ΚΛΩΝΙΚΗ ΕΠΙΛΟΓΗ ΚΥΤΤΑΡΑ ΜΝΗΜΗΣ (ΕΠΙΒΙΩΣΗ ΕΚΑΕΤΙΕΣ)

Μέγεθος: px
Εμφάνιση ξεκινά από τη σελίδα:

Download "ΚΛΩΝΙΚΗ ΕΠΙΛΟΓΗ ΚΥΤΤΑΡΑ ΜΝΗΜΗΣ (ΕΠΙΒΙΩΣΗ ΕΚΑΕΤΙΕΣ)"

Transcript

1 ΚΛΩΝΙΚΗ ΕΠΙΛΟΓΗ ANTIΓΟΝΟ ΑΡΧΙΚΗ ΕΞΑΜΕΝΗ ΛΕΜΦΟΚΥΤΤΑΡΩΝ (ΑΝΕΞΆΡΤΗΤΗ ΑΝΤΙΓΟΝΟΥ} ΕΠΙΛΟΓΗ ΚΛΩΝΟΥ (ΠΑΡΟΥΣΙΑ ΑΝΤΙΓΟΝΟΥ) ΑΥΞΗΣΗ ΑΡΙΘΜΟΥ ΩΡΙΜΑΝΣΗ ΑΝΤΙΣΩΜΑ ΕΚΤΕΛΕΣΤΙΚΑ ΚΥΤΤΑΡΑ (ΕΠΙΒΙΩΣΗ ΜΕΡΙΚΕΣ ΜΕΡΕΣ) ΚΥΤΤΑΡΑ ΜΝΗΜΗΣ (ΕΠΙΒΙΩΣΗ ΕΚΑΕΤΙΕΣ) Το αντιγόνο επιλέγει τα κύτταρα µε την κατάλληλη εξειδίκευση και προκαλεί τον πολ/σµό τους και την παραγωγή των αντισωµάτων Προϋπόθεση λειτουργίας να υπάρχει µηχανισµός παραγωγής τεράστιου αριθµού διαφορετικών Igs απουσία δυνάµεων επιλογής

2 ΩΡΙΜΑΝΣΗ Β ΚΥΤΤΑΡΩΝ ΚΥΤΤΑΡΟ Έκφραση Ig Προγονικό αιµοποιητικό κύτταρο Όχι Mυελός των οστών Κύτταρο Λεµφικής Σειράς Μερικός ανασυνδυασµός γονιδίου βαριάς αλυσίδας Προ-προ Β κύτταρο (pro-b cell) Ολικός ανασυνδυασµός γονιδίου βαριάς αλυσίδας Προ-Β κύτταρο (pre-b cell) Ανασυνδυασµός γονιδίου ελαφριάς αλυσίδας Ανώριµο Β κύτταρο Αλλαγή στη συρραφή του RNA Ωριµο Β κύτταρο Όχι Όχι µ βαριά aλυσίδα +βοηθητική migm migm+migd

3 ΩΡΙΜΑΝΣΗ Β ΚΥΤΤΑΡΩΝ ΚΥΤΤΑΡΟ Έκφραση Ig Περιφερικά λεµφικά όργανα Ωριµο Β κύτταρο ιέγερση από αντιγόνο Ενεργοποίηση Β κυττάρου ιαφοροποίηση Πλασµατοκύτταρα που εκκρίνουν IgM Μετάπτωση τάξης migm+migd Πλασµατοκύτταρα που εκκρίνουν διάφορους ισότυπους Ig Β κύτταρα µνήµης

4 Ισότυπος Ab Υπότυποι Βαριά αλυσίδα Συγκέντρωση ορού Χρόνος Ηµιζωής (ηµέρες) Εκκρινόµενη µορφή Λειτουργία ΙgA IgA 1,2 α (1 ή 2) Μονο, δι, τριµερές Βλεννογονική ανοσία νεογνική παθητική ανοσία IgD - δ Ιχνη 3 Όχι Αντιγονικός Υποδοχέας παρθένων Β κυττάρων IgE - ε Αµεση υπερευαισθησία IgG IgG1-4 γ(1,2,3, ή 4) 13,5 23 Ωψωνινοποίηση, ADCC, νεογνική ανοσία, ενεργ. συµπληρώµατος IgM - µ 1,5 5 Αντιγονικός Υποδοχέας παρθένων Β κυττάρων, ενεργ. συµπληρώµατος

5 Αναδιάταξη των γονιδίων των ανοσοσφαιρινών: πειραµατική προσέγγιση

6 Mεταβλητότητα αµινοξέων στη µεταβλητή V περιοχή VH CH VL CL FR1 FR2 FR3 FR4 CDR1 CDR2 CDR3 FR: Framework Region = περιοχή πλαισίου CDR: Complementarity Determining region =περιοχή που καθορίζει συµπληρωµατικότητα

7 Mεταβλητότητα αµινοξέων στη µεταβλητή V περιοχή Ελαφριά αλυσίδα ss s FR1 CDR1 FR2 CDR2 FR3 CDR3 FR4 Βαριά αλυσίδα ss s FR1 CDR1 FR2 CDR2 FR3 CDR3 FR4 I II III IV V CDR1 CDR EVGLVESGGGLVGQPGGSLRLSCAASGFTFSTSAVVWVRGARGKGLEWVGWRVEGSSLTHYAVSVG L S D M A K QEA NS F DT M D K AWMK V V QVVELAF N N A G TSRT EF VG AIS D L RVLSF SG LNA NL F A I II III IV V CDR GRFTISRNDSKNTLYLQMLSLEPZBTAVYYCARVTPAAASLTFSAVWGQGTLV NR A FRQ FVQ [--] FD F I VT VVST[---] SMD P A NTG A TR GGY[---] D QA LSVT V[---] AFD

8 Τοποθέτηση των γονιδίων των ανοσοσφαιρινών στα χρωµοσώµατα ΧΡΩΜΟΣΩΜΑΤΑ Γονίδιο Ανθρωπος Ποντίκι λ ελαφριά αλυσίδα κ ελαφριά αλυσίδα 2 6 Βαριά αλυσίδα 14 12

9 ΗΜΙΟΥΡΓΙΑ ΠΟΙΚΙΛΟΤΗΤΑΣ ΑΝΤΙΣΩΜΑΤΩΝ (ΡΕΠΕΡΤΟΡΙΟ Β ΚΥΤΤΑΡΩΝ) 1. Οργάνωση των γονιδίων των ανοσοσφαιρινών 2. Σωµατικός ανασυνδυασµός Αναδιάταξη γονιδίων 3. Μεταβλητός ανασυνδυασµός (Junctional diversity) 4. Προσθήκη Ν-νουκλεοτιδικής περιοχής 5. Σωµατικές µεταλλαγές (Somatic mutations) 6. Συνδυασµός αλυσίδων

10 ΗΜΙΟΥΡΓΙΑ ΠΟΙΚΙΛΟΤΗΤΑΣ ΑΝΤΙΣΩΜΑΤΩΝ (ΡΕΠΕΡΤΟΡΙΟ Β ΚΥΤΤΑΡΩΝ) 1. Οργάνωση των γονιδίων των ανοσοσφαιρινών

11 Οργάνωση γονιδίων ανοσοσφαιρινών Γενετικός τόπος βαριών H αλυσίδων (χρωµόσωµα 14) S1 VH1 SLn VHn D JH Cµ C δ Cγ3 Cγ1 Cγ2b 5 Cγ2a Cε Cα 3 CH1 CH2 CH3 CH4 SC Γενετικός τόπος κ ελαφριών αλυσίδων (χρωµόσωµα 2) S1 V κ1 Sn Vκn J κ C κ 5 3 Γενετικός τόπος λ ελαφριών αλυσίδων (χρωµόσωµα 22) S1 Vλ1 Sn Vλn Jλ1 C λ1...jλ6 C λ6 5 3 S=πεπτίδιο οδηγός, n= ~100 V= µεταβλητό γονιδιακό τµήµα, D=γονιδιακό τµήµα ετερογένειας J= συνδετικό γονιδιακό τµήµα, C= γονιδιακό τµήµα σταθερής περιοχής

12 ΗΜΙΟΥΡΓΙΑ ΠΟΙΚΙΛΟΤΗΤΑΣ ΑΝΤΙΣΩΜΑΤΩΝ (ΡΕΠΕΡΤΟΡΙΟ Β ΚΥΤΤΑΡΩΝ) 1. Οργάνωση των γονιδίων των ανοσοσφαιρινών 2. Σωµατικός ανασυνδυασµός Αναδιάταξη γονιδίων

13 Αναδιάταξη των γονιδίων των βαριών αλυσίδων στα B κύτταρα. DNA βλαστικών κυττάρων (Stem cell) 5 S1 VH1 Sn VHn D JH CHµ... CΗα 3 D -J αναδιάταξη DNA B κυττάρων α. 5 S1 VH1 Sn VHn D JH CHµ... CΗα 3 V-DJ αναδιάταξη β. 5 S1 VH1D JH CHµ... CΗα 3 Μεταγραφή hmrna 5 S1 VH1D JH CHµ... CΗα 3 Συρραφή RNA (splicing) mrna S VH DJ Cµ AAA Μετάφραση πρωτεΐνη

14 Αναδιάταξη των γονιδίων των ελαφριών κ αλυσίδων στα Β κύτταρα S1 Vκ1 Sn Vκn J κ Cκ S1 Vκ1 Jκ V-J αναδιάταξη Cκ 3 Μεταγραφή hmrna 5 S1 Vκ1 Jκ Cκ 3 Συρραφή RNA (splicing) mrna S Vκ J πρωτεΐνη C Μετάφραση AAA

15 AΛΛΗΛΟΥΧΙΕΣ ΑΝΑΓΝΩΡΙΣΗΣ ΑΝΑΣΥΝ YΑΣΜΟΥ (Recombination Signal Sequences - RSS) 1. Nουκλεοτιδική αλληλουχία των RSSs: είναι συντηρηµένες παλίνδροµες αλληλουχίες αποτελούν θέσεις πρόσδεσης δύο υποµονάδων ανασυνδυάσης 2-στροφές στην έλικα του DNA 1-στροφή στην έλικα του DNA

16 AΛΛΗΛΟΥΧΙΕΣ ΑΝΑΓΝΩΡΙΣΗΣ ΑΝΑΣΥΝ YΑΣΜΟΥ (Recombination Signal Sequences - RSS)

17 Κανόνας 23/12 5 Vλ Jλ CACAGTG ACAAAAACC GGTTTTTGT CACTGTG 3 7-µερές 9-µερές C --- G C --- G A --- T A --- T A --- T A --- T A --- T C --- G A --- T 9-µερές 7-µερές Vλ G --- C T --- A G --- C A --- T C --- G A --- T C --- G Jλ 3

18 Mηχανισµοί V-J αναδιάταξης Eλλειπτικός Αντιστροφή V J V J V 9 9 V J J V J V J 9 V J 5 3 V J 5 3

19 Αποµόνωση κυκλικού DNA από θυµοκύτταρα στα οποία το DNA που κωδικοποιεί τις αλυσίδες του TCR υφίσταται V-D-J και V-J γονιδιακή αναδιάταξη

20 ΗΜΙΟΥΡΓΙΑ ΠΟΙΚΙΛΟΤΗΤΑΣ ΑΝΤΙΣΩΜΑΤΩΝ (ΡΕΠΕΡΤΟΡΙΟ Β ΚΥΤΤΑΡΩΝ) 1. Οργάνωση των γονιδίων των ανοσοσφαιρινών 2. Σωµατικός ανασυνδυασµός Αναδιάταξη γονιδίων 3. Μεταβλητός ανασυνδυασµός (Junctional diversity)

21 3. Μεταβλητός ανασυνδυασµός (Junctional diversity)

22 Ελλείψεις νουκλεοτιδίων στις συνδέσεις Aλληλουχία βλαστικής σειράς (germline) Vk21 C C C C C C T G G Jk1 C C C C C C T G G C C C T G G Pro-Try Αλληλουχία κατά την έκφραση C C C C C C T G G C C C C G G Pro-Arg C C C C C C T G G C C C C C G Pro-Pro C C C C C C T G G C C C C C C Pro-Pro Αλληλουχία εκτός πλαισίου ανάγνωσης C C C C C C T G G C C C C T G G V1 D J C V1 D J C Αφαίρεση νουκλεοτιδίων από νουκλεάσες

23 Παραγωγικές και µη-παραγωγικές αναδιατάξεις RSS C A C T G T G Jk G T G G A C T A G G G A G G A T G C T C C Vk C A C T G T G RSS Glu Asp Ala Thr Arg 1 G A G G A T G C G A C T A G G Παραγωγική αναδιάταξη 2 3 Glu Asp Gly Thr Arg G A G G A T G G C G A C T A G Glu Asp Trp Thr Arg G A G G A T T G G A C T A G G Μη-παραγωγική αναδιάταξη 4 5 Glu Asp Ala Asp stop G A G G A T G C G G A C T A G Glu Val Asp stop G A G G T G G A C T A G

24 Κατά τον αλληλικό αποκλεισµό στο κύτταρο εκφράζονται µόνο η µια βαριά και η µια ελαφριά αλυσίδα της ανοσοσφαιρίνης από τον ένα γονέα. Το Β κύτταρο έχει µια µόνο αντιγονική ειδικότητα.

