ΚΛΩΝΙΚΗ ΕΠΙΛΟΓΗ ΚΥΤΤΑΡΑ ΜΝΗΜΗΣ (ΕΠΙΒΙΩΣΗ ΕΚΑΕΤΙΕΣ)

Μέγεθος: px
Εμφάνιση ξεκινά από τη σελίδα:

Download "ΚΛΩΝΙΚΗ ΕΠΙΛΟΓΗ ΚΥΤΤΑΡΑ ΜΝΗΜΗΣ (ΕΠΙΒΙΩΣΗ ΕΚΑΕΤΙΕΣ)"

Transcript

1 ΚΛΩΝΙΚΗ ΕΠΙΛΟΓΗ ANTIΓΟΝΟ ΑΡΧΙΚΗ ΕΞΑΜΕΝΗ ΛΕΜΦΟΚΥΤΤΑΡΩΝ (ΑΝΕΞΆΡΤΗΤΗ ΑΝΤΙΓΟΝΟΥ} ΕΠΙΛΟΓΗ ΚΛΩΝΟΥ (ΠΑΡΟΥΣΙΑ ΑΝΤΙΓΟΝΟΥ) ΑΥΞΗΣΗ ΑΡΙΘΜΟΥ ΩΡΙΜΑΝΣΗ ΑΝΤΙΣΩΜΑ ΕΚΤΕΛΕΣΤΙΚΑ ΚΥΤΤΑΡΑ (ΕΠΙΒΙΩΣΗ ΜΕΡΙΚΕΣ ΜΕΡΕΣ) ΚΥΤΤΑΡΑ ΜΝΗΜΗΣ (ΕΠΙΒΙΩΣΗ ΕΚΑΕΤΙΕΣ) Το αντιγόνο επιλέγει τα κύτταρα µε την κατάλληλη εξειδίκευση και προκαλεί τον πολ/σµό τους και την παραγωγή των αντισωµάτων Προϋπόθεση λειτουργίας να υπάρχει µηχανισµός παραγωγής τεράστιου αριθµού διαφορετικών Igs απουσία δυνάµεων επιλογής

2 ΩΡΙΜΑΝΣΗ Β ΚΥΤΤΑΡΩΝ ΚΥΤΤΑΡΟ Έκφραση Ig Προγονικό αιµοποιητικό κύτταρο Όχι Mυελός των οστών Κύτταρο Λεµφικής Σειράς Μερικός ανασυνδυασµός γονιδίου βαριάς αλυσίδας Προ-προ Β κύτταρο (pro-b cell) Ολικός ανασυνδυασµός γονιδίου βαριάς αλυσίδας Προ-Β κύτταρο (pre-b cell) Ανασυνδυασµός γονιδίου ελαφριάς αλυσίδας Ανώριµο Β κύτταρο Αλλαγή στη συρραφή του RNA Ωριµο Β κύτταρο Όχι Όχι µ βαριά aλυσίδα +βοηθητική migm migm+migd

3 ΩΡΙΜΑΝΣΗ Β ΚΥΤΤΑΡΩΝ ΚΥΤΤΑΡΟ Έκφραση Ig Περιφερικά λεµφικά όργανα Ωριµο Β κύτταρο ιέγερση από αντιγόνο Ενεργοποίηση Β κυττάρου ιαφοροποίηση Πλασµατοκύτταρα που εκκρίνουν IgM Μετάπτωση τάξης migm+migd Πλασµατοκύτταρα που εκκρίνουν διάφορους ισότυπους Ig Β κύτταρα µνήµης

4 Ισότυπος Ab Υπότυποι Βαριά αλυσίδα Συγκέντρωση ορού Χρόνος Ηµιζωής (ηµέρες) Εκκρινόµενη µορφή Λειτουργία ΙgA IgA 1,2 α (1 ή 2) Μονο, δι, τριµερές Βλεννογονική ανοσία νεογνική παθητική ανοσία IgD - δ Ιχνη 3 Όχι Αντιγονικός Υποδοχέας παρθένων Β κυττάρων IgE - ε Αµεση υπερευαισθησία IgG IgG1-4 γ(1,2,3, ή 4) 13,5 23 Ωψωνινοποίηση, ADCC, νεογνική ανοσία, ενεργ. συµπληρώµατος IgM - µ 1,5 5 Αντιγονικός Υποδοχέας παρθένων Β κυττάρων, ενεργ. συµπληρώµατος

