγόνο.

42 CΟΟΗ ΝΗ2 οµή και λειτουργία των ανοσοσφαιρινών Fv Fab Σταθερή περιοχή V-περιοχή Πρόσδεση αντιγόνου Fv VH Fab Cγ1 ΙgG CL VL Fv Fab V περιοχή Fc Cγ3 Cγ2 Πρόσδεση συµπληρώµατος Πρόσδεση του Fc υποδοχέα C περιοχή

43 οµή V περιοχών των ανοσοσφαιρινών VH VL CL CH FR: Framework Region = περιοχή πλαισίου CDR: Complementarity Determining region = περιοχή που καθορίζει συµπληρωµατικότητα FR1 FR2 FR3 FR4 CDR1 CDR2 CDR3 ΝΗ2 V-περιοχή Σταθερή περιοχή VH VL CΟΟΗ

44 Moνοκλωνικά αντισώµατα (mabs) 1975: Köhler και Milstein τεχνολογία µονοκλωνικών αντισωµάτων (µία κυτταρική σειρά µπορεί να εκκρίνει αντισώµατα µιάς ειδικότητας, δηλαδή να αναγνωρίζει ένα συγκεκριµένο αντιγόνο) Το νεοπλασµατικό κύτταρο διαιρείται επ άπειρον αλλά δεν παράγει mabs ΣΥΝΤΗΞΗ ΥΟ ΚΥΤΤΑΡΩΝ Το Β-λεµφοκύτταρο ενός ζώου το οποίο έχει ανοσοποιηθεί µε ένα αντιγόνο παράγει το ειδικό αντίσωµα, αλλά δεν διαιρείται επ άπειρον. Το υβριδικό κύτταρο παράγει ειδικό αντίσωµα και διαιρείται επ άπειρον.

45 Χρήση µονοκλωνικών αντισωµάτων Βιοµηχανία: Μαζική παραγωγή αντισωµάτων Ερευνα: Λειτουργική ανάλυση µορίων (βιοχηµική και µικροσκοπική ανίχνευση και αποµόνωση, διερέυνηση λειτουργίας) Αναγνώριση µεµβρανικών δεικτών (χαρακτηρισµός συγκεκριµένων κυττάρων κλπ) ιαγνωστική και Θεραπευτική Ιατρική: Ανοσοδιάγνωση (λοιµωδών ή συστηµατικών νοσηµάτων µε προσδιορισµό ειδικών αντιγόνων ή αντισωµάτων, διαγνωστική απεικόνιση όγκων, κλπ) Ανοσοθεραπεία (θεραπεία όγκων, µεταµόσχευση οργάνων, εµβόλια κλπ)

46 Προβλήµατα από τη χρήση µονοκλωνικών αντισωµάτων στην ιατρική Ευαισθητοποίηση του οργανισµού µετά την in vivo χορήγηγη ξενογενών µονοκλωνικών αντισωµάτων υσκολία δηµιουργίας φυσικής αλληλεπίδρασης µεταξύ του αντισώµατος και του αντιγόνου στόχου Αλλαγή στη δοµή του αντιγόνου Χαµηλή συγγένεια Μη ικανοποιητικός ισότυπος Μη ικανοποιητικός χρόνος ηµιζωής Μικρή παραγωγή Υψηλό οικονοµικό κόστος

47 Aνάγκη κατασκευής ανασυνδυασµένων αντισωµάτων ή τµηµάτων αντισωµάτων ΓΕΝΕΤΙΚΗ ΜΗΧΑΝΙΚΗ Κατασκευή ανοσοσυµβατών αντισωµάτων Αλλαγή χρόνου ηµιζωής Αλλαγή ισοτύπου Aύξηση συγγένειας και ειδικότητας Kατασκευή αντισωµάτων µε δύο ειδικότητες Kατασκευή µορίων που έχουν και άλλες ιδιότητες Αλλαγή λειτουργικότητας Eύκολη, γρήγορη, µαζική παραγωγή Χαµηλότερο οικονοµικό κόστος

48 Τροποποιηµένα αντισώµατα Υβρίδωµα από ποντίκι In vitro βιβλιοθήκες αντισωµάτων ιαγονιδιακά ποντίκια Ανθρώπινα Υβριδώµατα ποντικίσιο χιµαιρικό ανθρωποποιηµένο ανθρώπινο Γενετική µηχανική Κλωνοποίηση V γονιδίων Mεταµόσχευση CDR τµηµάτων Ευκαρυωτική έκφραση

49 Κατασκευή χιµαιρικών αντισωµάτων

50 Κατασκευή χιµαιρικών και υβριδικών µονοκλωνικών αντισωµάτων µε τεχνικές ανασυνδυασµένου DNA

51 Aνθρωποποιηµένa αντισώµατα Ab ποντικού Ab ανθρώπου Fv Ab χίµαιρα CDRs Ab ανθρωποποιηµένο

52 Ανασυνδυασµένα τµήµατα αντισωµάτων NH 2 NH 2 NH 2 NH 2 NH 2 NH 2 VL VH VH VL VL VH VL VH VL VH VH VL CL CH1 CH1 CL CL CH1 COOH COOH COOH COOH -S-S- H H -S-S- -S-S- -S-S- -S-S- COOH COOH Fv scfv (single chain Fv) CH2 CH2 Fab CH3 CH3 VH VL IgG VL VH CH1 CL VL VH

53 Νεότερες τεχνολογίες Fv τµηµάτων Γονίδια Μορφή scfv Triabody Diabody

54 Εκφραση των scfv και Fab τµηµάτων των αντισωµάτων στην επιφάνεια νηµατοειδών φάγων. V H V L scfv V H V L Fab C Η C L piii piii

55 Μολυσµατικός κύκλος νηµατοειδών φάγων. ιοσωµάτιο piii Εισβαλόµενο ιοσωµάτιο Εκβαλόµενο ιοσωµάτιο pviii pvi περίπλασµα κυτταρόπλασµα pv-ssdna pvii pix + κλώνος pii, px pii, px + κλώνος pv RF

56 ιαλυτή έκφραση τµηµάτων αντισώµατος σε E. coli (µερική λύση της κυτταροπλασµατικής µεµβράνης) periplasm VL CH1 VH CL N pelb C N pelb VH CH1 VL CL Coat protein III C phen1 amp R

57 Κατασκευή scfv τµήµατος του αντισώµατος υβρίδωµα mrna AAA RT µε ειδικά Ig εναρκτήρια µόρια cdna AAA PCR µε ειδικά Ig εναρκτήρια µόρια VH VL VH VL scfv Linker Εισαγωγή περιοριστικών θέσεων lacz pelb scfv φαγεµίδιο piii ιαλυτή έκφραση στο υπερκείµενο της καλλιέργειας

58 Kατασκευή Fab βιβλιοθήκης φάγων από Β λεµφοκύτταρα B λεµφοκύτταρα B κύτταρα Αποµόνωση RNA Σύνθεση cdna RT µε ειδικά Ig εναρκτήρια µόρια cdna AAA AAA mrna Ενζυµική ενίσχυση (PCR) PCR µε ειδικά Ig εναρκτήρια µόρια VH-CH1 VL-CL Προσθήκη περιοριστικών θέσεων Κλωνοποίηση στο φαγεµίδιο pcomb3h VH-CH1 VL-CL lacz pelb VH-CH1 lacz pelb VL-CL piii Φαγεµίδιο pcomb3h Πολυπλοκότητα βιβλιοθηκών Βιβλιοθήκη: 1-5X10 7 cfu/µg DNA Στάδια PCR: 2 Εναρκτήρια µόρια PCR: 26 Συνδέσεις: 2 Αποµόνωση των ειδικών φάγων - αντισωµάτων µε panning

59 Στρατηγική κλωνοποίησης ανθρώπινων µoνοκλωνικών τµηµάτων αντισωµάτων από βιβλιοθήκες φάγων-αντισωµάτων Β λεµφοκύτταρα περιφερικού, µυελού των οστών, σπληνοκύτταρα, κλπ RNA PCR, κατασκευή βιβλιοθήκης πολλαπλασιασµός 5-10 φορές Αποµάκρυνση µη-ειδικών φάγωναντισωµάτων Αντιγόνο Επιµόλυνση βακτηρίων µε τους εκλουόµενους φάγους Παρασκευή διαλυτού Fab Xαρακτηρισµός Fab

60

61 Επιλογή των Fabs (Panning) (Εµπλουτισµός φάγων / κύκλο επιλογής) ,

62 ιαλυτή έκφραση των scfv και Fab τµηµάτων των ανοσοσφαιρινών Από την επιφάνεια των νηµατοειδών φάγων Στo περίπλασµα της E.coli V H V L Fab Fab C Η C L V H V L piii E.coli C Η C L deletion Spe I Nhe I Lac Z promoter RIBS Omp A stop RIBS pelb Gene III (aa )stopstop Light chain Heavy chain

63 Πλασµατοκύτταρο Βλαστικό κύτταρο 1, 2 Β κύτταρο Αντιγόνο 5 Αντιγόνο Μη ανασυνδυασµένα V-γονίδια Ανασυνδυασµένα V- γονίδια 3 Β κύτταρο 4 Κύτταρο µνήµης Αντιγόνο Αντιγόνο V-γονίδια 4 1 E. coli E. coli V-γονίδια σε φαγεµίδιο

64 Η Μ Ι Ο Υ Υ Ρ Γ Ι Α mab κατασκευασµένα µε τον παραδοσιακό τρόπο ανοσοποίηση µε αντιγόνο-στόχο Αποµόνωση σπληνοκυττάρων Ab εκφρασµένα στην επιφάνεια της ουράς του φάγου Επιλογή στο αντιγόνοστόχο Βιβλιοθήκες αντισωµάτων σε φάγους Αb από διαγονιδιακά ποντίκια ανοσοποίηση µε αντιγόνο-στόχο Αποµόνωση σπληνοκυττάρων Α Ρ Χ Ι Κ Ο Υ Κατασκευή υβριδωµάτων Κατασκευή υβριδωµάτων ιαλογή ιαλογή ιαλογή mab Π Ε Ρ Α Ι Τ Ε Ρ Ω Χ Ε Ι Ρ Ι Σ Μ Ο Ι ΑΠΟΤΕΛΕΣΜΑ Αποµόνωση καλύτερου mab Χιµαιρικό Αb Ανθρωποποιηµένο Ab Ανθρωποποιηµένο mab: 90-95% ανθρώπινο Χιµαιρικό mab: 60-70% ανθρώπινο H εξειδίκευση και η συγγένεια εξαρτάται από το αρχικό mab που προέρχεται από το τρωκτικό ηµιουργία ποικιλόµορφων Επιλογή στο αντιγόνοστόχο ιαλογή (εκατοντάδες) Κατασκευή επιθυµητού µορίου Πλήρως ανθρώπινο mab H εξειδίκευση, η συγγένεια και η βιολογική ενεργότητα εξαρτάται από την ελεγχόµενη διαδικασία επιλογής Αποµόνωση καλύτερου mab Περιορισµένος αριθµός τροποποιήσεων Πλήρως ανθρώπινο mab H εξειδίκευση και η συγγένεια εξαρτάται από την ανοσολογική απάντηση του διαγονιδιακού ποντικού

65 ΙΑΓΟΝΙ ΙΑΚΑ ΑΝΘΡΩΠΟΠΟΙΗΜΕΝΑ ΠΟΝΤΙΚΙΑ Τα ενδογενή γονίδια των ανοσοσφαιρινών έχουν αδρανοποιηθεί Φέρουν γονιδιακούς τόπους των ανθρώπινων γονιδίων των ανοσοσφαιρινών