25 Αλληλικός αποκλεισµός

26 ΗΜΙΟΥΡΓΙΑ ΠΟΙΚΙΛΟΤΗΤΑΣ ΑΝΤΙΣΩΜΑΤΩΝ (ΡΕΠΕΡΤΟΡΙΟ Β ΚΥΤΤΑΡΩΝ) 1. Οργάνωση των γονιδίων των ανοσοσφαιρινών 2. Σωµατικός ανασυνδυασµός Αναδιάταξη γονιδίων 3. Μεταβλητός ανασυνδυασµός (Junctional diversity) 4. Προσθήκη Ν-νουκλεοτιδικής περιοχής

27 Μηχανισµός Προσθήκης P- νουκλεοτιδίων

28 Μηχανισµός Προσθήκης N- νουκλεοτιδίων Ακροτελική δεοξυνουκλεοτιδυλοτρανσφεράση (ΤdΤ)

29 Περιοχή προσθήκης Ν νουκλεοτιδίων Αλληλουχία βλαστικής σειράς (germline) VH Τ C Α C C + C C A Τ G A C D H Noυκλεοτίδια Ν περιοχής Αλληλουχία κατά την έκφραση VH Τ C Α C C C C A Τ G A C D H Ser-Pro-His-Asp V1 D J C V1 D J C Προσθήκη νουκλεοτιδίων ή περιοχή Ν

30 ΗΜΙΟΥΡΓΙΑ ΠΟΙΚΙΛΟΤΗΤΑΣ ΑΝΤΙΣΩΜΑΤΩΝ (ΡΕΠΕΡΤΟΡΙΟ Β ΚΥΤΤΑΡΩΝ) 1. Οργάνωση των γονιδίων των ανοσοσφαιρινών 2. Σωµατικός ανασυνδυασµός Αναδιάταξη γονιδίων 3. Μεταβλητός ανασυνδυασµός (Junctional diversity) 4. Προσθήκη Ν-νουκλεοτιδικής περιοχής 5. Σωµατικές µεταλλαγές (Somatic mutations)

31 Σωµατικές µεταλλαγές στα V γονίδια των ανοσοσφαιρινών (Somatic mutations)

32 Σωµατικές µεταλλαγές στα V γονίδια των ανοσοσφαιρινών (Somatic mutations) Ανοσιακή απάντηση 7η µέρα Πρωτογενής VH CDR1 CDR2 CDR3 J3 J3 J3 J3 J3 J4 J4 J4 J2 VL CDR1 CDR2 CDR3 KD 10-7 M η µέρα Πρωτογενής J3 J3 J3 J J3 0.9 J4 ευτερογενής J Τριτογενής D J ιαφορετικό νουκλεοτίδιο Mεταλλαγές: Σε όλες τις βάσεις Μεταλλαγή µετάπτωσης (transition): Pu Pu, Py Py (A G, C T) Μεταλλαγή µετατροπής (transversion): Pu Py, Py Pu Eνθέσεις Ελλείψεις J4 J4 J3 <0.03 <0.03 <0.03 Μεταλλαγή που οδηγεί σε διαφορετικό αµινοξύ

33

34 ΗΜΙΟΥΡΓΙΑ ΠΟΙΚΙΛΟΤΗΤΑΣ ΑΝΤΙΣΩΜΑΤΩΝ (ΡΕΠΕΡΤΟΡΙΟ Β ΚΥΤΤΑΡΩΝ) 1. Οργάνωση των γονιδίων των ανοσοσφαιρινών 2. Σωµατικός ανασυνδυασµός Αναδιάταξη γονιδίων 3. Μεταβλητός ανασυνδυασµός (Junctional diversity) 4. Προσθήκη Ν-νουκλεοτιδικής περιοχής 5. Σωµατικές µεταλλαγές (Somatic mutations) 6. Συνδυασµός αλυσίδων

35 ΣΥΝ ΥΑΣΤΙΚΗ ΣΥΝ ΕΣΗ ΑΛΥΣΙ ΩΝ Π.χ. Εαν υπάρχουν 10 4 διαφορετικές ελαφριές αλυσίδες και 10 4 διαφορετικές βαριές αλυσίδες µπορούν να παραχθούν θεωρητικά 10 8 διαφορετικά αντισώµατα

36 ΡΕΠΕΡΤΟΡΙΟ Β ΚΥΤΤΑΡΩΝ Στο ποντίκι Ελαφριά αλυσίδα Μηχανισµός ποικιλότητας Βαριά αλυσίδα κ λ Αριθµός γονιδιακών τµηµάτων 1. Πολλαπλά γονιδιακά τµήµατα V D J Πιθανός αριθµός ανασυνδυασµών 2. Αναδιάταξη V-J και V-D-J 300 Χ 13 Χ 4 =1.6 Χ Χ 4=1.2 Χ Χ 3 = 6 3. Μεταβλητός ανασυνδυασµός Προσθήκη Ν νουκλεοτιδίων Σωµατική µεταλλαγή Συνδυαστική σύνδεση >1.6 Χ 10 4 Χ (>1.2 Χ >6) =>>1.9 Χ 10 7

37 Locations of promoters, enhancers, & silencers in mouse heavy chain, κ chain and λ light chain germline DNA. Variable gene rearrangement moves an enhancer close enough to a promoter to activate transcription from the promoter. Hence, DNA rearrangement greatly accelerates immunoglobulin gene transcription Transcription factors that are important for immunoglobulin gene expression Oct 2 B-cell specific transcription factor E2A alternatively spliced to give rise to two collaborating proteins. E2A proteins are essential for B- cell development. No B cells in E2A knock-out mice. Expression of E2A in a T-cell line results in a dramatic increase in the transcription of µ chain mrna and induction of T cells to undergo DHJH joining.

38 Proposed mechanism for class switching induced by IL-4 in rearranged immunoglobulin heavy chain genes

39 Expression of membrane & secreted forms of immunoglobulin heavy chain

40 Alternative splicing regulates production of membrane-bound versus secreted µ heavy chain

41 Μαγικές σφαίρες = αντισώµατα Ο Paul Ehrlich, στις αρχές του προηγούµενου αιώνα, διετύπωσε τη θεωρία των υποδοχέων (σήµερα γνωστοί ως αντισώµατα) που εκκρίνονται από κύτταρα του ανοσοποιητικού συστήµατος ως απάντηση σ ένα ξένο αντιγόνο.

42 CΟΟΗ ΝΗ2 οµή και λειτουργία των ανοσοσφαιρινών Fv Fab Σταθερή περιοχή V-περιοχή Πρόσδεση αντιγόνου Fv VH Fab Cγ1 ΙgG CL VL Fv Fab V περιοχή Fc Cγ3 Cγ2 Πρόσδεση συµπληρώµατος Πρόσδεση του Fc υποδοχέα C περιοχή

43 οµή V περιοχών των ανοσοσφαιρινών VH VL CL CH FR: Framework Region = περιοχή πλαισίου CDR: Complementarity Determining region = περιοχή που καθορίζει συµπληρωµατικότητα FR1 FR2 FR3 FR4 CDR1 CDR2 CDR3 ΝΗ2 V-περιοχή Σταθερή περιοχή VH VL CΟΟΗ

44 Moνοκλωνικά αντισώµατα (mabs) 1975: Köhler και Milstein τεχνολογία µονοκλωνικών αντισωµάτων (µία κυτταρική σειρά µπορεί να εκκρίνει αντισώµατα µιάς ειδικότητας, δηλαδή να αναγνωρίζει ένα συγκεκριµένο αντιγόνο) Το νεοπλασµατικό κύτταρο διαιρείται επ άπειρον αλλά δεν παράγει mabs ΣΥΝΤΗΞΗ ΥΟ ΚΥΤΤΑΡΩΝ Το Β-λεµφοκύτταρο ενός ζώου το οποίο έχει ανοσοποιηθεί µε ένα αντιγόνο παράγει το ειδικό αντίσωµα, αλλά δεν διαιρείται επ άπειρον. Το υβριδικό κύτταρο παράγει ειδικό αντίσωµα και διαιρείται επ άπειρον.

45 Χρήση µονοκλωνικών αντισωµάτων Βιοµηχανία: Μαζική παραγωγή αντισωµάτων Ερευνα: Λειτουργική ανάλυση µορίων (βιοχηµική και µικροσκοπική ανίχνευση και αποµόνωση, διερέυνηση λειτουργίας) Αναγνώριση µεµβρανικών δεικτών (χαρακτηρισµός συγκεκριµένων κυττάρων κλπ) ιαγνωστική και Θεραπευτική Ιατρική: Ανοσοδιάγνωση (λοιµωδών ή συστηµατικών νοσηµάτων µε προσδιορισµό ειδικών αντιγόνων ή αντισωµάτων, διαγνωστική απεικόνιση όγκων, κλπ) Ανοσοθεραπεία (θεραπεία όγκων, µεταµόσχευση οργάνων, εµβόλια κλπ)

46 Προβλήµατα από τη χρήση µονοκλωνικών αντισωµάτων στην ιατρική Ευαισθητοποίηση του οργανισµού µετά την in vivo χορήγηγη ξενογενών µονοκλωνικών αντισωµάτων υσκολία δηµιουργίας φυσικής αλληλεπίδρασης µεταξύ του αντισώµατος και του αντιγόνου στόχου Αλλαγή στη δοµή του αντιγόνου Χαµηλή συγγένεια Μη ικανοποιητικός ισότυπος Μη ικανοποιητικός χρόνος ηµιζωής Μικρή παραγωγή Υψηλό οικονοµικό κόστος

47 Aνάγκη κατασκευής ανασυνδυασµένων αντισωµάτων ή τµηµάτων αντισωµάτων ΓΕΝΕΤΙΚΗ ΜΗΧΑΝΙΚΗ Κατασκευή ανοσοσυµβατών αντισωµάτων Αλλαγή χρόνου ηµιζωής Αλλαγή ισοτύπου Aύξηση συγγένειας και ειδικότητας Kατασκευή αντισωµάτων µε δύο ειδικότητες Kατασκευή µορίων που έχουν και άλλες ιδιότητες Αλλαγή λειτουργικότητας Eύκολη, γρήγορη, µαζική παραγωγή Χαµηλότερο οικονοµικό κόστος

48 Τροποποιηµένα αντισώµατα Υβρίδωµα από ποντίκι In vitro βιβλιοθήκες αντισωµάτων ιαγονιδιακά ποντίκια Ανθρώπινα Υβριδώµατα ποντικίσιο χιµαιρικό ανθρωποποιηµένο ανθρώπινο Γενετική µηχανική Κλωνοποίηση V γονιδίων Mεταµόσχευση CDR τµηµάτων Ευκαρυωτική έκφραση

49 Κατασκευή χιµαιρικών αντισωµάτων

50 Κατασκευή χιµαιρικών και υβριδικών µονοκλωνικών αντισωµάτων µε τεχνικές ανασυνδυασµένου DNA

51 Aνθρωποποιηµένa αντισώµατα Ab ποντικού Ab ανθρώπου Fv Ab χίµαιρα CDRs Ab ανθρωποποιηµένο

52 Ανασυνδυασµένα τµήµατα αντισωµάτων NH 2 NH 2 NH 2 NH 2 NH 2 NH 2 VL VH VH VL VL VH VL VH VL VH VH VL CL CH1 CH1 CL CL CH1 COOH COOH COOH COOH -S-S- H H -S-S- -S-S- -S-S- -S-S- COOH COOH Fv scfv (single chain Fv) CH2 CH2 Fab CH3 CH3 VH VL IgG VL VH CH1 CL VL VH

53 Νεότερες τεχνολογίες Fv τµηµάτων Γονίδια Μορφή scfv Triabody Diabody

54 Εκφραση των scfv και Fab τµηµάτων των αντισωµάτων στην επιφάνεια νηµατοειδών φάγων. V H V L scfv V H V L Fab C Η C L piii piii

55 Μολυσµατικός κύκλος νηµατοειδών φάγων. ιοσωµάτιο piii Εισβαλόµενο ιοσωµάτιο Εκβαλόµενο ιοσωµάτιο pviii pvi περίπλασµα κυτταρόπλασµα pv-ssdna pvii pix + κλώνος pii, px pii, px + κλώνος pv RF

56 ιαλυτή έκφραση τµηµάτων αντισώµατος σε E. coli (µερική λύση της κυτταροπλασµατικής µεµβράνης) periplasm VL CH1 VH CL N pelb C N pelb VH CH1 VL CL Coat protein III C phen1 amp R

57 Κατασκευή scfv τµήµατος του αντισώµατος υβρίδωµα mrna AAA RT µε ειδικά Ig εναρκτήρια µόρια cdna AAA PCR µε ειδικά Ig εναρκτήρια µόρια VH VL VH VL scfv Linker Εισαγωγή περιοριστικών θέσεων lacz pelb scfv φαγεµίδιο piii ιαλυτή έκφραση στο υπερκείµενο της καλλιέργειας

58 Kατασκευή Fab βιβλιοθήκης φάγων από Β λεµφοκύτταρα B λεµφοκύτταρα B κύτταρα Αποµόνωση RNA Σύνθεση cdna RT µε ειδικά Ig εναρκτήρια µόρια cdna AAA AAA mrna Ενζυµική ενίσχυση (PCR) PCR µε ειδικά Ig εναρκτήρια µόρια VH-CH1 VL-CL Προσθήκη περιοριστικών θέσεων Κλωνοποίηση στο φαγεµίδιο pcomb3h VH-CH1 VL-CL lacz pelb VH-CH1 lacz pelb VL-CL piii Φαγεµίδιο pcomb3h Πολυπλοκότητα βιβλιοθηκών Βιβλιοθήκη: 1-5X10 7 cfu/µg DNA Στάδια PCR: 2 Εναρκτήρια µόρια PCR: 26 Συνδέσεις: 2 Αποµόνωση των ειδικών φάγων - αντισωµάτων µε panning

59 Στρατηγική κλωνοποίησης ανθρώπινων µoνοκλωνικών τµηµάτων αντισωµάτων από βιβλιοθήκες φάγων-αντισωµάτων Β λεµφοκύτταρα περιφερικού, µυελού των οστών, σπληνοκύτταρα, κλπ RNA PCR, κατασκευή βιβλιοθήκης πολλαπλασιασµός 5-10 φορές Αποµάκρυνση µη-ειδικών φάγωναντισωµάτων Αντιγόνο Επιµόλυνση βακτηρίων µε τους εκλουόµενους φάγους Παρασκευή διαλυτού Fab Xαρακτηρισµός Fab

60

61 Επιλογή των Fabs (Panning) (Εµπλουτισµός φάγων / κύκλο επιλογής) ,

62 ιαλυτή έκφραση των scfv και Fab τµηµάτων των ανοσοσφαιρινών Από την επιφάνεια των νηµατοειδών φάγων Στo περίπλασµα της E.coli V H V L Fab Fab C Η C L V H V L piii E.coli C Η C L deletion Spe I Nhe I Lac Z promoter RIBS Omp A stop RIBS pelb Gene III (aa )stopstop Light chain Heavy chain

63 Πλασµατοκύτταρο Βλαστικό κύτταρο 1, 2 Β κύτταρο Αντιγόνο 5 Αντιγόνο Μη ανασυνδυασµένα V-γονίδια Ανασυνδυασµένα V- γονίδια 3 Β κύτταρο 4 Κύτταρο µνήµης Αντιγόνο Αντιγόνο V-γονίδια 4 1 E. coli E. coli V-γονίδια σε φαγεµίδιο

64 Η Μ Ι Ο Υ Υ Ρ Γ Ι Α mab κατασκευασµένα µε τον παραδοσιακό τρόπο ανοσοποίηση µε αντιγόνο-στόχο Αποµόνωση σπληνοκυττάρων Ab εκφρασµένα στην επιφάνεια της ουράς του φάγου Επιλογή στο αντιγόνοστόχο Βιβλιοθήκες αντισωµάτων σε φάγους Αb από διαγονιδιακά ποντίκια ανοσοποίηση µε αντιγόνο-στόχο Αποµόνωση σπληνοκυττάρων Α Ρ Χ Ι Κ Ο Υ Κατασκευή υβριδωµάτων Κατασκευή υβριδωµάτων ιαλογή ιαλογή ιαλογή mab Π Ε Ρ Α Ι Τ Ε Ρ Ω Χ Ε Ι Ρ Ι Σ Μ Ο Ι ΑΠΟΤΕΛΕΣΜΑ Αποµόνωση καλύτερου mab Χιµαιρικό Αb Ανθρωποποιηµένο Ab Ανθρωποποιηµένο mab: 90-95% ανθρώπινο Χιµαιρικό mab: 60-70% ανθρώπινο H εξειδίκευση και η συγγένεια εξαρτάται από το αρχικό mab που προέρχεται από το τρωκτικό ηµιουργία ποικιλόµορφων Επιλογή στο αντιγόνοστόχο ιαλογή (εκατοντάδες) Κατασκευή επιθυµητού µορίου Πλήρως ανθρώπινο mab H εξειδίκευση, η συγγένεια και η βιολογική ενεργότητα εξαρτάται από την ελεγχόµενη διαδικασία επιλογής Αποµόνωση καλύτερου mab Περιορισµένος αριθµός τροποποιήσεων Πλήρως ανθρώπινο mab H εξειδίκευση και η συγγένεια εξαρτάται από την ανοσολογική απάντηση του διαγονιδιακού ποντικού

65 ΙΑΓΟΝΙ ΙΑΚΑ ΑΝΘΡΩΠΟΠΟΙΗΜΕΝΑ ΠΟΝΤΙΚΙΑ Τα ενδογενή γονίδια των ανοσοσφαιρινών έχουν αδρανοποιηθεί Φέρουν γονιδιακούς τόπους των ανθρώπινων γονιδίων των ανοσοσφαιρινών