5 Αναδιάταξη των γονιδίων των ανοσοσφαιρινών: πειραµατική προσέγγιση

6 Mεταβλητότητα αµινοξέων στη µεταβλητή V περιοχή VH CH VL CL FR1 FR2 FR3 FR4 CDR1 CDR2 CDR3 FR: Framework Region = περιοχή πλαισίου CDR: Complementarity Determining region =περιοχή που καθορίζει συµπληρωµατικότητα

7 Mεταβλητότητα αµινοξέων στη µεταβλητή V περιοχή Ελαφριά αλυσίδα ss s FR1 CDR1 FR2 CDR2 FR3 CDR3 FR4 Βαριά αλυσίδα ss s FR1 CDR1 FR2 CDR2 FR3 CDR3 FR4 I II III IV V CDR1 CDR EVGLVESGGGLVGQPGGSLRLSCAASGFTFSTSAVVWVRGARGKGLEWVGWRVEGSSLTHYAVSVG L S D M A K QEA NS F DT M D K AWMK V V QVVELAF N N A G TSRT EF VG AIS D L RVLSF SG LNA NL F A I II III IV V CDR GRFTISRNDSKNTLYLQMLSLEPZBTAVYYCARVTPAAASLTFSAVWGQGTLV NR A FRQ FVQ [--] FD F I VT VVST[---] SMD P A NTG A TR GGY[---] D QA LSVT V[---] AFD

8 Τοποθέτηση των γονιδίων των ανοσοσφαιρινών στα χρωµοσώµατα ΧΡΩΜΟΣΩΜΑΤΑ Γονίδιο Ανθρωπος Ποντίκι λ ελαφριά αλυσίδα κ ελαφριά αλυσίδα 2 6 Βαριά αλυσίδα 14 12

9 ΗΜΙΟΥΡΓΙΑ ΠΟΙΚΙΛΟΤΗΤΑΣ ΑΝΤΙΣΩΜΑΤΩΝ (ΡΕΠΕΡΤΟΡΙΟ Β ΚΥΤΤΑΡΩΝ) 1. Οργάνωση των γονιδίων των ανοσοσφαιρινών 2. Σωµατικός ανασυνδυασµός Αναδιάταξη γονιδίων 3. Μεταβλητός ανασυνδυασµός (Junctional diversity) 4. Προσθήκη Ν-νουκλεοτιδικής περιοχής 5. Σωµατικές µεταλλαγές (Somatic mutations) 6. Συνδυασµός αλυσίδων

10 ΗΜΙΟΥΡΓΙΑ ΠΟΙΚΙΛΟΤΗΤΑΣ ΑΝΤΙΣΩΜΑΤΩΝ (ΡΕΠΕΡΤΟΡΙΟ Β ΚΥΤΤΑΡΩΝ) 1. Οργάνωση των γονιδίων των ανοσοσφαιρινών

11 Οργάνωση γονιδίων ανοσοσφαιρινών Γενετικός τόπος βαριών H αλυσίδων (χρωµόσωµα 14) S1 VH1 SLn VHn D JH Cµ C δ Cγ3 Cγ1 Cγ2b 5 Cγ2a Cε Cα 3 CH1 CH2 CH3 CH4 SC Γενετικός τόπος κ ελαφριών αλυσίδων (χρωµόσωµα 2) S1 V κ1 Sn Vκn J κ C κ 5 3 Γενετικός τόπος λ ελαφριών αλυσίδων (χρωµόσωµα 22) S1 Vλ1 Sn Vλn Jλ1 C λ1...jλ6 C λ6 5 3 S=πεπτίδιο οδηγός, n= ~100 V= µεταβλητό γονιδιακό τµήµα, D=γονιδιακό τµήµα ετερογένειας J= συνδετικό γονιδιακό τµήµα, C= γονιδιακό τµήµα σταθερής περιοχής