66 Αποµόνωση ανθρώπινων αντισωµάτων από «ανθρωποποιηµένα» ποντίκια

67 Ιn vitro ωρίµανση συγγένειας chain shuffling 1η βιβλιοθήκη 2η βιβλιοθήκη 3η βιβλιοθήκη

68 Η in vivo διάγνωση αναπτύσσεται κυρίως µε τµήµατα αντισωµάτων scfv Γρήγορη προσέγγιση του όγκου (τo scfv 7 φορές γρηγορότερα από το Fab) Καλύτερη απεικόνιση του όγκου Γρήγορη αποµάκρυνση από τα όργανα, ιστούς Αυξηµένο ποσοστό που προσεγγίζει τον στόχο

69 Θεραπευτική προσέγγιση µε ανασυνδυασµένα αντισώµατα I. Mεταµόσχευση οργάνων, ιστών II. Προστασία έναντι ιών III. Ογκολογία IV. Aυτοάνοσα νοσήµατα

70

71 Ανοσολογικά χαρακτηριστικά της απόρριψης ΑPC Κύτταρα µοσχεύµατος CD4 ΤΗ ΤΗ CD8 ΤC ΙL-2 TNFγ κυτταροκίνες B ΙL-2 IL-4 IL-5 TNF β IFN γ Μφ Eνεργοποίηση Αντίσωµα Συµπλήρωµα ΤC Κυταροτοξικότητα µεσολαβούµενη από τα κύτταρα Κυταροτοξικότητα µεσολαβούµενη από τα κύτταρα εξαρτώµενη από αντίσωµα (ADCC) Λυτική βλάβη Αγγειακή θρόµβωση Φλεγµονώδεις διαµεσολαβητές Επιδράσεις στο µόσχευµα

72 Ανοσοκαταστολή για επιβίωση του µοσχεύµατος Mεταµόσχευση στο ζώο Εγχυση αντι-cd4 mab Mεταµόσχευση στο ζώο + έγχυση αντι-cd4 mab Πρώτη απόρριψη µοσχεύµατος Επιβίωση Αναµονή µέχρι το αντι-cd4 mab εξαφανιστεί από την κυκλοφορία Επιβίωση µοσχεύµατος Επιβίωση Χρόνος Χρόνος Mεταµόσχευση στο ζώο ξανά Mεταµόσχευση στο ζώο Mεταµόσχευση στο ζώο ξανά Επιταχυνόµενη (2η) απόρριψη µοσχεύµατος Επιβίωση Πρώτη απόρριψη µοσχεύµατος Επιβίωση Επιβίωση µοσχεύµατος Επιβίωση Χρόνος Χρόνος Χρόνος

73 ΑΝΤΙ-ΙΙΚΗ ΡΑΣΤΙΚΟΤΗΤΑ ΤΩΝ ΑΝΤΙΣΩΜΑΤΩΝ Τα εξουδετερωτικά αντισώµατα είναι σηµαντικά για προστασία µέσω εµβολίων Εξουδετερωτικά Ab (anti-env) ιός εξουδετέρωση κυτταροτοξικότητα µέσω συµπληρώµατος και φαγοκυττάρωση Κυτταρική προστασία από Ab (Πρέπει να έχουν µεγάλη συγγένεια για το αντιγόνο) Εξουδετέρωση (προκαλούνται αλλαγές στη διαµόρφωση των πρωτεϊνών του φακέλου ή καψιδίου) ADCC και φαγοκυττάρωση Mακροφάγα συµπλήρωµα

74 Εξουδετερωτικά Ab µόλυνση Μή-εξουδετερωτικά Ab Μολυσµένο ραστικοί µηχανισµοί µέσω Fc Κυτταρική σηµατοδότηση Κυτταρική λύση Αναστολή ιικής αντιγραφής κύτταρο Στερική παρεµπόδιση; Αναστολή απελευθέρωσης του ιού Μή-εξουδετερωτικά Ab Στερική παρεµπόδιση; Αναστολή µεταφοράς από κύτταρο σε κύτταρο

75 ΑΝΤΙΣΤΡΟΦΗ ΠΑΡΑΓΩΓΗ ΕΜΒΟΛΙΩΝ Τα εξουδετερωτικά αντισώµατα είναι σηµαντικά για προστασία µέσω εµβολίων Ανθρώπινα αντισώµατα Ανθρώπινα εξουδετερωτικά αντισώµατα αντιγόνο Μοριακός χαρακτηρισµός της αλληλεπίδρασης αντισώµαατοςπαθογόνου-αντιγόνου Σχεδιασµός ανοσογόνου και δοκιµασία Συνδυασµός διαφόρων ανοσογόνων = εµβόλιο

76 ΙΙ. Ογκολογία: 1. Αύξηση δραστικών λειτουργιών 2. Άµεσος οπλισµός των αντισωµάτων 3. Έµµεσος οπλισµός των αντισωµάτων 4. Προ-στόχευση

77 ΘΕΡΑΠΕΥΤΙΚΗ ΠΡΟΣΕΓΓΙΣΗ ΤΟΥ ΚΑΡΚΙΝΟΥ ΜΕ ΑΝΤΙΣΩΜΑΤΑ 1. Αύξηση δραστικών λειτουργιών ραστικό κύτταρο (ουδετερόφιλα, µακροφάγα, ΝΚ) ADCC (κυτταροτοξικότητα µέσω αντισωµάτων) Μεταλλαγές και/ή τροποποιηµένη γλυκοσυλίωση (αυξάνουν την πρόσδεση στον FcγR, C1q) Καρκινικό κύτταρο Φαγοκυττάρωση ή λύση κυττάρου MAC (σύµπλεγµα προσβολής της µεµβράνης) λύση Φαγοκυττάρωση ή λύση κυττάρου CDC (κυτταροτοξικότητα µέσω συµπληρώµατος) ραστικό κύτταρο

78 ΘΕΡΑΠΕΥΤΙΚΗ ΠΡΟΣΕΓΓΙΣΗ ΤΟΥ ΚΑΡΚΙΝΟΥ ΜΕ ΑΝΤΙΣΩΜΑΤΑ 2. Άµεσος οπλισµός των αντισωµάτων Το αντιγόνο στόχος πρέπει να εκφράζεται στα καρκινικά κύτταρα και να απουσιάζει ή να εκφράζεται σε πολύ χαµηλά επίπεδα στα φυσιολογικά κύτταρα) ΙgG Fab scfv κυτταροκίνη ανοσοκυτταροκίνη Καρκινικό κύτταρο Μικρά µόρια ή τοξίνες Τοξίνη φυτών: ricin A chain Βακτηριακή τοξίνη: Pseudomonas exotoxin Μετά την ενδοκυττάρωση το µόριο απελευθερώνεται από το αντίσωµα και ενεργοποιείται. IL-2, IL-12, GM-CSF Ραδιενεργό στοιχείο Ενεργοποίηση ανοσoδραστικών κυττάρων (Τ, Β, ΝΚ) 131 Ι, 90 yttrium, 186 rhodium, 188 rhodium: β-σωµατίδια (κυτταροτοξικά σε µεγάλη ακτίνα) 212 Bismuth, 213 Bismuth, 211 astotine): α-σωµατίδια (κυτταροτοξικά σε µικρή απόσταση, ειδικά για µικροµεταστάσεις και νεοπλάσµατα)

79 ΘΕΡΑΠΕΥΤΙΚΗ ΠΡΟΣΕΓΓΙΣΗ ΤΟΥ ΚΑΡΚΙΝΟΥ ΜΕ ΑΝΤΙΣΩΜΑΤΑ 3. Έµµεσος οπλισµός των αντισωµάτων Η απελευθέρωση χηµειοθεραπευτικών ουσιών που είναι συµπυκνωµένες σε κάψουλες σε σύγκριση µε τις ελεύθερες µειώνουν την κυτταροτοξικότητα Καρκινικό κύτταρο Τµήµα scfv Αb δύο ειδικοτήτων Ραδιενεργό στοιχείο, τοξίνη ή ανοσοδραστικό κύτταρο ανοσολιποσώµατα ΙgG PEG Fab scfv Χηµειοθεραπευτική ουσία Φωσφωλιπιδικά κυστίδια

80 ΘΕΡΑΠΕΥΤΙΚΗ ΠΡΟΣΕΓΓΙΣΗ ΤΟΥ ΚΑΡΚΙΝΟΥ ΜΕ ΑΝΤΙΣΩΜΑΤΑ 4. Προ-στόχευση Απαιτούνται 2-3 συστατικά και θεραπευτικά στάδια Μείωση συστηµατικής τοξικότητας 4-12Χ αύξηση της συγκέντρωσης στους ιστούς 5Χ µείωση της συγκέντρωσης έξω από στους ιστούς Βιοτίνη-ραδιενεργό στοιχείο Καρκινικό κύτταρο στρεπταβιδίνη 1. Το Ab στοχεύει τον όγκο 2. Αποβολή των ελεύθερων κυκλοφορούντων Ab 3. Χορήγηση ενός κυτταροτοξικού παράγοντα που συλλαµβάνεται ή ενεργοποιείται από το Ab που βρίσκεται είδη στον όγκο. Προφάρµακο scfv-ένζυµο φάρµακο ADEPT (= Ab-dependent enzyme mediated prodrug therapy) (Το προφάρµακο ενεργοποιείται µόνο µετά την επαφή µε την πρωτείνη σύντηξης ενίσχυση της κυτταροτοξικής δράσης)

81 Aνοσοθεραπεία µελανώµατος Στο µελάνωµα υπερεκφράζονται τα γλυκολιπίδια GD2 και GM2 Μελάνωµα το οποίο δεν απάντησε σε ακτινοθεραπεία Το ίδιο µελάνωµα µετά από τοπική έγχυση αντι- GD2 και αντι-gm2 Abs

82 Πλασµατική µεµβράνη (ΑΝΤΙΓΟΝΙΚΗ ΤΡΟΠΟΠΟΙΗΣΗ)

83 ΑΝΤΙΓΟΝΙΚΗ ΤΡΟΠΟΠΟΙΗΣΗ ΑΝΟΣΟΘΕΡΑΠΕΙΑ

84

Αντιγόνα & Ανοσοσφαιρίνες

Αντιγόνα & Ανοσοσφαιρίνες Αντιγόνα & Ανοσοσφαιρίνες Ανοσολογικά χαρακτηριστικά των αντιγόνων I Τα αντιγόνα είναι ουσίες ικανές να επάγουν ειδική ανοσιακή απάντηση (ανοσογόνα) Ανοσογονικότητα (immunogenicity) ικανότητα επαγωγής

Διαβάστε περισσότερα

ΑΝΟΣΟΠΟΙΗΤΙΚΟ ΣΥΣΤΗΜΑ ΜΟΝΟΚΛΩΝΙΚΑ ΑΝΤΙΣΩΜΑΤΑ ΕΜΒΟΛΙΑ. Εργαστήριο Γενετικής, ΓΠΑ

ΑΝΟΣΟΠΟΙΗΤΙΚΟ ΣΥΣΤΗΜΑ ΜΟΝΟΚΛΩΝΙΚΑ ΑΝΤΙΣΩΜΑΤΑ ΕΜΒΟΛΙΑ. Εργαστήριο Γενετικής, ΓΠΑ ΑΝΟΣΟΠΟΙΗΤΙΚΟ ΣΥΣΤΗΜΑ ΜΟΝΟΚΛΩΝΙΚΑ ΑΝΤΙΣΩΜΑΤΑ ΕΜΒΟΛΙΑ Στάδια μικροβιακής λοίμωξης δημιουργία αποικίας σε εξωτερική επιφάνεια διείσδυση στον οργανισμό τοπική μόλυνση συστηματική (γενικευμένη) μόλυνση H σημασία