66 Αποµόνωση ανθρώπινων αντισωµάτων από «ανθρωποποιηµένα» ποντίκια

67 Ιn vitro ωρίµανση συγγένειας chain shuffling 1η βιβλιοθήκη 2η βιβλιοθήκη 3η βιβλιοθήκη

68 Η in vivo διάγνωση αναπτύσσεται κυρίως µε τµήµατα αντισωµάτων scfv Γρήγορη προσέγγιση του όγκου (τo scfv 7 φορές γρηγορότερα από το Fab) Καλύτερη απεικόνιση του όγκου Γρήγορη αποµάκρυνση από τα όργανα, ιστούς Αυξηµένο ποσοστό που προσεγγίζει τον στόχο

69 Θεραπευτική προσέγγιση µε ανασυνδυασµένα αντισώµατα I. Mεταµόσχευση οργάνων, ιστών II. Προστασία έναντι ιών III. Ογκολογία IV. Aυτοάνοσα νοσήµατα

70

71 Ανοσολογικά χαρακτηριστικά της απόρριψης ΑPC Κύτταρα µοσχεύµατος CD4 ΤΗ ΤΗ CD8 ΤC ΙL-2 TNFγ κυτταροκίνες B ΙL-2 IL-4 IL-5 TNF β IFN γ Μφ Eνεργοποίηση Αντίσωµα Συµπλήρωµα ΤC Κυταροτοξικότητα µεσολαβούµενη από τα κύτταρα Κυταροτοξικότητα µεσολαβούµενη από τα κύτταρα εξαρτώµενη από αντίσωµα (ADCC) Λυτική βλάβη Αγγειακή θρόµβωση Φλεγµονώδεις διαµεσολαβητές Επιδράσεις στο µόσχευµα

72 Ανοσοκαταστολή για επιβίωση του µοσχεύµατος Mεταµόσχευση στο ζώο Εγχυση αντι-cd4 mab Mεταµόσχευση στο ζώο + έγχυση αντι-cd4 mab Πρώτη απόρριψη µοσχεύµατος Επιβίωση Αναµονή µέχρι το αντι-cd4 mab εξαφανιστεί από την κυκλοφορία Επιβίωση µοσχεύµατος Επιβίωση Χρόνος Χρόνος Mεταµόσχευση στο ζώο ξανά Mεταµόσχευση στο ζώο Mεταµόσχευση στο ζώο ξανά Επιταχυνόµενη (2η) απόρριψη µοσχεύµατος Επιβίωση Πρώτη απόρριψη µοσχεύµατος Επιβίωση Επιβίωση µοσχεύµατος Επιβίωση Χρόνος Χρόνος Χρόνος

73 ΑΝΤΙ-ΙΙΚΗ ΡΑΣΤΙΚΟΤΗΤΑ ΤΩΝ ΑΝΤΙΣΩΜΑΤΩΝ Τα εξουδετερωτικά αντισώµατα είναι σηµαντικά για προστασία µέσω εµβολίων Εξουδετερωτικά Ab (anti-env) ιός εξουδετέρωση κυτταροτοξικότητα µέσω συµπληρώµατος και φαγοκυττάρωση Κυτταρική προστασία από Ab (Πρέπει να έχουν µεγάλη συγγένεια για το αντιγόνο) Εξουδετέρωση (προκαλούνται αλλαγές στη διαµόρφωση των πρωτεϊνών του φακέλου ή καψιδίου) ADCC και φαγοκυττάρωση Mακροφάγα συµπλήρωµα

74 Εξουδετερωτικά Ab µόλυνση Μή-εξουδετερωτικά Ab Μολυσµένο ραστικοί µηχανισµοί µέσω Fc Κυτταρική σηµατοδότηση Κυτταρική λύση Αναστολή ιικής αντιγραφής κύτταρο Στερική παρεµπόδιση; Αναστολή απελευθέρωσης του ιού Μή-εξουδετερωτικά Ab Στερική παρεµπόδιση; Αναστολή µεταφοράς από κύτταρο σε κύτταρο

75 ΑΝΤΙΣΤΡΟΦΗ ΠΑΡΑΓΩΓΗ ΕΜΒΟΛΙΩΝ Τα εξουδετερωτικά αντισώµατα είναι σηµαντικά για προστασία µέσω εµβολίων Ανθρώπινα αντισώµατα Ανθρώπινα εξουδετερωτικά αντισώµατα αντιγόνο Μοριακός χαρακτηρισµός της αλληλεπίδρασης αντισώµαατοςπαθογόνου-αντιγόνου Σχεδιασµός ανοσογόνου και δοκιµασία Συνδυασµός διαφόρων ανοσογόνων = εµβόλιο

76 ΙΙ. Ογκολογία: 1. Αύξηση δραστικών λειτουργιών 2. Άµεσος οπλισµός των αντισωµάτων 3. Έµµεσος οπλισµός των αντισωµάτων 4. Προ-στόχευση

77 ΘΕΡΑΠΕΥΤΙΚΗ ΠΡΟΣΕΓΓΙΣΗ ΤΟΥ ΚΑΡΚΙΝΟΥ ΜΕ ΑΝΤΙΣΩΜΑΤΑ 1. Αύξηση δραστικών λειτουργιών ραστικό κύτταρο (ουδετερόφιλα, µακροφάγα, ΝΚ) ADCC (κυτταροτοξικότητα µέσω αντισωµάτων) Μεταλλαγές και/ή τροποποιηµένη γλυκοσυλίωση (αυξάνουν την πρόσδεση στον FcγR, C1q) Καρκινικό κύτταρο Φαγοκυττάρωση ή λύση κυττάρου MAC (σύµπλεγµα προσβολής της µεµβράνης) λύση Φαγοκυττάρωση ή λύση κυττάρου CDC (κυτταροτοξικότητα µέσω συµπληρώµατος) ραστικό κύτταρο

78 ΘΕΡΑΠΕΥΤΙΚΗ ΠΡΟΣΕΓΓΙΣΗ ΤΟΥ ΚΑΡΚΙΝΟΥ ΜΕ ΑΝΤΙΣΩΜΑΤΑ 2. Άµεσος οπλισµός των αντισωµάτων Το αντιγόνο στόχος πρέπει να εκφράζεται στα καρκινικά κύτταρα και να απουσιάζει ή να εκφράζεται σε πολύ χαµηλά επίπεδα στα φυσιολογικά κύτταρα) ΙgG Fab scfv κυτταροκίνη ανοσοκυτταροκίνη Καρκινικό κύτταρο Μικρά µόρια ή τοξίνες Τοξίνη φυτών: ricin A chain Βακτηριακή τοξίνη: Pseudomonas exotoxin Μετά την ενδοκυττάρωση το µόριο απελευθερώνεται από το αντίσωµα και ενεργοποιείται. IL-2, IL-12, GM-CSF Ραδιενεργό στοιχείο Ενεργοποίηση ανοσoδραστικών κυττάρων (Τ, Β, ΝΚ) 131 Ι, 90 yttrium, 186 rhodium, 188 rhodium: β-σωµατίδια (κυτταροτοξικά σε µεγάλη ακτίνα) 212 Bismuth, 213 Bismuth, 211 astotine): α-σωµατίδια (κυτταροτοξικά σε µικρή απόσταση, ειδικά για µικροµεταστάσεις και νεοπλάσµατα)

79 ΘΕΡΑΠΕΥΤΙΚΗ ΠΡΟΣΕΓΓΙΣΗ ΤΟΥ ΚΑΡΚΙΝΟΥ ΜΕ ΑΝΤΙΣΩΜΑΤΑ 3. Έµµεσος οπλισµός των αντισωµάτων Η απελευθέρωση χηµειοθεραπευτικών ουσιών που είναι συµπυκνωµένες σε κάψουλες σε σύγκριση µε τις ελεύθερες µειώνουν την κυτταροτοξικότητα Καρκινικό κύτταρο Τµήµα scfv Αb δύο ειδικοτήτων Ραδιενεργό στοιχείο, τοξίνη ή ανοσοδραστικό κύτταρο ανοσολιποσώµατα ΙgG PEG Fab scfv Χηµειοθεραπευτική ουσία Φωσφωλιπιδικά κυστίδια

80 ΘΕΡΑΠΕΥΤΙΚΗ ΠΡΟΣΕΓΓΙΣΗ ΤΟΥ ΚΑΡΚΙΝΟΥ ΜΕ ΑΝΤΙΣΩΜΑΤΑ 4. Προ-στόχευση Απαιτούνται 2-3 συστατικά και θεραπευτικά στάδια Μείωση συστηµατικής τοξικότητας 4-12Χ αύξηση της συγκέντρωσης στους ιστούς 5Χ µείωση της συγκέντρωσης έξω από στους ιστούς Βιοτίνη-ραδιενεργό στοιχείο Καρκινικό κύτταρο στρεπταβιδίνη 1. Το Ab στοχεύει τον όγκο 2. Αποβολή των ελεύθερων κυκλοφορούντων Ab 3. Χορήγηση ενός κυτταροτοξικού παράγοντα που συλλαµβάνεται ή ενεργοποιείται από το Ab που βρίσκεται είδη στον όγκο. Προφάρµακο scfv-ένζυµο φάρµακο ADEPT (= Ab-dependent enzyme mediated prodrug therapy) (Το προφάρµακο ενεργοποιείται µόνο µετά την επαφή µε την πρωτείνη σύντηξης ενίσχυση της κυτταροτοξικής δράσης)

81 Aνοσοθεραπεία µελανώµατος Στο µελάνωµα υπερεκφράζονται τα γλυκολιπίδια GD2 και GM2 Μελάνωµα το οποίο δεν απάντησε σε ακτινοθεραπεία Το ίδιο µελάνωµα µετά από τοπική έγχυση αντι- GD2 και αντι-gm2 Abs

82 Πλασµατική µεµβράνη (ΑΝΤΙΓΟΝΙΚΗ ΤΡΟΠΟΠΟΙΗΣΗ)

83 ΑΝΤΙΓΟΝΙΚΗ ΤΡΟΠΟΠΟΙΗΣΗ ΑΝΟΣΟΘΕΡΑΠΕΙΑ

84

Οι αντιγονικοί υποδοχείς των λεµφοκυττάρων. Η ανάπτυξη του ανοσιακού ρεπερτορίου

Οι αντιγονικοί υποδοχείς των λεµφοκυττάρων. Η ανάπτυξη του ανοσιακού ρεπερτορίου 4. Η ΑΝΑΓΝΩΡΙΣΗ ΤΟΥ ΑΝΤΙΓΟΝΟΥ: Η δοµή των αντιγονικών υποδοχέων των λεµφοκυττάρων και η ανάπτυξη του ανοσιακού ρεπερτορίου Οι αντιγονικοί υποδοχείς των λεµφοκυττάρων Αντισώµατα Αντιγονικοί υποδοχείς των

Διαβάστε περισσότερα

Αντιγόνα & Ανοσοσφαιρίνες

Αντιγόνα & Ανοσοσφαιρίνες Αντιγόνα & Ανοσοσφαιρίνες Ανοσολογικά χαρακτηριστικά των αντιγόνων I Τα αντιγόνα είναι ουσίες ικανές να επάγουν ειδική ανοσιακή απάντηση (ανοσογόνα) Ανοσογονικότητα (immunogenicity) ικανότητα επαγωγής

Διαβάστε περισσότερα

ΠΑΝΕΠΙΣΤΗΜΙΟ ΙΩΑΝΝΙΝΩΝ ΑΝΟΙΚΤΑ ΑΚΑΔΗΜΑΪΚΑ ΜΑΘΗΜΑΤΑ. Ανοσολογία. Αντιγόνα, αντισώματα Διδάσκων: Αναπληρωτής Καθηγητής Γεώργιος Θυφρονίτης

ΠΑΝΕΠΙΣΤΗΜΙΟ ΙΩΑΝΝΙΝΩΝ ΑΝΟΙΚΤΑ ΑΚΑΔΗΜΑΪΚΑ ΜΑΘΗΜΑΤΑ. Ανοσολογία. Αντιγόνα, αντισώματα Διδάσκων: Αναπληρωτής Καθηγητής Γεώργιος Θυφρονίτης ΠΑΝΕΠΙΣΤΗΜΙΟ ΙΩΑΝΝΙΝΩΝ ΑΝΟΙΚΤΑ ΑΚΑΔΗΜΑΪΚΑ ΜΑΘΗΜΑΤΑ Ανοσολογία Αντιγόνα, αντισώματα Διδάσκων: Αναπληρωτής Καθηγητής Γεώργιος Θυφρονίτης Άδειες Χρήσης Το παρόν εκπαιδευτικό υλικό υπόκειται σε άδειες χρήσης

Διαβάστε περισσότερα

ΑΝΟΣΟΠΟΙΗΤΙΚΟ ΣΥΣΤΗΜΑ ΜΟΝΟΚΛΩΝΙΚΑ ΑΝΤΙΣΩΜΑΤΑ ΕΜΒΟΛΙΑ. Εργαστήριο Γενετικής, ΓΠΑ

ΑΝΟΣΟΠΟΙΗΤΙΚΟ ΣΥΣΤΗΜΑ ΜΟΝΟΚΛΩΝΙΚΑ ΑΝΤΙΣΩΜΑΤΑ ΕΜΒΟΛΙΑ. Εργαστήριο Γενετικής, ΓΠΑ ΑΝΟΣΟΠΟΙΗΤΙΚΟ ΣΥΣΤΗΜΑ ΜΟΝΟΚΛΩΝΙΚΑ ΑΝΤΙΣΩΜΑΤΑ ΕΜΒΟΛΙΑ Στάδια μικροβιακής λοίμωξης δημιουργία αποικίας σε εξωτερική επιφάνεια διείσδυση στον οργανισμό τοπική μόλυνση συστηματική (γενικευμένη) μόλυνση H σημασία

Διαβάστε περισσότερα

οµή Ανοσιακού Συστήµατος Ελένη Φωτιάδου-Παππά Τµήµα Ανοσολογίας Γ.Ν. Νίκαιας-Πειραιά

οµή Ανοσιακού Συστήµατος Ελένη Φωτιάδου-Παππά Τµήµα Ανοσολογίας Γ.Ν. Νίκαιας-Πειραιά οµή Ανοσιακού Συστήµατος Ελένη Φωτιάδου-Παππά Τµήµα Ανοσολογίας Γ.Ν. Νίκαιας-Πειραιά Ανοσολογικό σύστηµα Βασικό σύστηµα του οργανισµού Λειτουργικές µονάδες του ανοσολογικού συστήµατος Οργανωµένος λεµφικός

Διαβάστε περισσότερα

ΑΝΟΣΟΒΙΟΛΟΓΙΑ. Εξεταστική Ιανουαρίου 2010

ΑΝΟΣΟΒΙΟΛΟΓΙΑ. Εξεταστική Ιανουαρίου 2010 Εξεταστική Ιανουαρίου 2010 Ποιες είναι οι διαφορές μιας πρωτογενούς από μια δευτερογενή χυμική ανοσολογική απόκριση; Περιγράψετε τους μηχανισμούς ενεργοποίησης στις δυο περιπτώσεις. ΘΕΜΑ 2 (1 μονάδα) Περιγράψετε

Διαβάστε περισσότερα

ΚΥΤΤΑΡΙΚΕΣ ΑΝΟΣΟΑΠΑΝΤΗΣΕΙΣ: Ενεργοποίηση των Τ κυττάρων από τους µικροοργανισµούς. Οι φάσεις των Τ κυτταρικών απαντήσεων

ΚΥΤΤΑΡΙΚΕΣ ΑΝΟΣΟΑΠΑΝΤΗΣΕΙΣ: Ενεργοποίηση των Τ κυττάρων από τους µικροοργανισµούς. Οι φάσεις των Τ κυτταρικών απαντήσεων ΚΥΤΤΑΡΙΚΕΣ ΑΝΟΣΟΑΠΑΝΤΗΣΕΙΣ: Ενεργοποίηση των Τ κυττάρων από τους µικροοργανισµούς Οι φάσεις των Τ κυτταρικών απαντήσεων Αναγνώριση του αντιγόνου και συνδιέγερση Αναγνώριση πεπτιδίων συνδεδεµένων µε το

Διαβάστε περισσότερα

ΚΕΦΑΛΑΙΟ 8 ο...2 I. Εφαρµογές της βιοτεχνολογίας στην ιατρική...2 ΕΡΩΤΗΣΕΙΣ ΠΟΛΛΑΠΛΗΣ ΕΠΙΛΟΓΗΣ...7 ΝΑ ΣΥΜΠΛΗΡΩΣΕΤΕ ΤΑ ΚΕΝΑ ΜΕ ΤΗΝ ΚΑΤΑΛΛΗΛΗ ΛΕΞΗ...