12 ΗΜΙΟΥΡΓΙΑ ΠΟΙΚΙΛΟΤΗΤΑΣ ΑΝΤΙΣΩΜΑΤΩΝ (ΡΕΠΕΡΤΟΡΙΟ Β ΚΥΤΤΑΡΩΝ) 1. Οργάνωση των γονιδίων των ανοσοσφαιρινών 2. Σωµατικός ανασυνδυασµός Αναδιάταξη γονιδίων

13 Αναδιάταξη των γονιδίων των βαριών αλυσίδων στα B κύτταρα. DNA βλαστικών κυττάρων (Stem cell) 5 S1 VH1 Sn VHn D JH CHµ... CΗα 3 D -J αναδιάταξη DNA B κυττάρων α. 5 S1 VH1 Sn VHn D JH CHµ... CΗα 3 V-DJ αναδιάταξη β. 5 S1 VH1D JH CHµ... CΗα 3 Μεταγραφή hmrna 5 S1 VH1D JH CHµ... CΗα 3 Συρραφή RNA (splicing) mrna S VH DJ Cµ AAA Μετάφραση πρωτεΐνη

14 Αναδιάταξη των γονιδίων των ελαφριών κ αλυσίδων στα Β κύτταρα S1 Vκ1 Sn Vκn J κ Cκ S1 Vκ1 Jκ V-J αναδιάταξη Cκ 3 Μεταγραφή hmrna 5 S1 Vκ1 Jκ Cκ 3 Συρραφή RNA (splicing) mrna S Vκ J πρωτεΐνη C Μετάφραση AAA

15 AΛΛΗΛΟΥΧΙΕΣ ΑΝΑΓΝΩΡΙΣΗΣ ΑΝΑΣΥΝ YΑΣΜΟΥ (Recombination Signal Sequences - RSS) 1. Nουκλεοτιδική αλληλουχία των RSSs: είναι συντηρηµένες παλίνδροµες αλληλουχίες αποτελούν θέσεις πρόσδεσης δύο υποµονάδων ανασυνδυάσης 2-στροφές στην έλικα του DNA 1-στροφή στην έλικα του DNA

16 AΛΛΗΛΟΥΧΙΕΣ ΑΝΑΓΝΩΡΙΣΗΣ ΑΝΑΣΥΝ YΑΣΜΟΥ (Recombination Signal Sequences - RSS)

17 Κανόνας 23/12 5 Vλ Jλ CACAGTG ACAAAAACC GGTTTTTGT CACTGTG 3 7-µερές 9-µερές C --- G C --- G A --- T A --- T A --- T A --- T A --- T C --- G A --- T 9-µερές 7-µερές Vλ G --- C T --- A G --- C A --- T C --- G A --- T C --- G Jλ 3

18 Mηχανισµοί V-J αναδιάταξης Eλλειπτικός Αντιστροφή V J V J V 9 9 V J J V J V J 9 V J 5 3 V J 5 3

19 Αποµόνωση κυκλικού DNA από θυµοκύτταρα στα οποία το DNA που κωδικοποιεί τις αλυσίδες του TCR υφίσταται V-D-J και V-J γονιδιακή αναδιάταξη

20 ΗΜΙΟΥΡΓΙΑ ΠΟΙΚΙΛΟΤΗΤΑΣ ΑΝΤΙΣΩΜΑΤΩΝ (ΡΕΠΕΡΤΟΡΙΟ Β ΚΥΤΤΑΡΩΝ) 1. Οργάνωση των γονιδίων των ανοσοσφαιρινών 2. Σωµατικός ανασυνδυασµός Αναδιάταξη γονιδίων 3. Μεταβλητός ανασυνδυασµός (Junctional diversity)

21 3. Μεταβλητός ανασυνδυασµός (Junctional diversity)

22 Ελλείψεις νουκλεοτιδίων στις συνδέσεις Aλληλουχία βλαστικής σειράς (germline) Vk21 C C C C C C T G G Jk1 C C C C C C T G G C C C T G G Pro-Try Αλληλουχία κατά την έκφραση C C C C C C T G G C C C C G G Pro-Arg C C C C C C T G G C C C C C G Pro-Pro C C C C C C T G G C C C C C C Pro-Pro Αλληλουχία εκτός πλαισίου ανάγνωσης C C C C C C T G G C C C C T G G V1 D J C V1 D J C Αφαίρεση νουκλεοτιδίων από νουκλεάσες