Διαβάστε περισσότερα

οµή Ανοσιακού Συστήµατος Ελένη Φωτιάδου-Παππά Τµήµα Ανοσολογίας Γ.Ν. Νίκαιας-Πειραιά

οµή Ανοσιακού Συστήµατος Ελένη Φωτιάδου-Παππά Τµήµα Ανοσολογίας Γ.Ν. Νίκαιας-Πειραιά οµή Ανοσιακού Συστήµατος Ελένη Φωτιάδου-Παππά Τµήµα Ανοσολογίας Γ.Ν. Νίκαιας-Πειραιά Ανοσολογικό σύστηµα Βασικό σύστηµα του οργανισµού Λειτουργικές µονάδες του ανοσολογικού συστήµατος Οργανωµένος λεµφικός

Διαβάστε περισσότερα

ΑΝΟΣΟΒΙΟΛΟΓΙΑ. Εξεταστική Ιανουαρίου 2010

ΑΝΟΣΟΒΙΟΛΟΓΙΑ. Εξεταστική Ιανουαρίου 2010 Εξεταστική Ιανουαρίου 2010 Ποιες είναι οι διαφορές μιας πρωτογενούς από μια δευτερογενή χυμική ανοσολογική απόκριση; Περιγράψετε τους μηχανισμούς ενεργοποίησης στις δυο περιπτώσεις. ΘΕΜΑ 2 (1 μονάδα) Περιγράψετε

Διαβάστε περισσότερα

Επίκτητη Ανοσιακή Απάντηση (χυμικό σκέλος) Β λεμφοκύτταρα

Επίκτητη Ανοσιακή Απάντηση (χυμικό σκέλος) Β λεμφοκύτταρα Επίκτητη Ανοσιακή Απάντηση (χυμικό σκέλος) Β λεμφοκύτταρα φυσική ή μη ειδική ανοσία δεν απαιτεί προηγούμενη έκθεση στο παθογόνο και δεν διαθέτει μνήμη. σε επίκτητη ή ειδική ανοσία χυμική ανοσία με παραγωγή

Διαβάστε περισσότερα

Βιολογία γενικής παιδείας τάξη Γ

Βιολογία γενικής παιδείας τάξη Γ Βιολογία γενικής παιδείας τάξη Γ Παραδόσεις του μαθήματος Επιμέλεια: Γιάννης Αργύρης Βιολόγος M.Sc. Καθηγητής 3 ου Γεν. Λυκ. Ηλιούπολης Κεφάλαιο 1ο Άνθρωπος και υγεία 2. Μηχανισμοί Άμυνας του Ανθρώπινου

Διαβάστε περισσότερα

ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ Ο.Ε.Φ.Ε. 2004 ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ Γ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ

ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ Ο.Ε.Φ.Ε. 2004 ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ Γ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ Ο.Ε.Φ.Ε. 2004 ΘΕΜΑ 1 Ο Α. Να επιλέξετε την ορθή πρόταση: ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ Γ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 1. Το κωδικόνιο του mrna που κωδικοποιεί το αµινοξύ µεθειονίνη είναι α. 5 GUA

Διαβάστε περισσότερα

Ανοσιακή απάντηση (immune response)

Ανοσιακή απάντηση (immune response) Ανοσιακή απάντηση (immune response) Το σύνολο των μηχανισμών που καθιστούν τον οργανισμό ικανό να αναγνωρίζει,να εξουδετερώνει και να απομακρύνει κάθε ξένη ουσία προς αυτόν χαρακτηρίζεται ως ανοσία. Αποτέλεσμα

Διαβάστε περισσότερα

Εργαλεία Μοριακής Γενετικής

Εργαλεία Μοριακής Γενετικής Εργαλεία Μοριακής Γενετικής Αρχές Μοριακής κλωνοποίησης Τα περιοριστικά ένζυμα: αναγνωρίζουν αλληλουχίες (θέσεις περιορισμού). 2 τύποι ενζύμων: -Τύπος I = Κόβουν κοντά στη θέση περιορισμού -σπάνια χρησιμοποιούνται.

Διαβάστε περισσότερα

Θέματα Πανελλαδικών 2000-2013

Θέματα Πανελλαδικών 2000-2013 Θέματα Πανελλαδικών 2000-2013 ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΗΜΕΡΗΣΙΩΝ ΛΥΚΕΙΩΝ ΕΣΠΕΡΙΝΩΝ ΛΥΚΕΙΩΝ ΕΠΑΝΑΛΗΠΤΙΚΕΣ Κεφάλαιο 8 ΚΕΦΑΛΑΙΟ 8 ΘΕΜΑ 1 ο Γράψτε τον αριθμό καθεμιάς από τις παρακάτω προτάσεις και δίπλα το γράμμα

Διαβάστε περισσότερα

Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗ ΚΑΤΕΥΘΥΝΣΗ ΒΙΟΛΟΓΙΑ ΑΠΑΝΤΗΣΕΙΣ ÏÅÖÅ

Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗ ΚΑΤΕΥΘΥΝΣΗ ΒΙΟΛΟΓΙΑ ΑΠΑΝΤΗΣΕΙΣ ÏÅÖÅ 1 Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗ ΚΑΤΕΥΘΥΝΣΗ ΒΙΟΛΟΓΙΑ ΘΕΜΑ 1 ο 1 γ 2 δ 3 β 4 α 5 γ ΘΕΜΑ 2 ο ΑΠΑΝΤΗΣΕΙΣ Μονάδες 25 (5Χ5) Α. ιαγονιδιακά ζώα ονοµάζονται εκείνα στα οποία το γενετικό τους υλικό έχει τροποποιηθεί µε την

Διαβάστε περισσότερα

ΑΡΧΕΣ ΑΝΟΣΟΛΟΓΙΑΣ ΕΙΣΑΓΩΓΗ ΣΤΟ ΑΝΟΣΟΠΟΙΗΤΙΚΟ ΣΥΣΤΗΜΑ

ΑΡΧΕΣ ΑΝΟΣΟΛΟΓΙΑΣ ΕΙΣΑΓΩΓΗ ΣΤΟ ΑΝΟΣΟΠΟΙΗΤΙΚΟ ΣΥΣΤΗΜΑ ΑΡΧΕΣ ΑΝΟΣΟΛΟΓΙΑΣ ΕΙΣΑΓΩΓΗ ΣΤΟ ΑΝΟΣΟΠΟΙΗΤΙΚΟ ΣΥΣΤΗΜΑ Χρειάζεται η µελέτη της ανοσολογία; Εµβόλια Άµυνα κατά µικροοργανισµών Ανοσολογικές ασθένειες Αλλεργίες - υπερευαισθησίες, αυτοανοσίες, ανοσοανεπάρκειες,

Διαβάστε περισσότερα

Νικόλαος Σιαφάκας Λέκτορας Διαγνωστικής Ιολογίας Εργαστήριο Κλινικής Μικροβιολογίας ΠΓΝ «ΑΤΤΙΚΟΝ»

Νικόλαος Σιαφάκας Λέκτορας Διαγνωστικής Ιολογίας Εργαστήριο Κλινικής Μικροβιολογίας ΠΓΝ «ΑΤΤΙΚΟΝ» Νικόλαος Σιαφάκας Λέκτορας Διαγνωστικής Ιολογίας Εργαστήριο Κλινικής Μικροβιολογίας ΠΓΝ «ΑΤΤΙΚΟΝ» DNA RNA: ΑΝΤΙΓΡΑΦΗ, ΜΕΤΑΓΡΑΦΗ, ΜΕΤΑΦΡΑΣΗ DNA RNA: Βασικά Χαρακτηριστικά Ρόλος Κεντικό Δόγμα της Βιολογίας:

Διαβάστε περισσότερα

Ανοσιακή απάντηση Αικατερίνη Ταράση

Ανοσιακή απάντηση Αικατερίνη Ταράση Ανοσιακή απάντηση Αικατερίνη Ταράση ιευθύντρια Τµ. Ανοσολογίας- Ιστοσυµβατότητας Γ.Ν.Α.. " Ο Ευαγγελισµός" ανοσιακή απάντηση είναι το σύνολο των πολύπλοκων διεργασιών µε τις οποίες ο οργανισµός (ξενιστής)

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ 8 Ο ΚΕΦΑΛΑΙΟ ΕΦΑΡΜΟΓΕΣ ΤΗΣ ΒΙΟΤΕΧΝΟΛΟΓΙΑΣ ΣΤΗΝ ΙΑΤΡΙΚΗ 5ο ΓΕΝΙΚΟ ΛΥΚΕΙΟ ΙΛΙΟΥ 1 8. Εφαρμογές της Βιοτεχνολογίας στην Ιατρική Φαρμακευτικές πρωτεΐνες Τι είναι οι φαρμακευτικές

Διαβάστε περισσότερα

ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ - ΕΣΠΕΡΙΝΩΝ

ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ - ΕΣΠΕΡΙΝΩΝ ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ - ΕΣΠΕΡΙΝΩΝ ΠΑΝΕΛΛΗΝΙΕΣ ΕΞΕΤΑΣΕΙΣ ΤΑΞΗΣ ΕΣΠΕΡΙΝΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΚΑΙ ΕΠΑΛ (ΟΜΑ Α Β ) ΤΕΤΑΡΤΗ 18 ΜΑΪΟΥ 2011 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ: ΒΙΟΛΟΓΙΑ ΣΥΝΟΛΟ ΣΕΛΙ ΩΝ: ΠΕΝΤΕ (5) ΘΕΜΑ

Διαβάστε περισσότερα

ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΠΕΜΠΤΗ 11 ΙΟΥΝΙΟΥ 2015 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ

ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΠΕΜΠΤΗ 11 ΙΟΥΝΙΟΥ 2015 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 1 ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΠΕΜΠΤΗ 11 ΙΟΥΝΙΟΥ 2015 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ Α Α1. β Α2. γ Α3. α Α4. γ Α5. δ ΘΕΜΑ Β Β1.

Διαβάστε περισσότερα

Αντιγόνο. ξένη) με μια σχετικά ισχυρή δύναμη σύνδεσης.

Αντιγόνο. ξένη) με μια σχετικά ισχυρή δύναμη σύνδεσης. Αντιγόνα Αντισώματα Αντιγόνο Ως αντιγόνο ορίζεται κάθε ουσία που προέρχεται από το εξωτερικό ή εσωτερικό περιβάλλον και είναι ικανή να αντιδράσει με τα προϊόντα της ανοσιακής απάντησης (αναγνωρίζεται από

Διαβάστε περισσότερα

ΘΕΜΑ Α Α1. γ Α2. γ Α3. α Α4. β Α5. β ΘΕΜΑ B B1. B2.