ΚΕΦΑΛΑΙΟ 8 ο...2 I. Εφαρµογές της βιοτεχνολογίας στην ιατρική...2 ΕΡΩΤΗΣΕΙΣ ΠΟΛΛΑΠΛΗΣ ΕΠΙΛΟΓΗΣ...7 ΝΑ ΣΥΜΠΛΗΡΩΣΕΤΕ ΤΑ ΚΕΝΑ ΜΕ ΤΗΝ ΚΑΤΑΛΛΗΛΗ ΛΕΞΗ... ΚΕΦΑΛΑΙΟ 8 ο ΚΕΦΑΛΑΙΟ 8 ο...2 I. Εφαρµογές της βιοτεχνολογίας στην ιατρική...2 ΕΡΩΤΗΣΕΙΣ ΠΟΛΛΑΠΛΗΣ ΕΠΙΛΟΓΗΣ...7 ΝΑ ΣΥΜΠΛΗΡΩΣΕΤΕ ΤΑ ΚΕΝΑ ΜΕ ΤΗΝ ΚΑΤΑΛΛΗΛΗ ΛΕΞΗ...10 1 ΚΕΦΑΛΑΙΟ 8 ο I. Εφαρµογές της βιοτεχνολογίας

Διαβάστε περισσότερα

Κεφ. 8. ραστικοί µηχανισµοί της χυµικής ανοσίας: Η εξάλειψη των εξωκυττάριων µικροοργανισµών και τοξινών

Κεφ. 8. ραστικοί µηχανισµοί της χυµικής ανοσίας: Η εξάλειψη των εξωκυττάριων µικροοργανισµών και τοξινών Κεφ. 8. ραστικοί µηχανισµοί της χυµικής ανοσίας: Η εξάλειψη των εξωκυττάριων µικροοργανισµών και τοξινών Οι ιδιότητες των αντισωµάτων που καθορίζουν τις δραστικές τους λειτουργίες Οι δραστικές λειτουργίες

Διαβάστε περισσότερα

7. Χυµικές ανοσοαπαντήσεις. Ενεργοποίηση των Β λεµφοκυττάρων και παραγωγή αντισωµάτων

7. Χυµικές ανοσοαπαντήσεις. Ενεργοποίηση των Β λεµφοκυττάρων και παραγωγή αντισωµάτων 7. Χυµικές ανοσοαπαντήσεις. Ενεργοποίηση των Β λεµφοκυττάρων και παραγωγή αντισωµάτων Οι φάσεις και οι τύποι των χυµικών ανοσοαπαντήσεων Η διέγερση των Β λεµφοκυττάρων από το αντιγόνο Ο ρόλος των βοηθητικών

Διαβάστε περισσότερα

Εισαγωγή στην Ανοσολογία Επίκτητη Ανοσία I. Σωτήρης Ζαρογιάννης Επίκ. Καθηγητής Φυσιολογίας Εργαστήριο Φυσιολογίας Τμήμα Ιατρικής Π.Θ.

Εισαγωγή στην Ανοσολογία Επίκτητη Ανοσία I. Σωτήρης Ζαρογιάννης Επίκ. Καθηγητής Φυσιολογίας Εργαστήριο Φυσιολογίας Τμήμα Ιατρικής Π.Θ. Εισαγωγή στην Ανοσολογία Επίκτητη Ανοσία I Σωτήρης Ζαρογιάννης Επίκ. Καθηγητής Φυσιολογίας Εργαστήριο Φυσιολογίας Τμήμα Ιατρικής Π.Θ. 14/10/2016 Φυσιολογία Συστημάτων Ακαδημαϊκό Ετος 2016-2017 Γενικά στοιχεία

Διαβάστε περισσότερα

Κεφ. 10. Ανοσοαπαντήσεις κατά όγκων και µοσχευµάτων. Ανοσία κατά µη λοιµωδών κυττάρων: µετασχηµατισµένων ή ξένων

Κεφ. 10. Ανοσοαπαντήσεις κατά όγκων και µοσχευµάτων. Ανοσία κατά µη λοιµωδών κυττάρων: µετασχηµατισµένων ή ξένων Κεφ. 10. Ανοσοαπαντήσεις κατά όγκων και µοσχευµάτων Ανοσία κατά µη λοιµωδών κυττάρων: µετασχηµατισµένων ή ξένων I. Ανοσοαπαντήσεις κατά όγκων Τα αντιγόνα των όγκων Ανοσιακοί µηχανισµοί της απόρριψης του

Διαβάστε περισσότερα

ΠΑΝΕΠΙΣΤΗΜΙΟ ΙΩΑΝΝΙΝΩΝ ΑΝΟΙΚΤΑ ΑΚΑΔΗΜΑΪΚΑ ΜΑΘΗΜΑΤΑ. Παθοφυσιολογία Ι

ΠΑΝΕΠΙΣΤΗΜΙΟ ΙΩΑΝΝΙΝΩΝ ΑΝΟΙΚΤΑ ΑΚΑΔΗΜΑΪΚΑ ΜΑΘΗΜΑΤΑ. Παθοφυσιολογία Ι ΠΑΝΕΠΙΣΤΗΜΙΟ ΙΩΑΝΝΙΝΩΝ ΑΝΟΙΚΤΑ ΑΚΑΔΗΜΑΪΚΑ ΜΑΘΗΜΑΤΑ Παθοφυσιολογία Ι Ανοσολογία - Ρευματολογία Υπεύθυνος μαθήματος: Καθηγητής Παθολογίας/Ρευματολογίας, Αλέξανδρος Α. Δρόσος Άδειες Χρήσης Το παρόν εκπαιδευτικό

Διαβάστε περισσότερα

Επίκτητη Ανοσιακή Απάντηση (χυμικό σκέλος) Β λεμφοκύτταρα

Επίκτητη Ανοσιακή Απάντηση (χυμικό σκέλος) Β λεμφοκύτταρα Επίκτητη Ανοσιακή Απάντηση (χυμικό σκέλος) Β λεμφοκύτταρα φυσική ή μη ειδική ανοσία δεν απαιτεί προηγούμενη έκθεση στο παθογόνο και δεν διαθέτει μνήμη. σε επίκτητη ή ειδική ανοσία χυμική ανοσία με παραγωγή

Διαβάστε περισσότερα

ΓΕΝΕΤΙΚΗ ΜΗΧΑΝΙΚΗ. Η τεχνολογία του ανασυνδυασμένου DNA και οι εφαρμογές της...

ΓΕΝΕΤΙΚΗ ΜΗΧΑΝΙΚΗ. Η τεχνολογία του ανασυνδυασμένου DNA και οι εφαρμογές της... ΓΕΝΕΤΙΚΗ ΜΗΧΑΝΙΚΗ Η τεχνολογία του ανασυνδυασμένου DNA και οι εφαρμογές της... Γενετική Μηχανική o Περιλαμβάνει όλες τις τεχνικές με τις οποίες μπορούμε να επεμβαίνουμε στο γενετικό υλικό των οργανισμών.

Διαβάστε περισσότερα

όλοι αναπνευστική οδός στομάχι στόμα

όλοι αναπνευστική οδός στομάχι στόμα κεράτινη στιβάδα περιέχει σμήγμα λιπαρά οξέα Μηχανισμοί που παρεμποδίζουν την είσοδο Δέρμα περιέχει ιδρώτας φυσιολογική μικροχλωρίδα λυσοζύμη γαλακτικό οξύ μικροοργανισμών Βλεννογόνοι όλοι αναπνευστική

Διαβάστε περισσότερα

Αντιγόνα & Ανοσοσφαιρίνες. Ε. Παρασκευά Αναπλ. Καθηγήτρια Κυτταρικής Φυσιολογίας, Τμήμα Ιατρικής, Παν. Θεσσαλίας

Αντιγόνα & Ανοσοσφαιρίνες. Ε. Παρασκευά Αναπλ. Καθηγήτρια Κυτταρικής Φυσιολογίας, Τμήμα Ιατρικής, Παν. Θεσσαλίας Αντιγόνα & Ανοσοσφαιρίνες Ε. Παρασκευά Αναπλ. Καθηγήτρια Κυτταρικής Φυσιολογίας, Τμήμα Ιατρικής, Παν. Θεσσαλίας 12.10.2015 Ανοσολογικά χαρακτηριστικά των αντιγόνων I Τα αντιγόνα είναι ουσίες ικανές να

Διαβάστε περισσότερα

H μοριακή βιολογία και η φαρμακολογία των μονοκλωνικών αντισωμάτων και η κλινική τους εφαρμογή στην πολλαπλή σκλήρυνση".

H μοριακή βιολογία και η φαρμακολογία των μονοκλωνικών αντισωμάτων και η κλινική τους εφαρμογή στην πολλαπλή σκλήρυνση. H μοριακή βιολογία και η φαρμακολογία των μονοκλωνικών αντισωμάτων και η κλινική τους εφαρμογή στην πολλαπλή σκλήρυνση". «Κλινική Φαρμακολογία και Θεραπευτική» 5 ος Κύκλος Επιβλέπων: Ηλιόπουλος Ιωάννης

Διαβάστε περισσότερα

Μοριακή κυτταρική βιοχημεία Ανοσοποιητικό σύστημα

Μοριακή κυτταρική βιοχημεία Ανοσοποιητικό σύστημα Μοριακή κυτταρική βιοχημεία Ανοσοποιητικό σύστημα κωδικός μαθήματος: ETY-335 Χειμερινό εξάμηνο 2014 / 2015 Μαρία Χατζηνικολαΐδου mchatzin@materials.uoc.gr Έμφυτο και προσαρμοστικό ανοσοποιητικό σύστημα

Διαβάστε περισσότερα

Βιολογία γενικής παιδείας τάξη Γ

Βιολογία γενικής παιδείας τάξη Γ Βιολογία γενικής παιδείας τάξη Γ Παραδόσεις του μαθήματος Επιμέλεια: Γιάννης Αργύρης Βιολόγος M.Sc. Καθηγητής 3 ου Γεν. Λυκ. Ηλιούπολης Κεφάλαιο 1ο Άνθρωπος και υγεία 2. Μηχανισμοί Άμυνας του Ανθρώπινου

Διαβάστε περισσότερα

ΦΡΟΝΤΙΣΤΗΡΙΑ ΠΡΟΟΠΤΙΚΗ

ΦΡΟΝΤΙΣΤΗΡΙΑ ΠΡΟΟΠΤΙΚΗ Απαντήσεις του κριτηρίου αξιολόγησης στη βιολογία γενικής παιδείας 1 ο ΚΕΦΑΛΑΙΟ ΘΕΜΑ 1 ο Να γράψετε τον αριθμό καθεμίας από τις ημιτελείς προτάσεις 1 έως και 5, και δίπλα σε αυτόν το γράμμα που αντιστοιχεί

Διαβάστε περισσότερα

Φαρµακευτική Ανοσολογία

Φαρµακευτική Ανοσολογία Φαρµακευτική Ανοσολογία 1. Εισαγωγή (κυρίως στην επίκτητη ανοσία) 2. Φυσική ανοσία ΕΠΙΚΤΗΤΗ ΑΝΟΣΙΑ ΑΝΤΙΓΟΝΟ 3. Η πρόσληψη του αντιγόνου και η παρουσίασή του στα λεµφοκύτταρα 4. Η αναγνώριση του αντιγόνου.

Διαβάστε περισσότερα

ΧΑΡΑΚΤΗΡΙΣΤΙΚΑ. Εξειδίκευση: προϊόντα (κύτταρα ή αντισώματα) ειδικά για το αντιγόνο. Μνήμη: κύτταρα

ΧΑΡΑΚΤΗΡΙΣΤΙΚΑ. Εξειδίκευση: προϊόντα (κύτταρα ή αντισώματα) ειδικά για το αντιγόνο. Μνήμη: κύτταρα ΕΙΔΙΚΗ ΑΜΥΝΑ ΧΑΡΑΚΤΗΡΙΣΤΙΚΑ Εξειδίκευση: προϊόντα (κύτταρα ή αντισώματα) ειδικά για το αντιγόνο Μνήμη: κύτταρα ΑΝΤΙΓΟΝΟ ΜΙΚΡΟΟΡΓΑΝΙΣΜΟΣ ΤΜΗΜΑ ΜΙΚΡΟΟΡΓΑΝΙΣΜΟΥ ΤΟΞΙΚΕΣ ΟΥΣΙΕΣ ΜΙΚΡΟΟΡΓΑΝΙΣΜΟΥ ΓΥΡΗ, ΦΑΡΜΑΚΕΥΤΙΚΕΣ

Διαβάστε περισσότερα

ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ Ο.Ε.Φ.Ε. 2004 ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ Γ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ

ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ Ο.Ε.Φ.Ε. 2004 ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ Γ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ Ο.Ε.Φ.Ε. 2004 ΘΕΜΑ 1 Ο Α. Να επιλέξετε την ορθή πρόταση: ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ Γ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 1. Το κωδικόνιο του mrna που κωδικοποιεί το αµινοξύ µεθειονίνη είναι α. 5 GUA

Διαβάστε περισσότερα

Ανοσιακή απάντηση (immune response)

Ανοσιακή απάντηση (immune response) Ανοσιακή απάντηση (immune response) Το σύνολο των μηχανισμών που καθιστούν τον οργανισμό ικανό να αναγνωρίζει,να εξουδετερώνει και να απομακρύνει κάθε ξένη ουσία προς αυτόν χαρακτηρίζεται ως ανοσία. Αποτέλεσμα

Διαβάστε περισσότερα

Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗ ΚΑΤΕΥΘΥΝΣΗ ΒΙΟΛΟΓΙΑ ΑΠΑΝΤΗΣΕΙΣ ÏÅÖÅ

Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗ ΚΑΤΕΥΘΥΝΣΗ ΒΙΟΛΟΓΙΑ ΑΠΑΝΤΗΣΕΙΣ ÏÅÖÅ 1 Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗ ΚΑΤΕΥΘΥΝΣΗ ΒΙΟΛΟΓΙΑ ΘΕΜΑ 1 ο 1 γ 2 δ 3 β 4 α 5 γ ΘΕΜΑ 2 ο ΑΠΑΝΤΗΣΕΙΣ Μονάδες 25 (5Χ5) Α. ιαγονιδιακά ζώα ονοµάζονται εκείνα στα οποία το γενετικό τους υλικό έχει τροποποιηθεί µε την