23 Παραγωγικές και µη-παραγωγικές αναδιατάξεις RSS C A C T G T G Jk G T G G A C T A G G G A G G A T G C T C C Vk C A C T G T G RSS Glu Asp Ala Thr Arg 1 G A G G A T G C G A C T A G G Παραγωγική αναδιάταξη 2 3 Glu Asp Gly Thr Arg G A G G A T G G C G A C T A G Glu Asp Trp Thr Arg G A G G A T T G G A C T A G G Μη-παραγωγική αναδιάταξη 4 5 Glu Asp Ala Asp stop G A G G A T G C G G A C T A G Glu Val Asp stop G A G G T G G A C T A G

24 Κατά τον αλληλικό αποκλεισµό στο κύτταρο εκφράζονται µόνο η µια βαριά και η µια ελαφριά αλυσίδα της ανοσοσφαιρίνης από τον ένα γονέα. Το Β κύτταρο έχει µια µόνο αντιγονική ειδικότητα.

25 Αλληλικός αποκλεισµός

26 ΗΜΙΟΥΡΓΙΑ ΠΟΙΚΙΛΟΤΗΤΑΣ ΑΝΤΙΣΩΜΑΤΩΝ (ΡΕΠΕΡΤΟΡΙΟ Β ΚΥΤΤΑΡΩΝ) 1. Οργάνωση των γονιδίων των ανοσοσφαιρινών 2. Σωµατικός ανασυνδυασµός Αναδιάταξη γονιδίων 3. Μεταβλητός ανασυνδυασµός (Junctional diversity) 4. Προσθήκη Ν-νουκλεοτιδικής περιοχής

27 Μηχανισµός Προσθήκης P- νουκλεοτιδίων

28 Μηχανισµός Προσθήκης N- νουκλεοτιδίων Ακροτελική δεοξυνουκλεοτιδυλοτρανσφεράση (ΤdΤ)

29 Περιοχή προσθήκης Ν νουκλεοτιδίων Αλληλουχία βλαστικής σειράς (germline) VH Τ C Α C C + C C A Τ G A C D H Noυκλεοτίδια Ν περιοχής Αλληλουχία κατά την έκφραση VH Τ C Α C C C C A Τ G A C D H Ser-Pro-His-Asp V1 D J C V1 D J C Προσθήκη νουκλεοτιδίων ή περιοχή Ν

30 ΗΜΙΟΥΡΓΙΑ ΠΟΙΚΙΛΟΤΗΤΑΣ ΑΝΤΙΣΩΜΑΤΩΝ (ΡΕΠΕΡΤΟΡΙΟ Β ΚΥΤΤΑΡΩΝ) 1. Οργάνωση των γονιδίων των ανοσοσφαιρινών 2. Σωµατικός ανασυνδυασµός Αναδιάταξη γονιδίων 3. Μεταβλητός ανασυνδυασµός (Junctional diversity) 4. Προσθήκη Ν-νουκλεοτιδικής περιοχής 5. Σωµατικές µεταλλαγές (Somatic mutations)

31 Σωµατικές µεταλλαγές στα V γονίδια των ανοσοσφαιρινών (Somatic mutations)

32 Σωµατικές µεταλλαγές στα V γονίδια των ανοσοσφαιρινών (Somatic mutations) Ανοσιακή απάντηση 7η µέρα Πρωτογενής VH CDR1 CDR2 CDR3 J3 J3 J3 J3 J3 J4 J4 J4 J2 VL CDR1 CDR2 CDR3 KD 10-7 M η µέρα Πρωτογενής J3 J3 J3 J J3 0.9 J4 ευτερογενής J Τριτογενής D J ιαφορετικό νουκλεοτίδιο Mεταλλαγές: Σε όλες τις βάσεις Μεταλλαγή µετάπτωσης (transition): Pu Pu, Py Py (A G, C T) Μεταλλαγή µετατροπής (transversion): Pu Py, Py Pu Eνθέσεις Ελλείψεις J4 J4 J3 <0.03 <0.03 <0.03 Μεταλλαγή που οδηγεί σε διαφορετικό αµινοξύ