ΘΕΜΑ Α Α1. γ Α2. γ Α3. α Α4. β Α5. β ΘΕΜΑ B B1. B2. ΘΕΜΑ Α Α1. γ (το πριμόσωμα) Α2. γ (οι υποκινητές και οι μεταγραφικοί παράγοντες κάθε γονιδίου) Α3. α (μεταφέρει ένα συγκεκριμένο αμινοξύ στο ριβόσωμα) Α4. β (αποδιάταξη των δύο συμπληρωματικών αλυσίδων)

Διαβάστε περισσότερα

ΑΠΑΝΤΗΣΕΙΣ. ΘΕΜΑ Α Α1. β Α2. γ Α3. γ Α4. α Α5. δ

ΑΠΑΝΤΗΣΕΙΣ. ΘΕΜΑ Α Α1. β Α2. γ Α3. γ Α4. α Α5. δ ΘΕΜΑ Α Α1. β Α2. γ Α3. γ Α4. α Α5. δ 1 ΕΙΣΑΓΩΓΙΚΕΣ ΕΞΕΤΑΣΕΙΣ ΤΕΚΝΩΝ ΕΛΛΗΝΩΝ ΤΟΥ ΕΞΩΤΕΡΙΚΟΥ ΚΑΙ ΤΕΚΝΩΝ ΕΛΛΗΝΩΝ ΥΠΑΛΛΗΛΩΝ ΣΤΟ ΕΞΩΤΕΡΙΚΟ ΤΕΤΑΡΤΗ 15 ΣΕΠΤΕΜΒΡΙΟΥ 2010 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ:

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΙΑΓΩΝΙΣΜΑ Θέµα 1 ο 1. Τα άτοµα που είναι ετερόζυγα για τη β-θαλασσαιµία: α. Εµφανίζουν ήπια αναιµία β. Έχουν ευαισθησία στην ελονοσία γ. Συνθέτουν µεγάλη ποσότητα HbF δ.

Διαβάστε περισσότερα

ΟΜΟΣΠΟΝ ΙΑ ΕΚΠΑΙ ΕΥΤΙΚΩΝ ΦΡΟΝΤΙΣΤΩΝ ΕΛΛΑ ΟΣ (Ο.Ε.Φ.Ε.) ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ 2014

ΟΜΟΣΠΟΝ ΙΑ ΕΚΠΑΙ ΕΥΤΙΚΩΝ ΦΡΟΝΤΙΣΤΩΝ ΕΛΛΑ ΟΣ (Ο.Ε.Φ.Ε.) ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ 2014 ΤΑΞΗ: ΚΑΤΕΥΘΥΝΣΗ: ΜΑΘΗΜΑ: Γ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗ ΒΙΟΛΟΓΙΑ Ηµεροµηνία: Παρασκευή 25 Απριλίου 2014 ιάρκεια Εξέτασης: 3 ώρες ΕΚΦΩΝΗΣΕΙΣ ΘΕΜΑ Α Να γράψετε στο τετράδιό σας τον αριθµό καθεµιάς από τις παρακάτω

Διαβάστε περισσότερα

1 ο #Κεφάλαιο# 1)#Πειράματα: α)$να#περιγράψεις#το#πείραμα#των#hershey#και#chase.# Υπόδειξη:#σελ#14#σχολ.

1 ο #Κεφάλαιο# 1)#Πειράματα: α)$να#περιγράψεις#το#πείραμα#των#hershey#και#chase.# Υπόδειξη:#σελ#14#σχολ. 1 ο #Κεφάλαιο# ΤΟ ΓΕΝΕΤΙΚΟ ΥΛΙΚΟ 1)#Πειράματα: α)$να#περιγράψεις#το#πείραμα#των#hershey#και#chase.# Υπόδειξη:#σελ#14#σχολ. Παραλλαγή:#δίνονται##τα#παρακάτω#διαγράμματα#που#απεικονίζουν# τη#ραδιενέργεια#στο#εσωτερικό#των#βακτηρίων,#μετά#τη#μόλυνση#με#

Διαβάστε περισσότερα

Σάββατο, 25 Μαΐου 2002 Γ ΛΥΚΕΙΟΥ ΓΕΝΙΚΗ ΠΑΙ ΕΙΑ. Βιολογία

Σάββατο, 25 Μαΐου 2002 Γ ΛΥΚΕΙΟΥ ΓΕΝΙΚΗ ΠΑΙ ΕΙΑ. Βιολογία Σάββατο, 25 Μαΐου 2002 Γ ΛΥΚΕΙΟΥ ΓΕΝΙΚΗ ΠΑΙ ΕΙΑ Βιολογία ΘΕΜΑ 1 Στις ερωτήσεις 1 5, να γράψετε στο τετράδιό σας τον αριθµό της ερώτησης και δίπλα του το γράµµα που αντιστοιχεί στη σωστή απάντηση. 1. Ποιο

Διαβάστε περισσότερα

ΕΡΩΤΗΣΕΙΣ ΣΩΣΤΟΥ - ΛΑΘΟΥΣ. ΠΟΛΛΑΠΛΗΣ ΕΠΙΛΟΓΗΣ

ΕΡΩΤΗΣΕΙΣ ΣΩΣΤΟΥ - ΛΑΘΟΥΣ. ΠΟΛΛΑΠΛΗΣ ΕΠΙΛΟΓΗΣ ΕΡΩΤΗΣΕΙΣ ΣΩΣΤΟΥ - ΛΑΘΟΥΣ. ΠΟΛΛΑΠΛΗΣ ΕΠΙΛΟΓΗΣ 1. Η πήξη του αίματος συμβάλλει στην άμυνα του οργανισμού 2. Η φαγοκυττάρωση είναι αποτελεσματική μόνο έναντι των βακτηρίων 3. Οι ιντερφερόνες δρουν άμεσα

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΟΝΟΜΑΤΕΠΩΝΥΜΟ: ΤΜΗΜΑ: ΘΕΜΑ 1 Ο. 3. Το DNA των μιτοχονδρίων έχει μεγαλύτερο μήκος από αυτό των χλωροπλαστών.

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΟΝΟΜΑΤΕΠΩΝΥΜΟ: ΤΜΗΜΑ: ΘΕΜΑ 1 Ο. 3. Το DNA των μιτοχονδρίων έχει μεγαλύτερο μήκος από αυτό των χλωροπλαστών. ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΟΝΟΜΑΤΕΠΩΝΥΜΟ: ΤΜΗΜΑ: ΘΕΜΑ 1 Ο Α. Να γράψετε τον αριθμό της καθεμιάς από τις παρακάτω προτάσεις 1-5 και δίπλα του τη λέξη Σωστό, αν η πρόταση είναι σωστή, ή Λάθος, αν η πρόταση

Διαβάστε περισσότερα

ΘΕΜΑ 1 Ο ΜΑΘΗΜΑ / ΤΑΞΗ : ΑΠΑΝΤΗΣΕΙΣ ΒΙΟΛΟΓΙΑΣ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΣΕΙΡΑ: ΘΕΡΙΝΑ ΗΜΕΡΟΜΗΝΙΑ: 01/12/2013

ΘΕΜΑ 1 Ο ΜΑΘΗΜΑ / ΤΑΞΗ : ΑΠΑΝΤΗΣΕΙΣ ΒΙΟΛΟΓΙΑΣ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΣΕΙΡΑ: ΘΕΡΙΝΑ ΗΜΕΡΟΜΗΝΙΑ: 01/12/2013 ΜΑΘΗΜΑ / ΤΑΞΗ : ΑΠΑΝΤΗΣΕΙΣ ΒΙΟΛΟΓΙΑΣ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΣΕΙΡΑ: ΘΕΡΙΝΑ ΗΜΕΡΟΜΗΝΙΑ: 01/12/2013 ΘΕΜΑ 1 Ο Να επιλέξετε την φράση που συμπληρώνει ορθά κάθε μία από τις ακόλουθες προτάσεις: 1. Τα

Διαβάστε περισσότερα

ANOΣΟΓΗΡΑΝΣΗ. Ιωάννα Οικονοµίδου. Αναπληρώτρια Καθηγήτρια Ιατρικής Πανεπιστηµίου Αθηνών

ANOΣΟΓΗΡΑΝΣΗ. Ιωάννα Οικονοµίδου. Αναπληρώτρια Καθηγήτρια Ιατρικής Πανεπιστηµίου Αθηνών ANOΣΟΓΗΡΑΝΣΗ Ιωάννα Οικονοµίδου Αναπληρώτρια Καθηγήτρια Ιατρικής Πανεπιστηµίου Αθηνών Το ανοσιακό σύστηµα θεωρείται αποφασιστικός παράγοντας για την διατήρηση της υγείας και την επιβίωση στους ηλικιωµένους

Διαβάστε περισσότερα

Ποιες είναι οι ομοιότητες και οι διαφορές μεταξύ της αντιγραφής και της

Ποιες είναι οι ομοιότητες και οι διαφορές μεταξύ της αντιγραφής και της ΚΕΦ. 2 ο ΕΡΩΤΗΣΕΙΣ ΚΡΙΣΕΩΣ Ποιες είναι οι ομοιότητες και οι διαφορές μεταξύ της αντιγραφής και της μεταγραφής; Διαφορές Αντιγραφή Μεταγραφή 1. Διατηρείται και μεταβιβάζεται η 1. Μεταβιβάζεται η γενετική

Διαβάστε περισσότερα

ΑΛΛΗΛΕΠΙΔΡΑΣΗ ΑΝΤΙΓΟΝΟΥ/ΑΝΤΙΣΩΜΑΤΟΣ

ΑΛΛΗΛΕΠΙΔΡΑΣΗ ΑΝΤΙΓΟΝΟΥ/ΑΝΤΙΣΩΜΑΤΟΣ Β ΒΑΣΙΚΟ ΣΕΜΙΝΑΡΙΟ ΚΥΤΤΑΡΟΜΕΤΡΙΑΣ 2 ΦΕΒΡΟΥΑΡΙΟΥ 2013 ΑΜΦΙΘΕΑΤΡΟ ΤΟΥ ΓΕΝΙΚΟΥ ΚΡΑΤΙΚΟΥ ΑΘΗΝΩΝ «Γ. ΓΕΝΝΗΜΑΤΑΣ» IV Σχεδιασμός Πειραμάτων και Ανάπτυξη Δοκιμασιών ΑΛΛΗΛΕΠΙΔΡΑΣΗ ΑΝΤΙΓΟΝΟΥ/ΑΝΤΙΣΩΜΑΤΟΣ Βικεντίου

Διαβάστε περισσότερα

ΑΙΜΟΠΑΘΟΛΟΓΟΑΝΑΤΟΜΙΑ

ΑΙΜΟΠΑΘΟΛΟΓΟΑΝΑΤΟΜΙΑ ΑΙΜΟΠΑΘΟΛΟΓΟΑΝΑΤΟΜΙΑ Η συµβολή της µοριακής ανάλυσης Eλισάβετ Οικονοµάκη Βιολόγος Αιµοπαθολογοανατοµικό Εργαστήριο ΠΓΝΑ > ΜΟΡΙΑΚΕΣ ΜΕΘΟ ΟΙ (Μη µορφολογικές) Αλυσιδωτή Αντίδραση Πολυµεράσης

Διαβάστε περισσότερα

ΔΙΑΓΩΝΙΣΜΑ ΒΙΟΛΟΓΙΑΣ ΠΡΟΣΑΝΑΤΟΛΙΣΜΟΥ ΚΕΦΑΛΑΙΑ 1 ΚΑΙ 2

ΔΙΑΓΩΝΙΣΜΑ ΒΙΟΛΟΓΙΑΣ ΠΡΟΣΑΝΑΤΟΛΙΣΜΟΥ ΚΕΦΑΛΑΙΑ 1 ΚΑΙ 2 ΔΙΑΓΩΝΙΣΜΑ ΒΙΟΛΟΓΙΑΣ ΠΡΟΣΑΝΑΤΟΛΙΣΜΟΥ ΚΕΦΑΛΑΙΑ 1 ΚΑΙ 2 ΘΕΜΑ 1 ο Α. Στις ερωτήσεις 1-5 να γράψετε στο τετράδιό σας τον αριθμό της ερώτησης και δίπλα του το γράμμα που αντιστοιχεί στη σωστή απάντηση. 1. Το