Διαβάστε περισσότερα

ΑΡΧΕΣ ΑΝΟΣΟΛΟΓΙΑΣ ΕΙΣΑΓΩΓΗ ΣΤΟ ΑΝΟΣΟΠΟΙΗΤΙΚΟ ΣΥΣΤΗΜΑ

ΑΡΧΕΣ ΑΝΟΣΟΛΟΓΙΑΣ ΕΙΣΑΓΩΓΗ ΣΤΟ ΑΝΟΣΟΠΟΙΗΤΙΚΟ ΣΥΣΤΗΜΑ ΑΡΧΕΣ ΑΝΟΣΟΛΟΓΙΑΣ ΕΙΣΑΓΩΓΗ ΣΤΟ ΑΝΟΣΟΠΟΙΗΤΙΚΟ ΣΥΣΤΗΜΑ Χρειάζεται η µελέτη της ανοσολογία; Εµβόλια Άµυνα κατά µικροοργανισµών Ανοσολογικές ασθένειες Αλλεργίες - υπερευαισθησίες, αυτοανοσίες, ανοσοανεπάρκειες,

Διαβάστε περισσότερα

Νικόλαος Σιαφάκας Λέκτορας Διαγνωστικής Ιολογίας Εργαστήριο Κλινικής Μικροβιολογίας ΠΓΝ «ΑΤΤΙΚΟΝ»

Νικόλαος Σιαφάκας Λέκτορας Διαγνωστικής Ιολογίας Εργαστήριο Κλινικής Μικροβιολογίας ΠΓΝ «ΑΤΤΙΚΟΝ» Νικόλαος Σιαφάκας Λέκτορας Διαγνωστικής Ιολογίας Εργαστήριο Κλινικής Μικροβιολογίας ΠΓΝ «ΑΤΤΙΚΟΝ» DNA RNA: ΑΝΤΙΓΡΑΦΗ, ΜΕΤΑΓΡΑΦΗ, ΜΕΤΑΦΡΑΣΗ DNA RNA: Βασικά Χαρακτηριστικά Ρόλος Κεντικό Δόγμα της Βιολογίας:

Διαβάστε περισσότερα

ΠΑΝΕΛΛΗΝΙΕ 2017 ΑΠΑΝΣΗΕΙ ΣΟ ΜΑΘΗΜΑ ΣΗ ΒΙΟΛΟΓΙΑ ΠΡΟΑΝΑΣΟΛΙΜΟΤ

ΠΑΝΕΛΛΗΝΙΕ 2017 ΑΠΑΝΣΗΕΙ ΣΟ ΜΑΘΗΜΑ ΣΗ ΒΙΟΛΟΓΙΑ ΠΡΟΑΝΑΣΟΛΙΜΟΤ ΠΑΝΕΛΛΗΝΙΕ 2017 ΑΠΑΝΣΗΕΙ ΣΟ ΜΑΘΗΜΑ ΣΗ ΒΙΟΛΟΓΙΑ ΠΡΟΑΝΑΣΟΛΙΜΟΤ 16/06/2017 ΕΠΙΜΕΛΕΙΑ: ΑΝΔΡΙΑΝΗ ΠΑΡΑΧΗ ΘΕΜΑ Α A1. Δ Α2. Δ Α3. Β Α4. Γ Α5.Α ΘΕΜΑ Β Β1) I A II E III Σ IV Β V Ζ VI Γ VII Δ Β2) ε προκαρυωτικό γιατί

Διαβάστε περισσότερα

Εργαλεία Μοριακής Γενετικής

Εργαλεία Μοριακής Γενετικής Εργαλεία Μοριακής Γενετικής Αρχές Μοριακής κλωνοποίησης Τα περιοριστικά ένζυμα: αναγνωρίζουν αλληλουχίες (θέσεις περιορισμού). 2 τύποι ενζύμων: -Τύπος I = Κόβουν κοντά στη θέση περιορισμού -σπάνια χρησιμοποιούνται.

Διαβάστε περισσότερα

5 Η ΠΑΡΟΥΣΙΑΣΗ. ΕΙΔΙΚΗ ΑΝΟΣΙΑ Dr.ΠΑΠΑΓΙΑΝΝΗΣ ΔΗΜΗΤΡΗΣ ΤΜΗΜΑ ΙΑΤΡΙΚΩΝ ΕΡΓΑΣΤΗΡΙΩΝ ΤΕΙ ΘΕΣΣΑΛΙΑΣ

5 Η ΠΑΡΟΥΣΙΑΣΗ. ΕΙΔΙΚΗ ΑΝΟΣΙΑ Dr.ΠΑΠΑΓΙΑΝΝΗΣ ΔΗΜΗΤΡΗΣ ΤΜΗΜΑ ΙΑΤΡΙΚΩΝ ΕΡΓΑΣΤΗΡΙΩΝ ΤΕΙ ΘΕΣΣΑΛΙΑΣ 5 Η ΠΑΡΟΥΣΙΑΣΗ ΕΙΔΙΚΗ ΑΝΟΣΙΑ Dr.ΠΑΠΑΓΙΑΝΝΗΣ ΔΗΜΗΤΡΗΣ ΤΜΗΜΑ ΙΑΤΡΙΚΩΝ ΕΡΓΑΣΤΗΡΙΩΝ ΤΕΙ ΘΕΣΣΑΛΙΑΣ ΕΙΔΙΚΗ ΑΝΟΣΙΑ Ειδική ή επίκτητη ανοσία είναι ένα σύνολο μηχανισμών με τους οποίους επιτυγχάνεται σημαντική

Διαβάστε περισσότερα

ΕΡΩΤΗΣΕΙΣ 4 Ο, 7 Ο, 8 Ο, 9 Ο ΚΕΦΑΛΑΙΩΝ

ΕΡΩΤΗΣΕΙΣ 4 Ο, 7 Ο, 8 Ο, 9 Ο ΚΕΦΑΛΑΙΩΝ ΕΡΩΤΗΣΕΙΣ 4 Ο, 7 Ο, 8 Ο, 9 Ο ΚΕΦΑΛΑΙΩΝ 1. Η μεταφορά ανθρώπινου γονιδίου σε βακτήριο δίνει διαφορετικό προϊόν μεταγραφής και μετάφρασης, ενώ σε μύκητες μεταγράφεται κανονικά αλλά το προϊόν μετάφρασης εμφανίζει

Διαβάστε περισσότερα

Ανοσοποιητικό σύστημα

Ανοσοποιητικό σύστημα Ανοσοποιητικό σύστημα κωδικός μαθήματος: ETY- 335 Χειμερινό εξάμηνο 2016 Μαρία Χατζηνικολαΐδου mchatzin@materials.uoc.gr Έμφυτο και προσαρμοστικό ανοσοποιητικό σύστημα Η ανοσία είναι η κατάσταση προστασίας

Διαβάστε περισσότερα

Θέματα Πανελλαδικών 2000-2013

Θέματα Πανελλαδικών 2000-2013 Θέματα Πανελλαδικών 2000-2013 ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΗΜΕΡΗΣΙΩΝ ΛΥΚΕΙΩΝ ΕΣΠΕΡΙΝΩΝ ΛΥΚΕΙΩΝ ΕΠΑΝΑΛΗΠΤΙΚΕΣ Κεφάλαιο 8 ΚΕΦΑΛΑΙΟ 8 ΘΕΜΑ 1 ο Γράψτε τον αριθμό καθεμιάς από τις παρακάτω προτάσεις και δίπλα το γράμμα

Διαβάστε περισσότερα

Ανοσιακή απάντηση Αικατερίνη Ταράση

Ανοσιακή απάντηση Αικατερίνη Ταράση Ανοσιακή απάντηση Αικατερίνη Ταράση ιευθύντρια Τµ. Ανοσολογίας- Ιστοσυµβατότητας Γ.Ν.Α.. " Ο Ευαγγελισµός" ανοσιακή απάντηση είναι το σύνολο των πολύπλοκων διεργασιών µε τις οποίες ο οργανισµός (ξενιστής)

Διαβάστε περισσότερα

Αντιγόνα & Ανοσοσφαιρίνες

Αντιγόνα & Ανοσοσφαιρίνες Ανοσολογικά χαρακτηριστικά των αντιγόνων Τα αντιγόνα είναι ουσίες ικανές να επάγουν ειδική ανοσιακή απάντηση (ανοσογόνα) Ανοσογονικότητα (immunogenicity) ικανότητα επαγωγής ανοσιακής απάντησης (χυµικής

Διαβάστε περισσότερα

Με την ανάπτυξη αυτής της τεχνολογίας το DNA που ήταν τόσο δύσκολο να µελετηθεί έγινε «παιχνίδι» στα ανθρώπινα χέρια

Με την ανάπτυξη αυτής της τεχνολογίας το DNA που ήταν τόσο δύσκολο να µελετηθεί έγινε «παιχνίδι» στα ανθρώπινα χέρια ΚΕΦΑΛΑΙΟ 4ο: Η τεχνολογία του ανασυνδυασµένου DNA έδωσε στον άνθρωπο την ικανότητα όχι µόνο να ερευνά αλλά και να τροποποιεί το γενετικό υλικό των οργανισµών ΤΕΧΝΟΛΟΓΙΑ ΤΟΥ ΑΝΑΣΥΝ ΥΑΣΜΕΝΟΥ DNA Η τεχνολογία

Διαβάστε περισσότερα

Εισαγωγή στην Ανοσολογία Επίκτητη Ανοσία II. Σωτήρης Ζαρογιάννης Επίκ. Καθηγητής Φυσιολογίας Εργαστήριο Φυσιολογίας Τμήμα Ιατρικής Π.Θ.

Εισαγωγή στην Ανοσολογία Επίκτητη Ανοσία II. Σωτήρης Ζαρογιάννης Επίκ. Καθηγητής Φυσιολογίας Εργαστήριο Φυσιολογίας Τμήμα Ιατρικής Π.Θ. Εισαγωγή στην Ανοσολογία Επίκτητη Ανοσία II Σωτήρης Ζαρογιάννης Επίκ. Καθηγητής Φυσιολογίας Εργαστήριο Φυσιολογίας Τμήμα Ιατρικής Π.Θ. 18/10/2016 Φυσιολογία Συστημάτων Ακαδημαϊκό Ετος 2016-2017 Γενικά

Διαβάστε περισσότερα

Kεφάλαιο 8: ΕΦΑΡΜΟΓΕΣ ΤΗΣ ΒΙΟΤΕΧΝΟΛΟΓΙΑΣ ΣΤΗΝ ΙΑΤΡΙΚΗ

Kεφάλαιο 8: ΕΦΑΡΜΟΓΕΣ ΤΗΣ ΒΙΟΤΕΧΝΟΛΟΓΙΑΣ ΣΤΗΝ ΙΑΤΡΙΚΗ Kεφάλαιο 8: ΕΦΑΡΜΟΓΕΣ ΤΗΣ ΒΙΟΤΕΧΝΟΛΟΓΙΑΣ ΣΤΗΝ ΙΑΤΡΙΚΗ -ΘΕΩΡΙΑ- Τομείς της Ιατρικής στους οποίους συνεισφέρει η Βιοτεχνολογία: Έγκαιρη διάγνωση ασθενειών (PCR και χρήση μονοκλωνικών αντισωμάτων). Πρόληψη

Διαβάστε περισσότερα

ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ - ΕΣΠΕΡΙΝΩΝ

ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ - ΕΣΠΕΡΙΝΩΝ ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ - ΕΣΠΕΡΙΝΩΝ ΠΑΝΕΛΛΗΝΙΕΣ ΕΞΕΤΑΣΕΙΣ ΤΑΞΗΣ ΕΣΠΕΡΙΝΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΚΑΙ ΕΠΑΛ (ΟΜΑ Α Β ) ΤΕΤΑΡΤΗ 18 ΜΑΪΟΥ 2011 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ: ΒΙΟΛΟΓΙΑ ΣΥΝΟΛΟ ΣΕΛΙ ΩΝ: ΠΕΝΤΕ (5) ΘΕΜΑ

Διαβάστε περισσότερα

ΚΕΦΑΛΑΙΟ 4 ΥΒΡΙ ΩΜΑΤΑ ΚΑΙ ΜΟΝΟΚΛΩΝΙΚΑ ΑΝΤΙΣΩΜΑΤΑ ΚΕΦΑΛΑΙΟ 4

ΚΕΦΑΛΑΙΟ 4 ΥΒΡΙ ΩΜΑΤΑ ΚΑΙ ΜΟΝΟΚΛΩΝΙΚΑ ΑΝΤΙΣΩΜΑΤΑ ΚΕΦΑΛΑΙΟ 4 1 ΚΕΦΑΛΑΙΟ 4 Τα αντισώματα που περιέχονται σε έναν αντιορό, σε απόκριση χορήγησης ενός αντιγόνου, είναι πολύ ετερογενή, εξαιτίας των πολλαπλών αντιγονικών καθοριστών, που επάγουν τον πολλαπλασιασμό και

Διαβάστε περισσότερα

ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΠΡΟΤΕΙΝΟΜΕΝΕΣ ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑΤΩΝ

ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΠΡΟΤΕΙΝΟΜΕΝΕΣ ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑΤΩΝ ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΗΜΕΡΟΜΗΝΙΑ ΕΞΕΤΑΣΗΣ: ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: 16 / 06 / 2017 ΒΙΟΛΟΓΙΑ ΠΡΟΣΑΝΑΤΟΛΙΣΜΟΥ ΘΕΤΙΚΩΝ ΣΠΟΥΔΩΝ ΠΡΟΤΕΙΝΟΜΕΝΕΣ ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑΤΩΝ Θέμα Α Α1: δ Α2:

Διαβάστε περισσότερα

ΚΕΦΑΛΑΙΟ 4. Βασικές αρχές της μοριακής βιολογίας. Ακαδημαϊκές Εκδόσεις 2011 Το κύτταρο-μια Μοριακή Προσέγγιση 1

ΚΕΦΑΛΑΙΟ 4. Βασικές αρχές της μοριακής βιολογίας. Ακαδημαϊκές Εκδόσεις 2011 Το κύτταρο-μια Μοριακή Προσέγγιση 1 ΚΕΦΑΛΑΙΟ 4 Βασικές αρχές της μοριακής βιολογίας Ακαδημαϊκές Εκδόσεις 2011 Το κύτταρο-μια Μοριακή Προσέγγιση 1 ΕΙΚΟΝΑ 4.4 Η μεταφορά της γενετικής πληροφορίας μέσω του DNA. Ακαδημαϊκές Εκδόσεις 2011 Το

Διαβάστε περισσότερα

ΑΠΑΝΤΗΣΕΙΣ. ΘΕΜΑ Α Α1. β Α2. β Α3. δ Α4. γ Α5. γ. ΘΕΜΑ Β Β1. Στήλη Ι Στήλη ΙΙ 1 Α 2 Γ 3 Α 4 Β 5 Α 6 Α 7 Γ

ΑΠΑΝΤΗΣΕΙΣ. ΘΕΜΑ Α Α1. β Α2. β Α3. δ Α4. γ Α5. γ. ΘΕΜΑ Β Β1. Στήλη Ι Στήλη ΙΙ 1 Α 2 Γ 3 Α 4 Β 5 Α 6 Α 7 Γ ΘΕΜΑ Α Α1. β Α2. β Α3. δ Α4. γ Α5. γ 1 ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΚΑΙ ΕΠΑΛ (ΟΜΑΔΑ Β) ΠΑΡΑΣΚΕΥΗ 27 ΜΑΪΟΥ 2016 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΠΡΟΣΑΝΑΤΟΛΙΣΜΟΥ (ΝΕΟ ΣΥΣΤΗΜΑ) ΒΙΟΛΟΓΙΑ

Διαβάστε περισσότερα

ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΠΕΜΠΤΗ 11 ΙΟΥΝΙΟΥ 2015 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ

ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΠΕΜΠΤΗ 11 ΙΟΥΝΙΟΥ 2015 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 1 ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΠΕΜΠΤΗ 11 ΙΟΥΝΙΟΥ 2015 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ Α Α1. β Α2. γ Α3. α Α4. γ Α5. δ ΘΕΜΑ Β Β1.