33

34 ΗΜΙΟΥΡΓΙΑ ΠΟΙΚΙΛΟΤΗΤΑΣ ΑΝΤΙΣΩΜΑΤΩΝ (ΡΕΠΕΡΤΟΡΙΟ Β ΚΥΤΤΑΡΩΝ) 1. Οργάνωση των γονιδίων των ανοσοσφαιρινών 2. Σωµατικός ανασυνδυασµός Αναδιάταξη γονιδίων 3. Μεταβλητός ανασυνδυασµός (Junctional diversity) 4. Προσθήκη Ν-νουκλεοτιδικής περιοχής 5. Σωµατικές µεταλλαγές (Somatic mutations) 6. Συνδυασµός αλυσίδων

35 ΣΥΝ ΥΑΣΤΙΚΗ ΣΥΝ ΕΣΗ ΑΛΥΣΙ ΩΝ Π.χ. Εαν υπάρχουν 10 4 διαφορετικές ελαφριές αλυσίδες και 10 4 διαφορετικές βαριές αλυσίδες µπορούν να παραχθούν θεωρητικά 10 8 διαφορετικά αντισώµατα

36 ΡΕΠΕΡΤΟΡΙΟ Β ΚΥΤΤΑΡΩΝ Στο ποντίκι Ελαφριά αλυσίδα Μηχανισµός ποικιλότητας Βαριά αλυσίδα κ λ Αριθµός γονιδιακών τµηµάτων 1. Πολλαπλά γονιδιακά τµήµατα V D J Πιθανός αριθµός ανασυνδυασµών 2. Αναδιάταξη V-J και V-D-J 300 Χ 13 Χ 4 =1.6 Χ Χ 4=1.2 Χ Χ 3 = 6 3. Μεταβλητός ανασυνδυασµός Προσθήκη Ν νουκλεοτιδίων Σωµατική µεταλλαγή Συνδυαστική σύνδεση >1.6 Χ 10 4 Χ (>1.2 Χ >6) =>>1.9 Χ 10 7

37 Locations of promoters, enhancers, & silencers in mouse heavy chain, κ chain and λ light chain germline DNA. Variable gene rearrangement moves an enhancer close enough to a promoter to activate transcription from the promoter. Hence, DNA rearrangement greatly accelerates immunoglobulin gene transcription Transcription factors that are important for immunoglobulin gene expression Oct 2 B-cell specific transcription factor E2A alternatively spliced to give rise to two collaborating proteins. E2A proteins are essential for B- cell development. No B cells in E2A knock-out mice. Expression of E2A in a T-cell line results in a dramatic increase in the transcription of µ chain mrna and induction of T cells to undergo DHJH joining.

38 Proposed mechanism for class switching induced by IL-4 in rearranged immunoglobulin heavy chain genes

39 Expression of membrane & secreted forms of immunoglobulin heavy chain

40 Alternative splicing regulates production of membrane-bound versus secreted µ heavy chain

41 Μαγικές σφαίρες = αντισώµατα Ο Paul Ehrlich, στις αρχές του προηγούµενου αιώνα, διετύπωσε τη θεωρία των υποδοχέων (σήµερα γνωστοί ως αντισώµατα) που εκκρίνονται από κύτταρα του ανοσοποιητικού συστήµατος ως απάντηση σ ένα ξένο αντιγόνο.