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ Γ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 2008

ΒΙΟΛΟΓΙΑ Γ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 2008 ΒΙΟΛΟΓΙΑ Γ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 2008 ΕΚΦΩΝΗΣΕΙΣ ΘΕΜΑ 1ο Να γράψετε στο τετράδιό σας τον αριθµό καθεµιάς από τις παρακάτω ηµιτελείς προτάσεις 1 έως 5 και δίπλα το γράµµα που αντιστοιχεί στη λέξη

Διαβάστε περισσότερα

ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Δ ΤΑΞΗΣ ΕΣΠΕΡΙΝΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΔΕΥΤΕΡΑ 23 ΙΟΥΝΙΟΥ 2014 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΑΠΑΝΤΗΣΕΙΣ

ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Δ ΤΑΞΗΣ ΕΣΠΕΡΙΝΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΔΕΥΤΕΡΑ 23 ΙΟΥΝΙΟΥ 2014 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΑΠΑΝΤΗΣΕΙΣ 1 ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Δ ΤΑΞΗΣ ΕΣΠΕΡΙΝΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΔΕΥΤΕΡΑ 23 ΙΟΥΝΙΟΥ 2014 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ Α Α1. γ Α2. β Α3. γ Α4. δ Α5. α ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ Β Β1. Σχολικό

Διαβάστε περισσότερα

ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΕΝΙΑΙΟΥ ΛΥΚΕΙΟΥ ΠΕΜΠΤΗ 1 ΙΟΥΛΙΟΥ 2004 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ

ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΕΝΙΑΙΟΥ ΛΥΚΕΙΟΥ ΠΕΜΠΤΗ 1 ΙΟΥΛΙΟΥ 2004 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 1 ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΕΝΙΑΙΟΥ ΛΥΚΕΙΟΥ ΠΕΜΠΤΗ 1 ΙΟΥΛΙΟΥ 2004 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ 1ο 1. β 2. γ 3. α 4. γ 5. δ ΘΕΜΑ 2ο 1. Σχολικό

Διαβάστε περισσότερα

Πανελλήνιες Εξετάσεις Ημερήσιων Γενικών Λυκείων. Εξεταζόμενο Μάθημα: Βιολογία Θετικής Κατεύθυνσης, Ημ/νία: 04 Ιουνίου 2014. Απαντήσεις Θεμάτων

Πανελλήνιες Εξετάσεις Ημερήσιων Γενικών Λυκείων. Εξεταζόμενο Μάθημα: Βιολογία Θετικής Κατεύθυνσης, Ημ/νία: 04 Ιουνίου 2014. Απαντήσεις Θεμάτων Πανελλήνιες Εξετάσεις Ημερήσιων Γενικών Λυκείων Εξεταζόμενο Μάθημα: Βιολογία Θετικής Κατεύθυνσης, Ημ/νία: 04 Ιουνίου 2014 Απαντήσεις Θεμάτων ΘΕΜΑ Α A1. Τα πλασμίδια είναι: δ. κυκλικά δίκλωνα μόρια DNA

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΘΕΜΑ 1ο Να γράψετε στο τετράδιό σας τον αριθμό καθεμιάς από τις παρακάτω ημιτελείς προτάσεις 1 έως 5 και δίπλα το γράμμα που αντιστοιχεί στη λέξη ή τη φράση, η οποία

Διαβάστε περισσότερα

Η ΤΕΧΝΟΛΟΓΙΑ ΤΟΥ ΑΝΑΣΥΝΔΥΑΖΟΜΕΝΟΥ ΓΕΝΕΤΙΚΗ ΜΗΧΑΝΙΚΗ

Η ΤΕΧΝΟΛΟΓΙΑ ΤΟΥ ΑΝΑΣΥΝΔΥΑΖΟΜΕΝΟΥ ΓΕΝΕΤΙΚΗ ΜΗΧΑΝΙΚΗ Η ΤΕΧΝΟΛΟΓΙΑ ΤΟΥ ΑΝΑΣΥΝΔΥΑΖΟΜΕΝΟΥ DNA ΓΕΝΕΤΙΚΗ ΜΗΧΑΝΙΚΗ Τεχνολογία ανασυνδυαζόμενου DNA ή Γενετική Μηχανική Κατασκευή τεχνητών μορίων DNA (ανασυνδυασμένο DNA) Τροποποίηση γονιδιωμάτων Μεταφορά γονιδίου/ων

Διαβάστε περισσότερα

Θέµατα Βιολογίας Θετικής Κατεύθυνσης Γ Λυκείου 2000

Θέµατα Βιολογίας Θετικής Κατεύθυνσης Γ Λυκείου 2000 Θέµατα Βιολογίας Θετικής Κατεύθυνσης Γ Λυκείου 2000 ΕΚΦΩΝΗΣΕΙΣ Ζήτηµα 1ο Στις ερωτήσεις 1-5, να γράψετε στο τετράδιο σας τον αριθµό της ερώτησης και δίπλα το γράµµα που αντιστοιχεί στη σωστή απάντηση.

Διαβάστε περισσότερα

Θέματα Πανελλαδικών 2000-2013

Θέματα Πανελλαδικών 2000-2013 Θέματα Πανελλαδικών 2000-2013 ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΗΜΕΡΗΣΙΩΝ ΛΥΚΕΙΩΝ ΕΣΠΕΡΙΝΩΝ ΛΥΚΕΙΩΝ ΕΠΑΝΑΛΗΠΤΙΚΕΣ Κεφάλαιο 4 ΚΕΦΑΛΑΙΟ 4 ΘΕΜΑ 1 ο Γράψτε τον αριθμό καθεμιάς από τις παρακάτω προτάσεις και δίπλα το γράμμα

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΘΕΜΑ 1ο Να γράψετε στο τετράδιό σας τον αριθμό καθεμιάς από τις παρακάτω ημιτελείς προτάσεις 1 έως 5 και δίπλα το γράμμα που αντιστοιχεί στη λέξη ή τη φράση, η οποία

Διαβάστε περισσότερα

Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΒΙΟΛΟΓΙΑ. Óõíåéñìüò ΕΚΦΩΝΗΣΕΙΣ. Να επιλέξετε τη φράση που συµπληρώνει ορθά κάθε µία από τις ακόλουθες προτάσεις:

Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΒΙΟΛΟΓΙΑ. Óõíåéñìüò ΕΚΦΩΝΗΣΕΙΣ. Να επιλέξετε τη φράση που συµπληρώνει ορθά κάθε µία από τις ακόλουθες προτάσεις: 1 Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ 1 o ΒΙΟΛΟΓΙΑ ΕΚΦΩΝΗΣΕΙΣ Να επιλέξετε τη φράση που συµπληρώνει ορθά κάθε µία από τις ακόλουθες προτάσεις: 1. Το DNA ενός ανθρώπινου κυττάρου αποτελείται από 6 10 9

Διαβάστε περισσότερα

Τεχνολογία του ανασυνδυασμένου DNA

Τεχνολογία του ανασυνδυασμένου DNA Τεχνολογία του ανασυνδυασμένου DNA Ε Ι Σ Α Γ Ω Γ Η Φώτης Καρβέλης Ιστορική αναδρομή Ανακάλυψη του DNA Μελέτη αντιγραφής Απομόνωση ενζύμων Μελέτη της δράσης τους Αποκάλυψη των περιοριστικών ενδονουκλεασών

Διαβάστε περισσότερα

Θέµατα Βιολογίας Θετικής Κατεύθυνσης Γ Λυκείου 2000

Θέµατα Βιολογίας Θετικής Κατεύθυνσης Γ Λυκείου 2000 Ζήτηµα 1ο Θέµατα Βιολογίας Θετικής Κατεύθυνσης Γ Λυκείου 2000 Στις ερωτήσεις 1-5, να γράψετε στο τετράδιο σας τον αριθµό της ερώτησης και δίπλα το γράµµα που αντιστοιχεί στη σωστή απάντηση. 1. Σε µια συνεχή

Διαβάστε περισσότερα

Γενική Μικροβιολογία. Ενότητα 12 η ΕΙΣΑΓΩΓΗ ΣΤΗΝ ΙΟΛΟΓΙΑ

Γενική Μικροβιολογία. Ενότητα 12 η ΕΙΣΑΓΩΓΗ ΣΤΗΝ ΙΟΛΟΓΙΑ Γενική Μικροβιολογία Ενότητα 12 η ΕΙΣΑΓΩΓΗ ΣΤΗΝ ΙΟΛΟΓΙΑ Όνομα καθηγητή: Δ. ΓΕΩΡΓΑΚΟΠΟΥΛΟΣ Όνομα καθηγητή: Γ. ΖΕΡΒΑΚΗΣ Όνομα καθηγητή: ΑΝ. ΤΑΜΠΑΚΑΚΗ Τμήμα: ΕΠΙΣΤΗΜΗΣ ΦΥΤΙΚΗΣ ΠΑΡΑΓΩΓΗΣ ΣΤΟΧΟΙ ΤΟΥ ΜΑΘΗΜΑΤΟΣ

Διαβάστε περισσότερα

ÍÅÏ ÄÕÍÁÌÉÊÏ ÓÔÁÕÑÏÕÐÏËÇ

ÍÅÏ ÄÕÍÁÌÉÊÏ ÓÔÁÕÑÏÕÐÏËÇ 1 ΘΕΜΑ 1 o Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΕΚΦΩΝΗΣΕΙΣ ΒΙΟΛΟΓΙΑ Α. Για τις ερωτήσεις 1 5 να γράψετε στο τετράδιό σας τον αριθµό της ερώτησης και δίπλα του το γράµµα, που αντιστοιχεί στη σωστή απάντηση. 1.