Διαβάστε περισσότερα

Οργάνωση των NA σε ιούς. 09/04/ Μοριακή Βιολογία Κεφ. 1 Καθηγητής Δρ. Κ. Ε. Βοργιάς

Οργάνωση των NA σε ιούς. 09/04/ Μοριακή Βιολογία Κεφ. 1 Καθηγητής Δρ. Κ. Ε. Βοργιάς Οργάνωση των NA σε ιούς 09/04/2014 1 Η οργάνωση των ιών γίνεται µε βάση το εύρος των ξενιστών που µπορούν να µολύνουν και συµπεριφέρονται σαν παράσιτα: Μόνο βακτήρια: βακτηριοφάγος ή φάγος (phage) Ζωϊκά

Διαβάστε περισσότερα

Αντιγόνο. ξένη) με μια σχετικά ισχυρή δύναμη σύνδεσης.

Αντιγόνο. ξένη) με μια σχετικά ισχυρή δύναμη σύνδεσης. Αντιγόνα Αντισώματα Αντιγόνο Ως αντιγόνο ορίζεται κάθε ουσία που προέρχεται από το εξωτερικό ή εσωτερικό περιβάλλον και είναι ικανή να αντιδράσει με τα προϊόντα της ανοσιακής απάντησης (αναγνωρίζεται από

Διαβάστε περισσότερα

ΘΕΜΑ Α Α1. γ Α2. γ Α3. α Α4. β Α5. β ΘΕΜΑ B B1. B2.

ΘΕΜΑ Α Α1. γ Α2. γ Α3. α Α4. β Α5. β ΘΕΜΑ B B1. B2. ΘΕΜΑ Α Α1. γ (το πριμόσωμα) Α2. γ (οι υποκινητές και οι μεταγραφικοί παράγοντες κάθε γονιδίου) Α3. α (μεταφέρει ένα συγκεκριμένο αμινοξύ στο ριβόσωμα) Α4. β (αποδιάταξη των δύο συμπληρωματικών αλυσίδων)

Διαβάστε περισσότερα

ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ ΤΑΞΗ

ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ ΤΑΞΗ ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ Σ ΕΣΠΕΡΙΝΟΥ ΕΝΙΑΙΟΥ ΛΥΚΕΙΟΥ ΠΑΡΑΣΚΕΥΗ 10 ΙΟΥΝΙΟΥ 2005 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ: ΒΙΟΛΟΓΙΑ ΣΥΝΟΛΟ ΣΕΛΙ ΩΝ: ΠΕΝΤΕ (5) ΘΕΜΑ 1ο Α. Για τις ημιτελείς προτάσεις

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ 8 Ο ΚΕΦΑΛΑΙΟ ΕΦΑΡΜΟΓΕΣ ΤΗΣ ΒΙΟΤΕΧΝΟΛΟΓΙΑΣ ΣΤΗΝ ΙΑΤΡΙΚΗ 5ο ΓΕΝΙΚΟ ΛΥΚΕΙΟ ΙΛΙΟΥ 1 8. Εφαρμογές της Βιοτεχνολογίας στην Ιατρική Φαρμακευτικές πρωτεΐνες Τι είναι οι φαρμακευτικές

Διαβάστε περισσότερα

Σάββατο, 25 Μαΐου 2002 Γ ΛΥΚΕΙΟΥ ΓΕΝΙΚΗ ΠΑΙ ΕΙΑ. Βιολογία

Σάββατο, 25 Μαΐου 2002 Γ ΛΥΚΕΙΟΥ ΓΕΝΙΚΗ ΠΑΙ ΕΙΑ. Βιολογία Σάββατο, 25 Μαΐου 2002 Γ ΛΥΚΕΙΟΥ ΓΕΝΙΚΗ ΠΑΙ ΕΙΑ Βιολογία ΘΕΜΑ 1 Στις ερωτήσεις 1 5, να γράψετε στο τετράδιό σας τον αριθµό της ερώτησης και δίπλα του το γράµµα που αντιστοιχεί στη σωστή απάντηση. 1. Ποιο

Διαβάστε περισσότερα

Η πρωτογενής ανοσοβιολογική απόκριση ενεργοποιείται κατά την πρώτη επαφή του οργανισμού με ένα αντιγόνο. Περιλαμβάνει τα εξής στάδια:

Η πρωτογενής ανοσοβιολογική απόκριση ενεργοποιείται κατά την πρώτη επαφή του οργανισμού με ένα αντιγόνο. Περιλαμβάνει τα εξής στάδια: Εικόνα 1.24: α) Σύνδεση αντισώματος - αντιγόνου, β) συμπληρωματικότητα αντισώματος - αντιγόνου, γ) ένα αντίσωμα συνδέεται με περισσότερα από ένα αντιγόνα. Στάδια ανοσοβιολογικής απόκρισης Η αντίδραση του

Διαβάστε περισσότερα

ΚΕΦΑΛΑΙΟ 5 ΑΝΟΣΟΑΙΜΑΤΟΛΟΓΙΑ ΑΜΕΣΗ COOMBS

ΚΕΦΑΛΑΙΟ 5 ΑΝΟΣΟΑΙΜΑΤΟΛΟΓΙΑ ΑΜΕΣΗ COOMBS ΚΕΦΑΛΑΙΟ 5 ΑΝΟΣΟΑΙΜΑΤΟΛΟΓΙΑ ΑΜΕΣΗ COOMBS ΑΜΕΣΗ COOMBS Θεμελιώδες γνώρισμα του κάθε οργανισμού είναι ότι αναγνωρίζει τα κύτταρα των άλλων οργανισμών ως ξένα Αντιδρά με σκοπό την καταστροφή ΑΝΟΣΟΑΙΜΑΤΟΛΟΓΙΑ

Διαβάστε περισσότερα

Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗ ΚΑΤΕΥΘΥΝΣΗ ΒΙΟΛΟΓΙΑ ΑΠΑΝΤΗΣΕΙΣ ÏÅÖÅ

Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗ ΚΑΤΕΥΘΥΝΣΗ ΒΙΟΛΟΓΙΑ ΑΠΑΝΤΗΣΕΙΣ ÏÅÖÅ 1 Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗ ΚΑΤΕΥΘΥΝΣΗ ΒΙΟΛΟΓΙΑ ΘΕΜΑ 1 ο Α. 1 - Γ 2 - Β 3-4 - Γ 5 - Β. 1 - Σ 2 - Λ 3 - Λ 4 - Λ 5 - Σ ΘΕΜΑ 2 ο ΑΠΑΝΤΗΣΕΙΣ 1. Κάθε είδος αντισώµατος που αναγνωρίζει έναν αντιγονικό καθοριστή παράγεται

Διαβάστε περισσότερα

σύγχρονο προπαρασκευή για Α.Ε.Ι. & Τ.Ε.Ι. & Group µαθητικό φροντιστήριο Γραβιάς 85 ΚΗΠΟΥΠΟΛΗ

σύγχρονο προπαρασκευή για Α.Ε.Ι. & Τ.Ε.Ι. & Group µαθητικό φροντιστήριο Γραβιάς 85 ΚΗΠΟΥΠΟΛΗ σύγχρονο Φάσµα & Group προπαρασκευή για Α.Ε.Ι. & Τ.Ε.Ι. µαθητικό φροντιστήριο Γραβιάς 85 ΚΗΠΟΥΠΟΛΗ 210 50 51 557 210 50 56 296 25ης Μαρτίου 111 ΠΕΤΡΟΥΠΟΛΗ 210 50 20 990 210 50 27 990 25ης Μαρτίου 74 ΠΕΤΡΟΥΠΟΛΗ

Διαβάστε περισσότερα

PCR Εφαρμογές-2. RACE Site directed mutagenesis

PCR Εφαρμογές-2. RACE Site directed mutagenesis PCR Εφαρμογές-2 RACE Site directed mutagenesis Σκοπός της αντίδρασης PCR (Polymerase Chain Reaction) είναι το να φτιάξει ένα μεγάλο αριθμό αντιγράφων. BHMATA 1. ΑΠΟΔΙΑΤΑΞΗ 2. ΥΒΡΙΔΙΣΜΟΣ 3. ΕΠΙΜΗΚΥΝΣΗ Επειδή

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΠΡΟΣΑΝΑΤΟΛΙΣΜΟΥ

ΒΙΟΛΟΓΙΑ ΠΡΟΣΑΝΑΤΟΛΙΣΜΟΥ ΕΝΔΕΙΚΤΙΚΕΣ ΑΠΑΝΤΗΣΕΙΣ ΠΑΝΕΛΛΗΝΙΩΝ 2017 ΘΕΜΑ Α Α1. δ Α2. δ Α3. β Α4. γ Α5. α ΘΕΜΑ Β Β1. Ι Α, ΙΙ Ε, ΙΙΙ ΣΤ, ΙV Β, V Ζ, VII Γ, VII Δ Β2. Η εικόνα 1 αντιστοιχεί σε προκαρυωτικό κύτταρο. Στους προκαρυωτικούς

Διαβάστε περισσότερα

ουσιών όπως τα µονοκλωνικά αντισώµατα

ουσιών όπως τα µονοκλωνικά αντισώµατα EΦΑΡΜΟΓΕΣ ΤΗΣ BIOΤΕΧΝΟΛΟΓΙΑΣ ΣΤΗΝ ΙΑΤΡΙΚΗ Η βιοτεχνολογία έχει συµβάλει 8ο ΚΕΦΑΛΑΙΟ αποτελεσµατικά σε τρεις βασικούς στόχους της Ιατρικής που είναι: 1 Η έγκαιρη ΙΑΓΝΩΣΗ µιας ασθένειας Απαιτεί την ανάπτυξη

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΠΡΟΣΑΝΑΤΟΛΙΣΜΟΥ ΘΕΤΙΚΩΝ ΣΠΟΥ ΩΝ 2017 ΑΠΑΝΤΗΣΕΙΣ ËÁÌÉÁ

ΒΙΟΛΟΓΙΑ ΠΡΟΣΑΝΑΤΟΛΙΣΜΟΥ ΘΕΤΙΚΩΝ ΣΠΟΥ ΩΝ 2017 ΑΠΑΝΤΗΣΕΙΣ ËÁÌÉÁ ΘΕΜΑ Α Α1: δ Α2: δ Α3: β Α4: γ Α5: α ΘΕΜΑ Β ΒΙΟΛΟΓΙΑ ΠΡΟΣΑΝΑΤΟΛΙΣΜΟΥ ΘΕΤΙΚΩΝ ΣΠΟΥ ΩΝ 2017 ΑΠΑΝΤΗΣΕΙΣ Β1. Ι Α, ΙΙ Ε, ΙΙΙ ΣΤ, ΙV Β, V Ζ, VII Γ, VII - Β2. Η εικόνα 1 αντιστοιχεί σε προκαρυωτικό κύτταρο. Αυτό

Διαβάστε περισσότερα

ΠΑΝΕΛΛAΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΠΡΟΣΑΝΑΤΟΛΙΣΜΟΥ ΑΠΑΝΤΗΣΕΙΣ

ΠΑΝΕΛΛAΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΠΡΟΣΑΝΑΤΟΛΙΣΜΟΥ ΑΠΑΝΤΗΣΕΙΣ ΠΑΝΕΛΛAΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΠΡΟΣΑΝΑΤΟΛΙΣΜΟΥ 16-06-2017 ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ Α Α1. δ Α2. δ Α3. β Α4. γ Α5. α ΘΕΜΑ Β Β1. Α. φωσφορική ομάδα (Ι) E. υδροξύλιο (II) Β. mrna

Διαβάστε περισσότερα

ΦΡΟΝΤΙΣΤΗΡΙΟ ΜΕΣΗΣ ΕΚΠΑΙΔΕΥΣΗΣ ΗΡΑΚΛΕΙΤΟΣ ΚΩΛΕΤΤΗ

ΦΡΟΝΤΙΣΤΗΡΙΟ ΜΕΣΗΣ ΕΚΠΑΙΔΕΥΣΗΣ ΗΡΑΚΛΕΙΤΟΣ ΚΩΛΕΤΤΗ ΠΑΝΕΛΛΗΝΙΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΠΑΡΑΣΚΕΥΗ 16 ΙΟΥΝΙΟΥ 2017 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΠΡΟΣΑΝΑΤΟΛΙΣΜΟΥ Ε Ν Δ Ε Ι Κ Τ Ι Κ Ε Σ Α Π Α Ν Τ Η Σ Ε Ι Σ Θ Ε Μ Α Τ Ω Ν ΘΕΜΑ Α Α1-δ Α2-δ Α3-β

Διαβάστε περισσότερα

Βιολογία Θετικής Κατεύθυνσης. 4 ο Κεφάλαιο - Τεχνολογία του ανασυνδυασμένου DNA

Βιολογία Θετικής Κατεύθυνσης. 4 ο Κεφάλαιο - Τεχνολογία του ανασυνδυασμένου DNA Βιολογία Θετικής Κατεύθυνσης 4 ο Κεφάλαιο - Τεχνολογία του ανασυνδυασμένου DNA Τεχνολογία ανασυνδυασμένου DNA Αναπτύχθηκε λόγω της ανακάλυψης: i. Περιοριστικών ενδονουκλεασών ii. Ειδικών φορέων DNA Έδωσε

Διαβάστε περισσότερα

ΠΑΝΕΠΙΣΤΗΜΙΟ ΙΩΑΝΝΙΝΩΝ ΑΝΟΙΚΤΑ ΑΚΑΔΗΜΑΪΚΑ ΜΑΘΗΜΑΤΑ

ΠΑΝΕΠΙΣΤΗΜΙΟ ΙΩΑΝΝΙΝΩΝ ΑΝΟΙΚΤΑ ΑΚΑΔΗΜΑΪΚΑ ΜΑΘΗΜΑΤΑ ΠΑΝΕΠΙΣΤΗΜΙΟ ΙΩΑΝΝΙΝΩΝ ΑΝΟΙΚΤΑ ΑΚΑΔΗΜΑΪΚΑ ΜΑΘΗΜΑΤΑ Φαρμακολογία ΙI Κυτταροτοξικά Διδάσκοντες: Μ. Μαρσέλος, Μ. Κωνσταντή, Π. Παππάς, Κ. Αντωνίου Άδειες Χρήσης Το παρόν εκπαιδευτικό υλικό υπόκειται σε άδειες

Διαβάστε περισσότερα

ΑΠΑΝΤΗΣΕΙΣ. ΘΕΜΑ Α Α1. β Α2. γ Α3. γ Α4. α Α5. δ

ΑΠΑΝΤΗΣΕΙΣ. ΘΕΜΑ Α Α1. β Α2. γ Α3. γ Α4. α Α5. δ ΘΕΜΑ Α Α1. β Α2. γ Α3. γ Α4. α Α5. δ 1 ΕΙΣΑΓΩΓΙΚΕΣ ΕΞΕΤΑΣΕΙΣ ΤΕΚΝΩΝ ΕΛΛΗΝΩΝ ΤΟΥ ΕΞΩΤΕΡΙΚΟΥ ΚΑΙ ΤΕΚΝΩΝ ΕΛΛΗΝΩΝ ΥΠΑΛΛΗΛΩΝ ΣΤΟ ΕΞΩΤΕΡΙΚΟ ΤΕΤΑΡΤΗ 15 ΣΕΠΤΕΜΒΡΙΟΥ 2010 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ:

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΙΑΓΩΝΙΣΜΑ Θέµα 1 ο 1. Τα άτοµα που είναι ετερόζυγα για τη β-θαλασσαιµία: α. Εµφανίζουν ήπια αναιµία β. Έχουν ευαισθησία στην ελονοσία γ. Συνθέτουν µεγάλη ποσότητα HbF δ.