42 CΟΟΗ ΝΗ2 οµή και λειτουργία των ανοσοσφαιρινών Fv Fab Σταθερή περιοχή V-περιοχή Πρόσδεση αντιγόνου Fv VH Fab Cγ1 ΙgG CL VL Fv Fab V περιοχή Fc Cγ3 Cγ2 Πρόσδεση συµπληρώµατος Πρόσδεση του Fc υποδοχέα C περιοχή

43 οµή V περιοχών των ανοσοσφαιρινών VH VL CL CH FR: Framework Region = περιοχή πλαισίου CDR: Complementarity Determining region = περιοχή που καθορίζει συµπληρωµατικότητα FR1 FR2 FR3 FR4 CDR1 CDR2 CDR3 ΝΗ2 V-περιοχή Σταθερή περιοχή VH VL CΟΟΗ

44 Moνοκλωνικά αντισώµατα (mabs) 1975: Köhler και Milstein τεχνολογία µονοκλωνικών αντισωµάτων (µία κυτταρική σειρά µπορεί να εκκρίνει αντισώµατα µιάς ειδικότητας, δηλαδή να αναγνωρίζει ένα συγκεκριµένο αντιγόνο) Το νεοπλασµατικό κύτταρο διαιρείται επ άπειρον αλλά δεν παράγει mabs ΣΥΝΤΗΞΗ ΥΟ ΚΥΤΤΑΡΩΝ Το Β-λεµφοκύτταρο ενός ζώου το οποίο έχει ανοσοποιηθεί µε ένα αντιγόνο παράγει το ειδικό αντίσωµα, αλλά δεν διαιρείται επ άπειρον. Το υβριδικό κύτταρο παράγει ειδικό αντίσωµα και διαιρείται επ άπειρον.

45 Χρήση µονοκλωνικών αντισωµάτων Βιοµηχανία: Μαζική παραγωγή αντισωµάτων Ερευνα: Λειτουργική ανάλυση µορίων (βιοχηµική και µικροσκοπική ανίχνευση και αποµόνωση, διερέυνηση λειτουργίας) Αναγνώριση µεµβρανικών δεικτών (χαρακτηρισµός συγκεκριµένων κυττάρων κλπ) ιαγνωστική και Θεραπευτική Ιατρική: Ανοσοδιάγνωση (λοιµωδών ή συστηµατικών νοσηµάτων µε προσδιορισµό ειδικών αντιγόνων ή αντισωµάτων, διαγνωστική απεικόνιση όγκων, κλπ) Ανοσοθεραπεία (θεραπεία όγκων, µεταµόσχευση οργάνων, εµβόλια κλπ)

46 Προβλήµατα από τη χρήση µονοκλωνικών αντισωµάτων στην ιατρική Ευαισθητοποίηση του οργανισµού µετά την in vivo χορήγηγη ξενογενών µονοκλωνικών αντισωµάτων υσκολία δηµιουργίας φυσικής αλληλεπίδρασης µεταξύ του αντισώµατος και του αντιγόνου στόχου Αλλαγή στη δοµή του αντιγόνου Χαµηλή συγγένεια Μη ικανοποιητικός ισότυπος Μη ικανοποιητικός χρόνος ηµιζωής Μικρή παραγωγή Υψηλό οικονοµικό κόστος

47 Aνάγκη κατασκευής ανασυνδυασµένων αντισωµάτων ή τµηµάτων αντισωµάτων ΓΕΝΕΤΙΚΗ ΜΗΧΑΝΙΚΗ Κατασκευή ανοσοσυµβατών αντισωµάτων Αλλαγή χρόνου ηµιζωής Αλλαγή ισοτύπου Aύξηση συγγένειας και ειδικότητας Kατασκευή αντισωµάτων µε δύο ειδικότητες Kατασκευή µορίων που έχουν και άλλες ιδιότητες Αλλαγή λειτουργικότητας Eύκολη, γρήγορη, µαζική παραγωγή Χαµηλότερο οικονοµικό κόστος

48 Τροποποιηµένα αντισώµατα Υβρίδωµα από ποντίκι In vitro βιβλιοθήκες αντισωµάτων ιαγονιδιακά ποντίκια Ανθρώπινα Υβριδώµατα ποντικίσιο χιµαιρικό ανθρωποποιηµένο ανθρώπινο Γενετική µηχανική Κλωνοποίηση V γονιδίων Mεταµόσχευση CDR τµηµάτων Ευκαρυωτική έκφραση

49 Κατασκευή χιµαιρικών αντισωµάτων

50 Κατασκευή χιµαιρικών και υβριδικών µονοκλωνικών αντισωµάτων µε τεχνικές ανασυνδυασµένου DNA