Διαβάστε περισσότερα

ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ

ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΘΕΜΑ Α Να γράψετε στο τετράδιό σας τον αριθμό καθεμιάς από τις παρακάτω ημιτελείς προτάσεις Α1 έως Α5 και δίπλα το γράμμα που αντιστοιχεί στη λέξη

Διαβάστε περισσότερα

ÖÑÏÍÔÉÓÔÇÑÉÏ ÈÅÙÑÇÔÉÊÏ ÊÅÍÔÑÏ ÁÈÇÍÁÓ - ÐÁÔÇÓÉÁ

ÖÑÏÍÔÉÓÔÇÑÉÏ ÈÅÙÑÇÔÉÊÏ ÊÅÍÔÑÏ ÁÈÇÍÁÓ - ÐÁÔÇÓÉÁ ΘΕΜΑ 1 ο ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 2009 ΕΚΦΩΝΗΣΕΙΣ Να γράψετε στο τετράδιό σας τον αριθµό καθεµιάς από τις παρακάτω ηµιτελείς προτάσεις 1 έως 5 και δίπλα το γράµµα που αντιστοιχεί στη λέξη ή τη φράση,

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙ ΕΙΑΣ

ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙ ΕΙΑΣ ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙ ΕΙΑΣ Συγκρίνατε την πρωτογενή µε τη δευτερογενή ανοσοβιολογική απόκριση και απεικονίστε αυτές στο ίδιο διάγραµµα αξόνων. Πρωτογενή ανοσοβιολογική απόκριση ονοµάζουµε την απόκριση του

Διαβάστε περισσότερα

ΑΡΧΗ 1ΗΣ ΣΕΛΙΔΑΣ Γ ΗΜΕΡΗΣΙΩΝ

ΑΡΧΗ 1ΗΣ ΣΕΛΙΔΑΣ Γ ΗΜΕΡΗΣΙΩΝ ΑΡΧΗ 1ΗΣ ΣΕΛΙΔΑΣ Γ ΗΜΕΡΗΣΙΩΝ ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΠΕΜΠΤΗ 11 ΙΟΥΝΙΟΥ 2015 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΣΥΝΟΛΟ ΣΕΛΙΔΩΝ: ΠΕΝΤΕ (5) ΘΕΜΑ

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ Α ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Να γράψετε στο τετράδιό σας τον αριθμό καθεμιάς από τις παρακάτω ημιτελείς προτάσεις Α1 έως Α5 και δίπλα το γράμμα που αντιστοιχεί στη λέξη ή τη φράση, η οποία συμπληρώνει

Διαβάστε περισσότερα

Πανελλήνιες Εξετάσεις Ημερήσιων Γενικών Λυκείων. Εξεταζόμενο Μάθημα: Βιολογία Θετικής Κατεύθυνσης, Ημ/νία: 04 Ιουνίου 2014. Απαντήσεις Θεμάτων

Πανελλήνιες Εξετάσεις Ημερήσιων Γενικών Λυκείων. Εξεταζόμενο Μάθημα: Βιολογία Θετικής Κατεύθυνσης, Ημ/νία: 04 Ιουνίου 2014. Απαντήσεις Θεμάτων Πανελλήνιες Εξετάσεις Ημερήσιων Γενικών Λυκείων Εξεταζόμενο Μάθημα: Βιολογία Θετικής Κατεύθυνσης, Ημ/νία: 04 Ιουνίου 2014 Απαντήσεις Θεμάτων ΘΕΜΑ Α A1. Τα πλασμίδια είναι: δ. κυκλικά δίκλωνα μόρια DNA

Διαβάστε περισσότερα

ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ ΤΑΞΗ

ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ ΤΑΞΗ ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ Σ ΕΣΠΕΡΙΝΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΠΑΡΑΣΚΕΥΗ 30 ΜΑΪΟΥ 2008 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ: ΒΙΟΛΟΓΙΑ ΣΥΝΟΛΟ ΣΕΛΙ ΩΝ: ΠΕΝΤΕ (5) ΘΕΜΑ 1ο Για τις ημιτελείς προτάσεις

Διαβάστε περισσότερα

Παραγωγή φαρμακευτικών πρωτεϊνών με βιοτεχνολογικές μεθόδους Μεταφορά γονιδίων σε ευκαρυωτικά κύτταρα (Γονιδιακή θεραπεία)

Παραγωγή φαρμακευτικών πρωτεϊνών με βιοτεχνολογικές μεθόδους Μεταφορά γονιδίων σε ευκαρυωτικά κύτταρα (Γονιδιακή θεραπεία) Παραγωγή φαρμακευτικών πρωτεϊνών με βιοτεχνολογικές μεθόδους Μεταφορά γονιδίων σε ευκαρυωτικά κύτταρα (Γονιδιακή θεραπεία) Παραγωγή ινσουλίνης από βακτήρια Παρελθόν: απομόνωση ινσουλίνης από πάνγκρεας

Διαβάστε περισσότερα

ΛΕΙΤΟΥΡΓΙΚΗ ΓΟΝΙ ΙΩΜΑΤΙΚΗ

ΛΕΙΤΟΥΡΓΙΚΗ ΓΟΝΙ ΙΩΜΑΤΙΚΗ ΛΕΙΤΟΥΡΓΙΚΗ ΓΟΝΙ ΙΩΜΑΤΙΚΗ ΑΝΑΣΤΡΟΦΗ ΓΕΝΕΤΙΚΗ (γονίδιο φαινότυπος) Πρόσθεση εξωγενών γονιδίων (διαγονιδιακά) Τροποποίηση ενδογενών γονιδίων Αφαίρεση γονιδίων (knockout) ΥΠΟΘΕΣΗ Στοχευμένη μεταλλαξογένεση

Διαβάστε περισσότερα

ΕΜΒΟΛΙΑ ΚΑΙ ΑΝΟΣΟΤΡΟΠΟΠΟΙΗΤΙΚΟΙ ΠΑΡΑΓΟΝΤΕΣ ΣΤΟΝ ΠΑΓΚΡΕΑΤΙΚΟ ΚΑΡΚΙΝΟ

ΕΜΒΟΛΙΑ ΚΑΙ ΑΝΟΣΟΤΡΟΠΟΠΟΙΗΤΙΚΟΙ ΠΑΡΑΓΟΝΤΕΣ ΣΤΟΝ ΠΑΓΚΡΕΑΤΙΚΟ ΚΑΡΚΙΝΟ ΕΜΒΟΛΙΑ ΚΑΙ ΑΝΟΣΟΤΡΟΠΟΠΟΙΗΤΙΚΟΙ ΠΑΡΑΓΟΝΤΕΣ ΣΤΟΝ ΠΑΓΚΡΕΑΤΙΚΟ ΚΑΡΚΙΝΟ ΒΑΣΙΛΕΙΟΣ ΠΑΝΤΕΡΗΣ ΓΑΣΤΡΕΝΤΕΡΟΛΟΓΟΣ ΕΠΙΣΤΗΜΟΝΙΚΟΣ ΣΥΝΕΡΓΑΤΗΣ ΓΑΣΤΡ/ΚΗΣ ΚΛΙΝΙΚΗΣ Γ.Ν. ΝΙΚΑΙΑΣ ΠΡΩΤΗ ΑΝΟΣΟΘΕΡΑΠΕΙΑ ΕΝΑΝΤΙ ΤΟΥ ΚΑΡΚΙΝΟΥ

Διαβάστε περισσότερα

ΑΝΤΙΓΟΝΑ. Aπτίνες Ετερόφιλα αντιγόνα Ομάδες αίματος 18/3/2015, M.ΧΡΙΣΤΟΦΙΔΟΥ

ΑΝΤΙΓΟΝΑ. Aπτίνες Ετερόφιλα αντιγόνα Ομάδες αίματος 18/3/2015, M.ΧΡΙΣΤΟΦΙΔΟΥ ΑΝΤΙΓΟΝΑ Antigens Ags Aπτίνες Ετερόφιλα αντιγόνα Ομάδες αίματος 18/3/2015, M.ΧΡΙΣΤΟΦΙΔΟΥ ΑΝΤΙΓΟΝΟ Χημική ένωση διαγείρει Β, Τ -λεμφοκύτταρα σε ειδική ανοσολογική απόκριση μέσω υποδοχέων (Igs, ΤCR) Ειδική

Διαβάστε περισσότερα

ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΠΑΡΑΣΚΕΥΗ 22 ΜΑΙΟΥ 2009 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ

ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΠΑΡΑΣΚΕΥΗ 22 ΜΑΙΟΥ 2009 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 1 ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΠΑΡΑΣΚΕΥΗ 22 ΜΑΙΟΥ 2009 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ 1ο Να γράψετε στο τετράδιό σας τον αριθµό καθεµιάς από τις παρακάτω

Διαβάστε περισσότερα

ΓΕΝΕΤΙΚΑ ΤΡΟΠΟΠΟΙΗΜΕΝΑ ΦΥΤΑ. ΑΡΧΕΣ ΓΟΝΙ ΙΑΚΟΥ ΧΕΙΡΙΣΜΟΥ ΙΙ (ΜΑΘΗΜΑ 3ο)

ΓΕΝΕΤΙΚΑ ΤΡΟΠΟΠΟΙΗΜΕΝΑ ΦΥΤΑ. ΑΡΧΕΣ ΓΟΝΙ ΙΑΚΟΥ ΧΕΙΡΙΣΜΟΥ ΙΙ (ΜΑΘΗΜΑ 3ο) ΓΕΝΕΤΙΚΑ ΤΡΟΠΟΠΟΙΗΜΕΝΑ ΦΥΤΑ ΑΡΧΕΣ ΓΟΝΙ ΙΑΚΟΥ ΧΕΙΡΙΣΜΟΥ ΙΙ (ΜΑΘΗΜΑ 3ο) 1 ΦΟΡΕΙΣ πλασµίδια βακτηρίων βακτηριοφάγοι ιοί συνδυασµός πλασµιδίου βακτηριοφάγου (κοσµίδια) 2 ΦΟΡΕΙΣ Βακτηριοφάγοι Χαρακτηριστικά

Διαβάστε περισσότερα

8. Σε στέλεχος του βακτηρίου E.coli δε λειτουργεί το γονίδιο που παράγει τον καταστολέα του οπερόνιου της λακτόζης. Ποιο είναι το αποτέλεσμα σε σχέση

8. Σε στέλεχος του βακτηρίου E.coli δε λειτουργεί το γονίδιο που παράγει τον καταστολέα του οπερόνιου της λακτόζης. Ποιο είναι το αποτέλεσμα σε σχέση Γονιδιακή ρύθμιοη 1. Εντοπίστε δύο διαφορές στον έλεγχο της γονιδιακής έκφρασης ανάμεσα στους προκαρυωτικούς και στους ευκαρυωτικούς οργανισμούς. Α. Η ρύθμιση της γσνιδιακής έκφρασης στους προκαρυωτικούς

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ ΚΕΦΑΛΑΙΟ 1(ΥΓΕΙΑ-ΑΝΘΡΩΠΟΣ)

ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ ΚΕΦΑΛΑΙΟ 1(ΥΓΕΙΑ-ΑΝΘΡΩΠΟΣ) ΟΝΟΜΑΤΕΠΩΝΥΜΟ: ΤΜΗΜΑ: ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ ΚΕΦΑΛΑΙΟ 1(ΥΓΕΙΑ-ΑΝΘΡΩΠΟΣ) Να βάλετε σε κύκλο το γράμμα που αντιστοιχεί στη σωστή απάντηση ή στη φράση που συμπληρώνει σωστά την πρόταση: 1. Οι ιοί αποτελούνται

Διαβάστε περισσότερα

ΠΡΟΤΕΙΝΟΜΕΝΕΣ ΑΠΑΝΤΗΣΕΙΣ ΒΙΟΛΟΓΙΑΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΔΙΑΓΩΝΙΣΜΑ 2

ΠΡΟΤΕΙΝΟΜΕΝΕΣ ΑΠΑΝΤΗΣΕΙΣ ΒΙΟΛΟΓΙΑΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΔΙΑΓΩΝΙΣΜΑ 2 ΠΡΟΤΕΙΝΟΜΕΝΕΣ ΑΠΑΝΤΗΣΕΙΣ ΒΙΟΛΟΓΙΑΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΔΙΑΓΩΝΙΣΜΑ 2 ΘΕΜΑ 1 Ο Α. 1 β, 2 α, 3 δ, 4 δ, 5 γ Β. 1 Λ, 2 Σ, 3 Λ, 4 Λ, 5 Λ ΘΕΜΑ 2 Ο Α. 1) α- θαλασσαιμία Σελ 93 σχολικού βιβλίου: ʽʽΤα γονίδια

Διαβάστε περισσότερα

Ανοσολογικό σύστημα και λοιμώξεις Μηχανισμοί άμυνας μεγαλοοργανισμού

Ανοσολογικό σύστημα και λοιμώξεις Μηχανισμοί άμυνας μεγαλοοργανισμού Ανοσολογικό σύστημα και λοιμώξεις Μηχανισμοί άμυνας μεγαλοοργανισμού Γεωργία Σ. Βρυώνη Ιατρός Βιοπαθολόγος Λέκτορας Μικροβιολογίας gvrioni@med.uoa.gr 23/01/08 Μαθήματα Ειδικευόμενων Εισαγωγή στην Ανοσολογία

Διαβάστε περισσότερα

ΠΡΟΤΕΙΝΟΜΕΝΑ ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ

ΠΡΟΤΕΙΝΟΜΕΝΑ ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΠΡΟΤΕΙΝΟΜΕΝΑ ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΘΕΜΑ 1 Ο Α. Να βάλετε σε κύκλο το γράμμα που αντιστοιχεί στη σωστή απάντηση ή στη φράση που συμπληρώνει σωστά την πρόταση. 1. H β- θαλασσαιμία είναι

Διαβάστε περισσότερα

Σας αποστέλλουµε τις προτεινόµενες απαντήσεις που αφορούν τα θέµατα της Βιολογίας Θετικής Κατεύθυνσης των Ηµερησίων Γενικών Λυκείων και ΕΠΑΛ.