Διαβάστε περισσότερα

ΘΕΜΑ Α Να επιλέξετε την φράση που συμπληρώνει ορθά κάθε μία από τις ακόλουθες προτάσεις:

ΘΕΜΑ Α Να επιλέξετε την φράση που συμπληρώνει ορθά κάθε μία από τις ακόλουθες προτάσεις: ΜΑΘΗΜΑ / ΤΑΞΗ : ΒΙΟΛΟΓΙΑ ΟΠ ΘΕΤΙΚΩΝ ΣΠΟΥΔΩΝ / Γ ΛΥΚΕΙΟΥ (ΘΕΡΙΝΑ) ΣΕΙΡΑ: ΗΜΕΡΟΜΗΝΙΑ: 15/11/2015 ΘΕΜΑ Α Να επιλέξετε την φράση που συμπληρώνει ορθά κάθε μία από τις ακόλουθες προτάσεις: 1. Δεοξυριβονουκλεοτίδια

Διαβάστε περισσότερα

Κεντρικό δόγμα της βιολογίας

Κεντρικό δόγμα της βιολογίας Κεντρικό δόγμα της βιολογίας DNA RNA Πρωτεΐνη Μεταγραφή Σύνθεση (μονόκλωνου) RNA από ένα δίκλωνο μόριο DNA κυρίως με τη βοήθεια του ενζύμου RNA πολυμεράση Το προϊόν της μεταγραφής ονομάζεται πρωτογενές

Διαβάστε περισσότερα

Θέματα Πανελλαδικών

Θέματα Πανελλαδικών Θέματα Πανελλαδικών 2000-2015 ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΗΜΕΡΗΣΙΩΝ ΛΥΚΕΙΩΝ ΕΣΠΕΡΙΝΩΝ ΛΥΚΕΙΩΝ ΕΠΑΝΑΛΗΠΤΙΚΕΣ Κεφάλαιο 8 Περιεχόμενα Περιεχόμενα 1 Κεφάλαιο 1 ο Το γενετικό υλικό Θέμα 1 ο 2 Θέμα 2 ο 8 Θέμα 3 ο 12 Θέμα

Διαβάστε περισσότερα

ΟΜΟΣΠΟΝ ΙΑ ΕΚΠΑΙ ΕΥΤΙΚΩΝ ΦΡΟΝΤΙΣΤΩΝ ΕΛΛΑ ΟΣ (Ο.Ε.Φ.Ε.) ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ 2014

ΟΜΟΣΠΟΝ ΙΑ ΕΚΠΑΙ ΕΥΤΙΚΩΝ ΦΡΟΝΤΙΣΤΩΝ ΕΛΛΑ ΟΣ (Ο.Ε.Φ.Ε.) ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ 2014 ΤΑΞΗ: ΚΑΤΕΥΘΥΝΣΗ: ΜΑΘΗΜΑ: Γ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗ ΒΙΟΛΟΓΙΑ Ηµεροµηνία: Παρασκευή 25 Απριλίου 2014 ιάρκεια Εξέτασης: 3 ώρες ΕΚΦΩΝΗΣΕΙΣ ΘΕΜΑ Α Να γράψετε στο τετράδιό σας τον αριθµό καθεµιάς από τις παρακάτω

Διαβάστε περισσότερα

ΘΕΜΑ 1 Ο ΜΑΘΗΜΑ / ΤΑΞΗ : ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ Γ ΛΥΚΕΙΟΥ ΣΕΙΡΑ: ΘΕΡΙΝΑ ΗΜΕΡΟΜΗΝΙΑ: 10/11/2013

ΘΕΜΑ 1 Ο ΜΑΘΗΜΑ / ΤΑΞΗ : ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ Γ ΛΥΚΕΙΟΥ ΣΕΙΡΑ: ΘΕΡΙΝΑ ΗΜΕΡΟΜΗΝΙΑ: 10/11/2013 ΜΑΘΗΜΑ / ΤΑΞΗ : ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ Γ ΛΥΚΕΙΟΥ ΣΕΙΡΑ: ΘΕΡΙΝΑ ΗΜΕΡΟΜΗΝΙΑ: 10/11/2013 ΘΕΜΑ 1 Ο Να επιλέξετε την φράση που συμπληρώνει ορθά κάθε μία από τις ακόλουθες προτάσεις: 1. Οι αποικοδομητές είναι:

Διαβάστε περισσότερα

ΤΕΛΟΣ 1ΗΣ ΑΠΟ 5 ΣΕΛΙ ΕΣ

ΤΕΛΟΣ 1ΗΣ ΑΠΟ 5 ΣΕΛΙ ΕΣ ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ Γ ΗΜΕΡΗΣΙΩΝ ΠΑΝΕΛΛΗΝΙΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΚΑΙ ΕΠΑΛ (ΟΜΑ Α Β ) ΤΕΤΑΡΤΗ 18 ΜΑΪΟΥ 2011 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΣΥΝΟΛΟ ΣΕΛΙ ΩΝ: ΠΕΝΤΕ (5)

Διαβάστε περισσότερα

ΕΡΩΤΗΣΕΙΣ ΣΩΣΤΟΥ - ΛΑΘΟΥΣ. ΠΟΛΛΑΠΛΗΣ ΕΠΙΛΟΓΗΣ

ΕΡΩΤΗΣΕΙΣ ΣΩΣΤΟΥ - ΛΑΘΟΥΣ. ΠΟΛΛΑΠΛΗΣ ΕΠΙΛΟΓΗΣ ΕΡΩΤΗΣΕΙΣ ΣΩΣΤΟΥ - ΛΑΘΟΥΣ. ΠΟΛΛΑΠΛΗΣ ΕΠΙΛΟΓΗΣ 1. Η πήξη του αίματος συμβάλλει στην άμυνα του οργανισμού 2. Η φαγοκυττάρωση είναι αποτελεσματική μόνο έναντι των βακτηρίων 3. Οι ιντερφερόνες δρουν άμεσα

Διαβάστε περισσότερα

ANOΣΟΓΗΡΑΝΣΗ. Ιωάννα Οικονοµίδου. Αναπληρώτρια Καθηγήτρια Ιατρικής Πανεπιστηµίου Αθηνών

ANOΣΟΓΗΡΑΝΣΗ. Ιωάννα Οικονοµίδου. Αναπληρώτρια Καθηγήτρια Ιατρικής Πανεπιστηµίου Αθηνών ANOΣΟΓΗΡΑΝΣΗ Ιωάννα Οικονοµίδου Αναπληρώτρια Καθηγήτρια Ιατρικής Πανεπιστηµίου Αθηνών Το ανοσιακό σύστηµα θεωρείται αποφασιστικός παράγοντας για την διατήρηση της υγείας και την επιβίωση στους ηλικιωµένους

Διαβάστε περισσότερα

ΑΝΟΣΟΛΟΓΙΑ ΘΕΩΡΙΑ 1 Ο ΜΑΘΗΜΑ

ΑΝΟΣΟΛΟΓΙΑ ΘΕΩΡΙΑ 1 Ο ΜΑΘΗΜΑ ΑΝΟΣΟΛΟΓΙΑ ΘΕΩΡΙΑ 1 Ο ΜΑΘΗΜΑ ΑΝΟΣΙΑ Η ανοσία (α- στερητικό + νόσος) είναι η ικανότητα ενός οργανισμού να αμύνεται ενάντια σε κάποιον εξωτερικό βλαπτικό παράγοντα και να μην υφίσταται τις συνέπειές του.

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΟΝΟΜΑΤΕΠΩΝΥΜΟ: ΤΜΗΜΑ: ΘΕΜΑ 1 Ο. 3. Το DNA των μιτοχονδρίων έχει μεγαλύτερο μήκος από αυτό των χλωροπλαστών.

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΟΝΟΜΑΤΕΠΩΝΥΜΟ: ΤΜΗΜΑ: ΘΕΜΑ 1 Ο. 3. Το DNA των μιτοχονδρίων έχει μεγαλύτερο μήκος από αυτό των χλωροπλαστών. ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΟΝΟΜΑΤΕΠΩΝΥΜΟ: ΤΜΗΜΑ: ΘΕΜΑ 1 Ο Α. Να γράψετε τον αριθμό της καθεμιάς από τις παρακάτω προτάσεις 1-5 και δίπλα του τη λέξη Σωστό, αν η πρόταση είναι σωστή, ή Λάθος, αν η πρόταση

Διαβάστε περισσότερα

ΑΛΛΗΛΕΠΙΔΡΑΣΗ ΑΝΤΙΓΟΝΟΥ/ΑΝΤΙΣΩΜΑΤΟΣ

ΑΛΛΗΛΕΠΙΔΡΑΣΗ ΑΝΤΙΓΟΝΟΥ/ΑΝΤΙΣΩΜΑΤΟΣ Β ΒΑΣΙΚΟ ΣΕΜΙΝΑΡΙΟ ΚΥΤΤΑΡΟΜΕΤΡΙΑΣ 2 ΦΕΒΡΟΥΑΡΙΟΥ 2013 ΑΜΦΙΘΕΑΤΡΟ ΤΟΥ ΓΕΝΙΚΟΥ ΚΡΑΤΙΚΟΥ ΑΘΗΝΩΝ «Γ. ΓΕΝΝΗΜΑΤΑΣ» IV Σχεδιασμός Πειραμάτων και Ανάπτυξη Δοκιμασιών ΑΛΛΗΛΕΠΙΔΡΑΣΗ ΑΝΤΙΓΟΝΟΥ/ΑΝΤΙΣΩΜΑΤΟΣ Βικεντίου

Διαβάστε περισσότερα

ÁÎÉÁ ÅÊÐÁÉÄÅÕÔÉÊÏÓ ÏÌÉËÏÓ

ÁÎÉÁ ÅÊÐÁÉÄÅÕÔÉÊÏÓ ÏÌÉËÏÓ ΘΕΜΑ Α ΒΙΟΛΟΓΙΑ ΠΡΟΣΑΝΑΤΟΛΙΣΜΟΥ (ΝΕΟ ΣΥΣΤΗΜΑ) ΚΑΤΕΥΘΥΝΣΗΣ (ΠΑΛΑΙΟ ΣΥΣΤΗΜΑ) 27 ΜΑΪΟΥ 2016 ΕΚΦΩΝΗΣΕΙΣ Να γράψετε στο τετράδιό σας τον αριθµό καθεµιάς από τις παρακάτω ηµιτελείς προτάσεις Α1 έως Α5 και, δίπλα,

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΠΡΟΣΑΝΑΤΟΛΙΣΜΟΥ ΟΜΑΔΑΣ ΥΓΕΙΑΣ & ΖΩΗΣ

ΒΙΟΛΟΓΙΑ ΠΡΟΣΑΝΑΤΟΛΙΣΜΟΥ ΟΜΑΔΑΣ ΥΓΕΙΑΣ & ΖΩΗΣ ΒΙΟΛΟΓΙΑ ΠΡΟΣΑΝΑΤΟΛΙΣΜΟΥ ΟΜΑΔΑΣ ΥΓΕΙΑΣ & ΖΩΗΣ ΘΕΜΑ Α Α1. δ Α2. δ Α3. β Α4. γ Α5. α ΘΕΜΑ Β Β1. Α. I, Β. IV, Γ. VI, Δ. VII, Ε. ΙΙ, ΣΤ. III, Ζ. V Β2. Αντιστοιχεί σε προκαρυωτικό οργανισμό. Στους προκαρυωτικούς

Διαβάστε περισσότερα

1 ο #Κεφάλαιο# 1)#Πειράματα: α)$να#περιγράψεις#το#πείραμα#των#hershey#και#chase.# Υπόδειξη:#σελ#14#σχολ.

1 ο #Κεφάλαιο# 1)#Πειράματα: α)$να#περιγράψεις#το#πείραμα#των#hershey#και#chase.# Υπόδειξη:#σελ#14#σχολ. 1 ο #Κεφάλαιο# ΤΟ ΓΕΝΕΤΙΚΟ ΥΛΙΚΟ 1)#Πειράματα: α)$να#περιγράψεις#το#πείραμα#των#hershey#και#chase.# Υπόδειξη:#σελ#14#σχολ. Παραλλαγή:#δίνονται##τα#παρακάτω#διαγράμματα#που#απεικονίζουν# τη#ραδιενέργεια#στο#εσωτερικό#των#βακτηρίων,#μετά#τη#μόλυνση#με#

Διαβάστε περισσότερα

Επιλεγόµενο µάθηµα:λευχαιµίες. Γεωργόπουλος Χρήστος Καρκατσούλης Μάριος Μπρίκος Νικήτας

Επιλεγόµενο µάθηµα:λευχαιµίες. Γεωργόπουλος Χρήστος Καρκατσούλης Μάριος Μπρίκος Νικήτας Επιλεγόµενο µάθηµα:λευχαιµίες Γεωργόπουλος Χρήστος Καρκατσούλης Μάριος Μπρίκος Νικήτας Ανοσολογία και καρκίνος Γενετικές και κυτταρικές αλλαγές που συµβαίνουν στον καρκίνο προσφέρουν στο ανοσιακό σύστηµα

Διαβάστε περισσότερα

ΥΠΟΠΛΗΘΥΣΜΟΙ Τ ΛΕΜΦΟΚΥΤΤΑΡΩΝ. Αλεξάνδρα Φλέβα Ph.D Βιολόγος Τμήμα Ανοσολογίας-Ιστοσυμβατότητας Γ.Ν. «Παπαγεωργίου»

ΥΠΟΠΛΗΘΥΣΜΟΙ Τ ΛΕΜΦΟΚΥΤΤΑΡΩΝ. Αλεξάνδρα Φλέβα Ph.D Βιολόγος Τμήμα Ανοσολογίας-Ιστοσυμβατότητας Γ.Ν. «Παπαγεωργίου» ΥΠΟΠΛΗΘΥΣΜΟΙ Τ ΛΕΜΦΟΚΥΤΤΑΡΩΝ Αλεξάνδρα Φλέβα Ph.D Βιολόγος Τμήμα Ανοσολογίας-Ιστοσυμβατότητας Γ.Ν. «Παπαγεωργίου» Η αξιοποίηση του εύρους των δυνατοτήτων της κυτταρομετρίας ροής στην Ανοσολογία προσφέρει

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ Γ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 2008

ΒΙΟΛΟΓΙΑ Γ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 2008 ΒΙΟΛΟΓΙΑ Γ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 2008 ΕΚΦΩΝΗΣΕΙΣ ΘΕΜΑ 1ο Να γράψετε στο τετράδιό σας τον αριθµό καθεµιάς από τις παρακάτω ηµιτελείς προτάσεις 1 έως 5 και δίπλα το γράµµα που αντιστοιχεί στη λέξη