Σας αποστέλλουµε τις προτεινόµενες απαντήσεις που αφορούν τα θέµατα της Βιολογίας Θετικής Κατεύθυνσης των Ηµερησίων Γενικών Λυκείων και ΕΠΑΛ. ΠΑΝΕΛΛΗΝΙΑ ΕΝΩΣΗ ΒΙΟΕΠΙΣΤΗΜΟΝΩΝ Σας αποστέλλουµε τις προτεινόµενες απαντήσεις που αφορούν τα θέµατα της Βιολογίας Θετικής Κατεύθυνσης των Ηµερησίων Γενικών Λυκείων και ΕΠΑΛ. Η Επιτροπή Παιδείας της ΠΕΒ

Διαβάστε περισσότερα

Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΒΙΟΛΟΓΙΑ ΑΠΑΝΤΗΣΕΙΣ ÏÅÖÅ

Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΒΙΟΛΟΓΙΑ ΑΠΑΝΤΗΣΕΙΣ ÏÅÖÅ 1 Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΒΙΟΛΟΓΙΑ ΘΕΜΑ 1 o 1 Β 2 3 Γ 4 5 Β. ΘΕΜΑ 2 o ΑΠΑΝΤΗΣΕΙΣ Α. Όπως στο σχολικό, σελίδα 20: «Κάθε φυσιολογικό µεταφασικό ως προς τη θέση του κεντροµεριδίου» και σελίδα «Κατά

Διαβάστε περισσότερα

Γ1. Το γνώρισμα για το μέγεθος των φτερών ελέγχεται από αυτοσωμικό γονίδιο.

Γ1. Το γνώρισμα για το μέγεθος των φτερών ελέγχεται από αυτοσωμικό γονίδιο. ΠΑΝΕΛΛΗΝΙΕΣ ΒΙΟΛΟΓΙΑΣ ΚΑΤΕΥΘΥΝΣΗΣ 2013 AΠΑΝΤΗΣΕΙΣ ΘΕΜΑ Α Α1.γ Α2.β Α3.α Α4.δ Α5.α ΘΕΜΑ Β Β1. Η γονιδιακή θεραπεία εφαρμόστηκε για πρώτη φορά το 1990 σε ένα κορίτσι που έπασχε από έλλειψη της απαμινάσης

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙ ΕΙΑΣ Γ ΤΑΞΗΣ ΕΝΙΑΙΟΥ ΛΥΚΕΙΟΥ 2002

ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙ ΕΙΑΣ Γ ΤΑΞΗΣ ΕΝΙΑΙΟΥ ΛΥΚΕΙΟΥ 2002 ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙ ΕΙΑΣ Γ ΤΑΞΗΣ ΕΝΙΑΙΟΥ ΛΥΚΕΙΟΥ 2002 ΕΚΦΩΝΗΣΕΙΣ ΘΕΜΑ 1 ο Στις ερωτήσεις 1-5, να γράψετε στο τετράδιό σας τον αριθµό της ερώτησης και δίπλα του το γράµµα που αντιστοιχεί στη σωστή απάντηση.

Διαβάστε περισσότερα

γ ρ α π τ ή ε ξ έ τ α σ η σ τ ο μ ά θ η μ α ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ

γ ρ α π τ ή ε ξ έ τ α σ η σ τ ο μ ά θ η μ α ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ γ ρ α π τ ή ε ξ έ τ α σ η σ τ ο μ ά θ η μ α ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ' ΛΥΚΕΙΟΥ Τάξη: Γ Λυκείου Τμήμα: Βαθμός: Ονοματεπώνυμο: Καθηγητές: Θ Ε Μ Α A 1. Να επιλέξετε τη σωστή απάντηση: Α1. Το γονίδιο

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ Α Να γράψετε στο τετράδιό σας τον αριθμό καθεμιάς από τις παρακάτω ημιτελείς προτάσεις Α1 έως Α5 και δίπλα το γράμμα που αντιστοιχεί στη λέξη ή φράση, η οποία συμπληρώνει σωστά

Διαβάστε περισσότερα

ΟΜΟΣΠΟΝ ΙΑ ΕΚΠΑΙ ΕΥΤΙΚΩΝ ΦΡΟΝΤΙΣΤΩΝ ΕΛΛΑ ΟΣ (Ο.Ε.Φ.Ε.) ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ 2012. Ηµεροµηνία: Κυριακή 22 Απριλίου 2012 ΑΠΑΝΤΗΣΕΙΣ

ΟΜΟΣΠΟΝ ΙΑ ΕΚΠΑΙ ΕΥΤΙΚΩΝ ΦΡΟΝΤΙΣΤΩΝ ΕΛΛΑ ΟΣ (Ο.Ε.Φ.Ε.) ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ 2012. Ηµεροµηνία: Κυριακή 22 Απριλίου 2012 ΑΠΑΝΤΗΣΕΙΣ ΤΑΞΗ: ΚΑΤΕΥΘΥΝΣΗ: ΜΑΘΗΜΑ: ΘΕΜΑ Α Γ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗ ΒΙΟΛΟΓΙΑ Ηµεροµηνία: Κυριακή 22 Απριλίου 2012 Α1- δ, Α2-α, Α3-γ, Α4-δ, Α5-β ΘΕΜΑ Β ΑΠΑΝΤΗΣΕΙΣ Β1. Η διπλή έλικα του DN συνδέεται µε τις ιστόνες

Διαβάστε περισσότερα

1. σελ. 109 «Με τον όρο ζύμωση.. όπως πρωτεΐνες και αντιβιοτικά»

1. σελ. 109 «Με τον όρο ζύμωση.. όπως πρωτεΐνες και αντιβιοτικά» ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ 1ο 1. γ 2. γ 3. δ 4. α 5. β ΘΕΜΑ 2ο 1. σελ. 109 «Με τον όρο ζύμωση.. όπως πρωτεΐνες και αντιβιοτικά» 2. σελ. 119-120: «Θεραπευτικά. Τα αντισώματα μπορούν να

Διαβάστε περισσότερα

Κεφάλαιο 19 Ρύθμιση της γονιδιακής έκφρασης σε βακτήρια και βακτηριοφάγους. Ο καταστολέας του οπερονίου lac προσδεδεμένος στο DNA.

Κεφάλαιο 19 Ρύθμιση της γονιδιακής έκφρασης σε βακτήρια και βακτηριοφάγους. Ο καταστολέας του οπερονίου lac προσδεδεμένος στο DNA. Κεφάλαιο 19 Ρύθμιση της γονιδιακής έκφρασης σε βακτήρια και βακτηριοφάγους Ο καταστολέας του οπερονίου lac προσδεδεμένος στο DNA. 1 -Ρυθμιζόμενα, ιδιοστατικά γονίδια και γονίδια κυτταρικής οικονομίας:

Διαβάστε περισσότερα

ΛΕΙΤΟΥΡΓΙΚΗ ΓΟΝΙ ΙΩΜΑΤΙΚΗ

ΛΕΙΤΟΥΡΓΙΚΗ ΓΟΝΙ ΙΩΜΑΤΙΚΗ ΛΕΙΤΟΥΡΓΙΚΗ ΓΟΝΙ ΙΩΜΑΤΙΚΗ ΑΝΑΣΤΡΟΦΗ ΓΕΝΕΤΙΚΗ (γονίδιο φαινότυπος) Πρόσθεση εξωγενών γονιδίων (διαγονιδιακά) Τροποποίηση ενδογενών γονιδίων Αφαίρεση γονιδίων (knockout) Στοχευμένη μεταλλαξογένεση γονιδίων

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ 1ο Να γράψετε στο τετράδιό σας τον αριθμό καθεμιάς από τις παρακάτω ημιτελείς προτάσεις 1 έως 5 και δίπλα το γράμμα που αντιστοιχεί στη λέξη ή τη φράση, η οποία συμπληρώνει

Διαβάστε περισσότερα

ΑΠΑΝΤΗΣΕΙΣ ΒΙΟΛΟΓΙΑΣ ΚΑΤΕΥΘΥΝΣΗΣ ΕΠΑΝΑΛΗΠΤΙΚΟ ΔΙΑΓΩΝΙΣΜΑ

ΑΠΑΝΤΗΣΕΙΣ ΒΙΟΛΟΓΙΑΣ ΚΑΤΕΥΘΥΝΣΗΣ ΕΠΑΝΑΛΗΠΤΙΚΟ ΔΙΑΓΩΝΙΣΜΑ ΑΠΑΝΤΗΣΕΙΣ ΒΙΟΛΟΓΙΑΣ ΚΑΤΕΥΘΥΝΣΗΣ ΕΠΑΝΑΛΗΠΤΙΚΟ ΔΙΑΓΩΝΙΣΜΑ ΘΕΜΑ Α Α1. γ Α2. γ Α3. γ Α4. γ Α5. β ΘΕΜΑ B B1. Σε κάθε νουκλεοτίδιο η αζωτούχος βάση συνδέεται με τον 1' άνθρακα της δεοξυριβόζης και η φωσφορική

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑΤΑ ΘΕΜΑ Α Να γράψετε στο τετράδιό σας τον αριθμό κάθε μίας από τις παρακάτω ημιτελείς προτάσεις Α1 έως Α5 και δίπλα το γράμμα, που αντιστοιχεί στη λέξη ή στη φράση, η οποία

Διαβάστε περισσότερα

- Θεωρία- Δρ. ΠέτρουΚαρκαλούσου

- Θεωρία- Δρ. ΠέτρουΚαρκαλούσου - Θεωρία- Έκδοση2008 Πρόλογος Αγαπητοίσπουδαστέςοισημειώσειςπουκρατάτεσταχέριασαςέχουνσκοπόνασας εισαγάγουνστιςβασικέςγνώσειςμιαςαπότιςσημαντικότερεςβιοιατρικέςεπιστήμες, της ανοσολογίας. Η ανοσολογίαείναιμιασχετικάνέαεπιστήμηηοποίαεμφανίστηκεστοτέλοςτου

Διαβάστε περισσότερα

ΠΡΟΤΕΙΝΟΜΕΝΑ ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 2012 (ΟΜΑΔΑ Α)

ΠΡΟΤΕΙΝΟΜΕΝΑ ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 2012 (ΟΜΑΔΑ Α) ΠΡΟΤΕΙΝΟΜΕΝΑ ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 2012 (ΟΜΑΔΑ Α) ΘΕΜΑ Α (Μονάδες 25) Να βάλετε σε κύκλο το γράμμα που αντιστοιχεί στη σωστή απάντηση ή στη φράση που συμπληρώνει σωστά την πρόταση: Α1. Ένα

Διαβάστε περισσότερα

ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ ΤΑΞΗ

ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ ΤΑΞΗ ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ Σ ΕΣΠΕΡΙΝΟΥ ΕΝΙΑΙΟΥ ΛΥΚΕΙΟΥ ΠΑΡΑΣΚΕΥΗ 2 ΙΟΥΝΙΟΥ 2006 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ: ΒΙΟΛΟΓΙΑ ΣΥΝΟΛΟ ΣΕΛΙ ΩΝ: ΠΕΝΤΕ (5) ΘΕΜΑ 1ο Α. Για τις ημιτελείς προτάσεις

Διαβάστε περισσότερα

ΓΕΝΕΤΙΚΗ ΒΕΛΤΙΩΣΗ. 11η ΙΑΛΕΞΗ

ΓΕΝΕΤΙΚΗ ΒΕΛΤΙΩΣΗ. 11η ΙΑΛΕΞΗ ΓΕΝΕΤΙΚΗ ΒΕΛΤΙΩΣΗ ΦΥΤΩΝ 11η ΙΑΛΕΞΗ ΓΕΝΕΤΙΚΗ ΒΕΛΤΙΩΣΗ ΜΕ ΜΕΤΑΛΛΑΓΕΣ Μεταλλαγή ή Μετάλλαξη Οποιαδήποτε αλλαγή του γενετικού υλικού που δεν οφείλεται σε ανασυνδυασµό ή σε διάσχιση των γονιδίων και η οποία

Διαβάστε περισσότερα

ÈÅÌÁÔÁ 2011 ÏÅÖÅ Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΒΙΟΛΟΓΙΑ ΕΚΦΩΝΗΣΕΙΣ. ΘΕΜΑ 1 o

ÈÅÌÁÔÁ 2011 ÏÅÖÅ Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΒΙΟΛΟΓΙΑ ΕΚΦΩΝΗΣΕΙΣ. ΘΕΜΑ 1 o 1 Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΒΙΟΛΟΓΙΑ ΘΕΜΑ 1 o ΕΚΦΩΝΗΣΕΙΣ Να επιλέξετε τη φράση που συµπληρώνει ορθά κάθε µία από τις ακόλουθες προτάσεις: 1. Το DNA ενός ανθρώπινου κυττάρου αποτελείται από 6 10 9

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΤΑΞΗΣ ΕΝΙΑΙΟΥ ΛΥΚΕΙΟΥ 2002

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΤΑΞΗΣ ΕΝΙΑΙΟΥ ΛΥΚΕΙΟΥ 2002 ΘΕΜΑ 1ο ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΤΑΞΗΣ ΕΝΙΑΙΟΥ ΛΥΚΕΙΟΥ 2002 Α. Στις ερωτήσεις 1-2, να γράψετε στο τετράδιό σας τον αριθµό της ερώτησης και δίπλα το γράµµα που αντιστοιχεί στη σωστή απάντηση. 1. ίκλωνο

Διαβάστε περισσότερα

ΟΜΟΣΠΟΝ ΙΑ ΕΚΠΑΙ ΕΥΤΙΚΩΝ ΦΡΟΝΤΙΣΤΩΝ ΕΛΛΑ ΟΣ (Ο.Ε.Φ.Ε.) ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ 2013 ÁÍÅËÉÎÇ

ΟΜΟΣΠΟΝ ΙΑ ΕΚΠΑΙ ΕΥΤΙΚΩΝ ΦΡΟΝΤΙΣΤΩΝ ΕΛΛΑ ΟΣ (Ο.Ε.Φ.Ε.) ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ 2013 ÁÍÅËÉÎÇ ΤΑΞΗ: ΚΑΤΕΥΘΥΝΣΗ: ΜΑΘΗΜΑ: Γ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗ ΒΙΟΛΟΓΙΑ Ηµεροµηνία: Κυριακή 28 Απριλίου 2013 ιάρκεια Εξέτασης: 3 ώρες ΕΚΦΩΝΗΣΕΙΣ ΘΕΜΑ Α Να γράψετε στο τετράδιό σας τον αριθµό καθεµιάς από τις παρακάτω

Διαβάστε περισσότερα

Για το χρώµα σπέρµατος επικρατής είναι η ιδιότητα κίτρινο και η υπολειπόµενη το πράσινο. Συµβολίζουµε: Κ:Κίτρινο κ: Πράσινο Κ>κ

Για το χρώµα σπέρµατος επικρατής είναι η ιδιότητα κίτρινο και η υπολειπόµενη το πράσινο. Συµβολίζουµε: Κ:Κίτρινο κ: Πράσινο Κ>κ Απαντήσεις Βιολογία Κατεύθυνσης 2011 ΘΕΜΑ Α Α1 α Α2 δ Α3 γ Α4 β Α5 β ΘΕΜΑ Β Β1 Σελ. 13 «Το 1928 γίνεται αυτό» Β2 Σελ 101 «βλάβες στους επιδιορθωτικά ένζυµα» (Χωρίς να απαιτείται θα θεωρηθεί σωστό να γίνει

Διαβάστε περισσότερα

γραπτή εξέταση στo μάθημα ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ Γ ' ΛΥΚΕΙΟΥ

γραπτή εξέταση στo μάθημα ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ Γ ' ΛΥΚΕΙΟΥ γραπτή εξέταση στo μάθημα ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ Γ ' ΛΥΚΕΙΟΥ Τάξη: Γ Λυκείου Τμήμα: Βαθμός: Ονοματεπώνυμο: Καθηγητής: Θ Ε Μ Α A 1. Να επιλέξετε τη σωστή απάντηση: Α1. Ευκαρυωτικοί μικροοργανισμοί; α.

Διαβάστε περισσότερα

Εισαγωγή στην Ανοσολογία

Εισαγωγή στην Ανοσολογία Εισαγωγή στην Ανοσολογία ρ. Γιώργος Κρασιάς Ινστιτούτο Νευρολογίας και Γενετικής Κύπρου Τµήµα Μοριακής Ιολογίας Τι είναι το Ανοσοποιητικό Σύστηµα (ΑΣ)? Το ΑΣ (Immune System) είναι ένα σύστηµα άµυνας του

Διαβάστε περισσότερα

ΜΑΘΗΜΑ / ΤΑΞΗ : ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ / Γ ΛΥΚΕΙΟΥ ΣΕΙΡΑ: ΗΜΕΡΟΜΗΝΙΑ: 08/01/2012

ΜΑΘΗΜΑ / ΤΑΞΗ : ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ / Γ ΛΥΚΕΙΟΥ ΣΕΙΡΑ: ΗΜΕΡΟΜΗΝΙΑ: 08/01/2012 ΜΑΘΗΜΑ / ΤΑΞΗ : ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ / Γ ΛΥΚΕΙΟΥ ΣΕΙΡΑ: ΗΜΕΡΟΜΗΝΙΑ: 08/01/2012 ΘΕΜΑ 1 Ο Α. Να επιλέξετε την φράση που συμπληρώνει ορθά κάθε μία από τις ακόλουθες προτάσεις: 1. Τα αντισώματα εκκρίνονται

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ 24 ΜΑΪΟΥ 2013 ΑΠΑΝΤΗΣΕΙΣ ÍÅÏ

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ 24 ΜΑΪΟΥ 2013 ΑΠΑΝΤΗΣΕΙΣ ÍÅÏ ΘΕΜΑ Α Α1: γ Α2: β Α3: α Α4: δ Α5: α ΘΕΜΑ B ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ 24 ΜΑΪΟΥ 2013 ΑΠΑΝΤΗΣΕΙΣ Β1. Η γονιδιακή θεραπεία εφαρµόστηκε για πρώτη φορά το Σεπτέµβριο του 1990 σε ένα τετράχρονο

Διαβάστε περισσότερα

ΦΡΟΝΤΙΣΤΗΡΙΟ «ΕΝΑ» ΓΙΟΜΠΛΙΑΚΗΣ ΛΑΖΑΡΟΣ ΠΕΤΡΟΜΕΛΙΔΗΣ ΒΑΣΙΛΗΣ

ΦΡΟΝΤΙΣΤΗΡΙΟ «ΕΝΑ» ΓΙΟΜΠΛΙΑΚΗΣ ΛΑΖΑΡΟΣ ΠΕΤΡΟΜΕΛΙΔΗΣ ΒΑΣΙΛΗΣ ΦΡΟΝΤΙΣΤΗΡΙΟ «ΕΝΑ» ΓΙΟΜΠΛΙΑΚΗΣ ΛΑΖΑΡΟΣ ΠΕΤΡΟΜΕΛΙΔΗΣ ΒΑΣΙΛΗΣ ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΘΕΜΑ 1 ο Α. Να βάλετε σε κύκλο το γράµµα που αντιστοιχεί στη σωστή απάντηση. 1. Ο µέγιστος αριθµός διαφορετικών

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ Α Α1 δ Α2 γ Α3 β Α4 γ Α5 β ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ Β Β1. 4 2 1 6 3 5 Β2. α. DNA πολυμεράση β. πριμόσωμα γ. DNA δεσμάση δ. DNA ελκάση ε. RNA πολυμεράση Β3. Σχολικό βιβλίο, Σελ.: 98: «Η διάγνωση των

Διαβάστε περισσότερα

των ανοσοσφαιρινών σε νεοπλασίες των Β λεμφοκυττάρων»

των ανοσοσφαιρινών σε νεοπλασίες των Β λεμφοκυττάρων» Αριστοτέλειο Πανεπιστήμιο Θεσσαλονίκης Σχολή Θετικών Επιστημών Τμήμα Βιολογίας Διδακτορική Διατριβή «Ανάλυση των αναδιατάξεων των γονιδίων των ανοσοσφαιρινών σε νεοπλασίες των Β λεμφοκυττάρων» Ανδρέας

Διαβάστε περισσότερα

Μαυροματάκης Γιώργος Βιολόγος

Μαυροματάκης Γιώργος Βιολόγος Βιολογία Γ'Λυκείου Κατεύθυνσης Εικονογραφημένη Επανάληψη Μαυροματάκης Γιώργος Βιολόγος (gmavromat@gmail.com) Χανιά 2009-2010 1 Κεφάλαιο 1ο Το γενετικό υλικό 2 3 Με τη βοήθεια της φωτογραφίας που ακολουθεί

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΘΕΜΑ 1ο Να γράψετε στο τετράδιο σας τον αριθμό καθεμιάς από τις παρακάτω ημιτελείς προτάσεις 1 έως 5 και δίπλα το γράμμα που αντιστοιχεί στη φράση που συμπληρώνει

Διαβάστε περισσότερα

ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΤΕΤΑΡΤΗ 4 ΙΟΥΛΙΟΥ 2007 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ: ΒΙΟΛΟΓΙΑ ΑΠΑΝΤΗΣΕΙΣ

ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΤΕΤΑΡΤΗ 4 ΙΟΥΛΙΟΥ 2007 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ: ΒΙΟΛΟΓΙΑ ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ 1ο 1. α 2. γ 3. δ 4. γ 5. β 1 ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΤΕΤΑΡΤΗ 4 ΙΟΥΛΙΟΥ 2007 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ: ΒΙΟΛΟΓΙΑ ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ 2ο 1. Σχολικό βιβλίο,

Διαβάστε περισσότερα