Διαβάστε περισσότερα

Ποιες είναι οι ομοιότητες και οι διαφορές μεταξύ της αντιγραφής και της

Ποιες είναι οι ομοιότητες και οι διαφορές μεταξύ της αντιγραφής και της ΚΕΦ. 2 ο ΕΡΩΤΗΣΕΙΣ ΚΡΙΣΕΩΣ Ποιες είναι οι ομοιότητες και οι διαφορές μεταξύ της αντιγραφής και της μεταγραφής; Διαφορές Αντιγραφή Μεταγραφή 1. Διατηρείται και μεταβιβάζεται η 1. Μεταβιβάζεται η γενετική

Διαβάστε περισσότερα

ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Δ ΤΑΞΗΣ ΕΣΠΕΡΙΝΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΔΕΥΤΕΡΑ 23 ΙΟΥΝΙΟΥ 2014 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΑΠΑΝΤΗΣΕΙΣ

ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Δ ΤΑΞΗΣ ΕΣΠΕΡΙΝΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΔΕΥΤΕΡΑ 23 ΙΟΥΝΙΟΥ 2014 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΑΠΑΝΤΗΣΕΙΣ 1 ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Δ ΤΑΞΗΣ ΕΣΠΕΡΙΝΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΔΕΥΤΕΡΑ 23 ΙΟΥΝΙΟΥ 2014 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ Α Α1. γ Α2. β Α3. γ Α4. δ Α5. α ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ Β Β1. Σχολικό

Διαβάστε περισσότερα

ΘΕΜΑ 1 Ο ΜΑΘΗΜΑ / ΤΑΞΗ : ΑΠΑΝΤΗΣΕΙΣ ΒΙΟΛΟΓΙΑΣ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΣΕΙΡΑ: ΘΕΡΙΝΑ ΗΜΕΡΟΜΗΝΙΑ: 01/12/2013

ΘΕΜΑ 1 Ο ΜΑΘΗΜΑ / ΤΑΞΗ : ΑΠΑΝΤΗΣΕΙΣ ΒΙΟΛΟΓΙΑΣ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΣΕΙΡΑ: ΘΕΡΙΝΑ ΗΜΕΡΟΜΗΝΙΑ: 01/12/2013 ΜΑΘΗΜΑ / ΤΑΞΗ : ΑΠΑΝΤΗΣΕΙΣ ΒΙΟΛΟΓΙΑΣ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΣΕΙΡΑ: ΘΕΡΙΝΑ ΗΜΕΡΟΜΗΝΙΑ: 01/12/2013 ΘΕΜΑ 1 Ο Να επιλέξετε την φράση που συμπληρώνει ορθά κάθε μία από τις ακόλουθες προτάσεις: 1. Τα

Διαβάστε περισσότερα

Κεφ.3. Τεχνολογία ανασυνδυασμένου DNA. 1. Τι ονομάζεται ανασυνδυασμένο DNA και τι τεχνολογία ανασυνδυασμένου DNA. Ποιά η σημασία της.

Κεφ.3. Τεχνολογία ανασυνδυασμένου DNA. 1. Τι ονομάζεται ανασυνδυασμένο DNA και τι τεχνολογία ανασυνδυασμένου DNA. Ποιά η σημασία της. 1 Κεφ.3. Τεχνολογία ανασυνδυασμένου DNA 1. Τι ονομάζεται ανασυνδυασμένο DNA και τι τεχνολογία ανασυνδυασμένου DNA. Ποιά η σημασία της. Ανασυνδυασμένο DNA: είναι αυτό που προκύπτει από την συνένωση 2 τμημάτων

Διαβάστε περισσότερα

Προτεινόμενες λύσεις ΒΙΟΛΟΓΙΑ ΠΡΟΣΑΝΑΤΟΛΙΣΜΟΥ ΠΑΡΑΣΚΕΥΗ 27 ΜΑΪΟΥ 2016

Προτεινόμενες λύσεις ΒΙΟΛΟΓΙΑ ΠΡΟΣΑΝΑΤΟΛΙΣΜΟΥ ΠΑΡΑΣΚΕΥΗ 27 ΜΑΪΟΥ 2016 Πανελλήνιες 2016 Προτεινόμενες λύσεις ΒΙΟΛΟΓΙΑ ΠΡΟΣΑΝΑΤΟΛΙΣΜΟΥ ΠΑΡΑΣΚΕΥΗ 27 ΜΑΪΟΥ 2016 ΘΕΜΑ Α Α1- β Α2- β Α3- δ Α4- γ Α- γ ΘΕΜΑ Β Β1. 1- Α 2- Γ 3- Α 4- Β - Α 6- Α 7- Γ Β2. Ορισμός καρυότυπου (σελ. 24):

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ ΚΕΦΑΛΑΙΟ 1: ΑΝΘΡΩΠΟΣ ΚΑΙ ΥΓΕΙΑ

ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ ΚΕΦΑΛΑΙΟ 1: ΑΝΘΡΩΠΟΣ ΚΑΙ ΥΓΕΙΑ ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ ΚΕΦΑΛΑΙΟ 1: ΑΝΘΡΩΠΟΣ ΚΑΙ ΥΓΕΙΑ 1.3, 1.4 Μηχανισμοί άμυνας του ανθρώπινου οργανισμού, AIDS ΕΡΩΤΗΣΕΙΣ ΠΟΛΛΑΠΛΗΣ ΕΠΙΛΟΓΗΣ Να βάλετε σε κύκλο το γράμμα που αντιστοιχεί στη σωστή απάντηση:

Διαβάστε περισσότερα

Β. Σελ 60 σχολικού: «Η αποµόνωση του συνολικού έως και σελ 61 από µία cdna βιβλιοθήκη.». Γ. ι ι α α α ι α α ι α α α! " # $ % & ' ( ) ( ) ( * % + α ι α

Β. Σελ 60 σχολικού: «Η αποµόνωση του συνολικού έως και σελ 61 από µία cdna βιβλιοθήκη.». Γ. ι ι α α α ι α α ι α α α!  # $ % & ' ( ) ( ) ( * % + α ι α ! THΛ: 270727 222594 THΛ: 919113 949422 Απαντήσεις: " # $ % & ' 1=γ, 2=β, 3=γ, 4=β, 5=δ. " # $ % ( ' εδοµένα από την ανάλυση του ποσοστού των βάσεων σε µόρια DNA από διαφορετικούς οργανισµούς έδειχναν

Διαβάστε περισσότερα

ΠΑΝΕΛΛΗΝΙΕΣ Απαντήσεις Βιολογίας κατεύθυνσης (ΗΜΕΡΗΣΙΟ)

ΠΑΝΕΛΛΗΝΙΕΣ Απαντήσεις Βιολογίας κατεύθυνσης (ΗΜΕΡΗΣΙΟ) ΠΑΝΕΛΛΗΝΙΕΣ 2016 Απαντήσεις Βιολογίας κατεύθυνσης (ΗΜΕΡΗΣΙΟ) Μιχάλης Χαλικιόπουλος ΘΕΜΑ Α Α1 β Α2 β Α3 δ Α4 γ Α5 γ ΘΕΜΑ Β Β1 Β2 1 Α 2 Γ 3 Α 4 Β 5 Α 6 Α 7 Γ Τα μεταφασικά χρωμοσώματα ενός κυττάρου διαφέρουν

Διαβάστε περισσότερα

ΑΡΧΗ 1ΗΣ ΣΕΛΙΔΑΣ Γ ΗΜΕΡΗΣΙΩΝ

ΑΡΧΗ 1ΗΣ ΣΕΛΙΔΑΣ Γ ΗΜΕΡΗΣΙΩΝ ΑΡΧΗ 1ΗΣ ΣΕΛΙΔΑΣ Γ ΗΜΕΡΗΣΙΩΝ ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΔΕΥΤΕΡΑ 23 ΙΟΥΝΙΟΥ 2014 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΣΥΝΟΛΟ ΣΕΛΙΔΩΝ: ΠΕΝΤΕ (5) ΘΕΜΑ

Διαβάστε περισσότερα

ΑΡΧΗ 1ΗΣ ΣΕΛΙΔΑΣ Δ ΤΑΞΗΣ ΕΣΠΕΡΙΝΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ

ΑΡΧΗ 1ΗΣ ΣΕΛΙΔΑΣ Δ ΤΑΞΗΣ ΕΣΠΕΡΙΝΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΑΡΧΗ 1ΗΣ ΣΕΛΙΔΑΣ Δ ΤΑΞΗΣ ΕΣΠΕΡΙΝΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Δ ΤΑΞΗΣ ΕΣΠΕΡΙΝΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΔΕΥΤΕΡΑ 23 ΙΟΥΝΙΟΥ 2014 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΣΥΝΟΛΟ

Διαβάστε περισσότερα

ΕΡΩΤΗΣΕΙΣ ΚΑΤΑΝΟΗΣΗΣ

ΕΡΩΤΗΣΕΙΣ ΚΑΤΑΝΟΗΣΗΣ ΕΡΩΤΗΣΕΙΣ ΚΑΤΑΝΟΗΣΗΣ ΚΕΦΑΛΑΙΟ 2 ο 1. Με ποιο μηχανισμό αντιγράφεται το DNA σύμφωνα με τους Watson και Crick; 2. Ένα κύτταρο που περιέχει ένα μόνο χρωμόσωμα τοποθετείται σε θρεπτικό υλικό που περιέχει ραδιενεργό

Διαβάστε περισσότερα

ΠΑΝΕΠΙΣΤΗΜΙΟ ΙΩΑΝΝΙΝΩΝ ΑΝΟΙΚΤΑ ΑΚΑΔΗΜΑΪΚΑ ΜΑΘΗΜΑΤΑ. Βιοτεχνολογία. Τεχνολογία ανασυνδυασμένου DNA Διδάσκουσα: Αναπλ. Καθ. Άννα Ειρήνη Κούκκου

ΠΑΝΕΠΙΣΤΗΜΙΟ ΙΩΑΝΝΙΝΩΝ ΑΝΟΙΚΤΑ ΑΚΑΔΗΜΑΪΚΑ ΜΑΘΗΜΑΤΑ. Βιοτεχνολογία. Τεχνολογία ανασυνδυασμένου DNA Διδάσκουσα: Αναπλ. Καθ. Άννα Ειρήνη Κούκκου ΠΑΝΕΠΙΣΤΗΜΙΟ ΙΩΑΝΝΙΝΩΝ ΑΝΟΙΚΤΑ ΑΚΑΔΗΜΑΪΚΑ ΜΑΘΗΜΑΤΑ Βιοτεχνολογία Τεχνολογία ανασυνδυασμένου DNA Διδάσκουσα: Αναπλ. Καθ. Άννα Ειρήνη Κούκκου Άδειες Χρήσης Το παρόν εκπαιδευτικό υλικό υπόκειται σε άδειες

Διαβάστε περισσότερα

ΘΕΩΡΙΑ 3 η ΠΑΡΟΥΣΙΑΣΗ. ΚΥΤΤΑΡΟΚΙΝΕΣ ή ΚΥΤΤΟΚΙΝΕΣ Dr ΠΑΠΑΓΙΑΝΝΗΣ ΔΗΜΗΤΡΗΣ ΤΜΗΜΑ ΙΑΤΡΙΚΩΝ ΕΡΓΑΣΤΗΡΙΩΝ ΤΕΙ ΘΕΣΣΑΛΙΑΣ

ΘΕΩΡΙΑ 3 η ΠΑΡΟΥΣΙΑΣΗ. ΚΥΤΤΑΡΟΚΙΝΕΣ ή ΚΥΤΤΟΚΙΝΕΣ Dr ΠΑΠΑΓΙΑΝΝΗΣ ΔΗΜΗΤΡΗΣ ΤΜΗΜΑ ΙΑΤΡΙΚΩΝ ΕΡΓΑΣΤΗΡΙΩΝ ΤΕΙ ΘΕΣΣΑΛΙΑΣ ΘΕΩΡΙΑ 3 η ΠΑΡΟΥΣΙΑΣΗ ΚΥΤΤΑΡΟΚΙΝΕΣ ή ΚΥΤΤΟΚΙΝΕΣ Dr ΠΑΠΑΓΙΑΝΝΗΣ ΔΗΜΗΤΡΗΣ ΤΜΗΜΑ ΙΑΤΡΙΚΩΝ ΕΡΓΑΣΤΗΡΙΩΝ ΤΕΙ ΘΕΣΣΑΛΙΑΣ Είδαμε ότι οι ΜΗΧΑΝΙΣΜΟΙ ΜΗ ΕΙΔΙΚΗΣ ΑΝΟΣΙΑΣ είναι 1. Ανατομικοί φραγμοί - Δέρμα - Βλεννώδεις

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 11 Ιουνίου 2015 ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Απαντήσεις Θεμάτων Επαναληπτικών Πανελληνίων Εξετάσεων Ημερησίων & Εσπερινών Γενικών Λυκείων ΘΕΜΑ Α Α1. β Α2. γ Α3. α Α4. γ Α5. δ ΘΕΜΑ B Β1. 1. Β 2. Γ 3. Α

Διαβάστε περισσότερα

Βιολογία. Θετικής Κατεύθυνσης

Βιολογία. Θετικής Κατεύθυνσης Βιολογία Θετικής Κατεύθυνσης Κεφάλαιο 4ο ΤΕΧΝΟΛΟΓΊΑ ΤΟΥ ΑΝΑΣΥΝΔΥΑΣΜΈΝΟΥ DNA Γενετική Μηχανική 3 Είναι ο κλάδος της Βιολογίας που περιλαμβάνει τις τεχνικές με τις οποίες ο άνθρωπος επεμβαίνει στο γενετικό

Διαβάστε περισσότερα

ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑΤΩΝ ΒΙΟΛΟΓΙΑΣ ΚΑΤΕΥΘΥΝΣΗΣ 2016

ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑΤΩΝ ΒΙΟΛΟΓΙΑΣ ΚΑΤΕΥΘΥΝΣΗΣ 2016 ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑΤΩΝ ΒΙΟΛΟΓΙΑΣ ΚΑΤΕΥΘΥΝΣΗΣ 2016 ΘΕΜΑ Α Α1. β Α2. β Α3. δ Α4. γ Α5. γ ΘΕΜΑ Β Β1. 1. Α, 2. Γ, 3. Α, 4. Β, 5. Α, 6. Α, 7. Γ Β2. Καρυότυπος είναι η απεικόνιση των µεταφασικών χρωµοσωµάτων ενός

Διαβάστε περισσότερα

Θετικών Σπουδών. Ενδεικτικές απαντήσεις θεμάτων

Θετικών Σπουδών. Ενδεικτικές απαντήσεις θεμάτων Πανελλαδικές Εξετάσεις Ημερήσιων Γενικών Λυκείων Εξεταζόμενο μάθημα: Βιολογία Προσανατολισμού Θετικών Σπουδών Παρασκευή, 16 Ιουνίου 2017 Ενδεικτικές απαντήσεις θεμάτων Θέμα Α Α1. α) 3 CAT 5 β) 3 TAC 5

Διαβάστε περισσότερα

ΑΙΜΟΠΑΘΟΛΟΓΟΑΝΑΤΟΜΙΑ

ΑΙΜΟΠΑΘΟΛΟΓΟΑΝΑΤΟΜΙΑ ΑΙΜΟΠΑΘΟΛΟΓΟΑΝΑΤΟΜΙΑ Η συµβολή της µοριακής ανάλυσης Eλισάβετ Οικονοµάκη Βιολόγος Αιµοπαθολογοανατοµικό Εργαστήριο ΠΓΝΑ > ΜΟΡΙΑΚΕΣ ΜΕΘΟ ΟΙ (Μη µορφολογικές) Αλυσιδωτή Αντίδραση Πολυµεράσης

Διαβάστε περισσότερα