51 Aνθρωποποιηµένa αντισώµατα Ab ποντικού Ab ανθρώπου Fv Ab χίµαιρα CDRs Ab ανθρωποποιηµένο

52 Ανασυνδυασµένα τµήµατα αντισωµάτων NH 2 NH 2 NH 2 NH 2 NH 2 NH 2 VL VH VH VL VL VH VL VH VL VH VH VL CL CH1 CH1 CL CL CH1 COOH COOH COOH COOH -S-S- H H -S-S- -S-S- -S-S- -S-S- COOH COOH Fv scfv (single chain Fv) CH2 CH2 Fab CH3 CH3 VH VL IgG VL VH CH1 CL VL VH

53 Νεότερες τεχνολογίες Fv τµηµάτων Γονίδια Μορφή scfv Triabody Diabody

54 Εκφραση των scfv και Fab τµηµάτων των αντισωµάτων στην επιφάνεια νηµατοειδών φάγων. V H V L scfv V H V L Fab C Η C L piii piii

55 Μολυσµατικός κύκλος νηµατοειδών φάγων. ιοσωµάτιο piii Εισβαλόµενο ιοσωµάτιο Εκβαλόµενο ιοσωµάτιο pviii pvi περίπλασµα κυτταρόπλασµα pv-ssdna pvii pix + κλώνος pii, px pii, px + κλώνος pv RF

56 ιαλυτή έκφραση τµηµάτων αντισώµατος σε E. coli (µερική λύση της κυτταροπλασµατικής µεµβράνης) periplasm VL CH1 VH CL N pelb C N pelb VH CH1 VL CL Coat protein III C phen1 amp R

57 Κατασκευή scfv τµήµατος του αντισώµατος υβρίδωµα mrna AAA RT µε ειδικά Ig εναρκτήρια µόρια cdna AAA PCR µε ειδικά Ig εναρκτήρια µόρια VH VL VH VL scfv Linker Εισαγωγή περιοριστικών θέσεων lacz pelb scfv φαγεµίδιο piii ιαλυτή έκφραση στο υπερκείµενο της καλλιέργειας

58 Kατασκευή Fab βιβλιοθήκης φάγων από Β λεµφοκύτταρα B λεµφοκύτταρα B κύτταρα Αποµόνωση RNA Σύνθεση cdna RT µε ειδικά Ig εναρκτήρια µόρια cdna AAA AAA mrna Ενζυµική ενίσχυση (PCR) PCR µε ειδικά Ig εναρκτήρια µόρια VH-CH1 VL-CL Προσθήκη περιοριστικών θέσεων Κλωνοποίηση στο φαγεµίδιο pcomb3h VH-CH1 VL-CL lacz pelb VH-CH1 lacz pelb VL-CL piii Φαγεµίδιο pcomb3h Πολυπλοκότητα βιβλιοθηκών Βιβλιοθήκη: 1-5X10 7 cfu/µg DNA Στάδια PCR: 2 Εναρκτήρια µόρια PCR: 26 Συνδέσεις: 2 Αποµόνωση των ειδικών φάγων - αντισωµάτων µε panning

59 Στρατηγική κλωνοποίησης ανθρώπινων µoνοκλωνικών τµηµάτων αντισωµάτων από βιβλιοθήκες φάγων-αντισωµάτων Β λεµφοκύτταρα περιφερικού, µυελού των οστών, σπληνοκύτταρα, κλπ RNA PCR, κατασκευή βιβλιοθήκης πολλαπλασιασµός 5-10 φορές Αποµάκρυνση µη-ειδικών φάγωναντισωµάτων Αντιγόνο Επιµόλυνση βακτηρίων µε τους εκλουόµενους φάγους Παρασκευή διαλυτού Fab Xαρακτηρισµός Fab

60

61 Επιλογή των Fabs (Panning) (Εµπλουτισµός φάγων / κύκλο επιλογής) ,

62 ιαλυτή έκφραση των scfv και Fab τµηµάτων των ανοσοσφαιρινών Από την επιφάνεια των νηµατοειδών φάγων Στo περίπλασµα της E.coli V H V L Fab Fab C Η C L V H V L piii E.coli C Η C L deletion Spe I Nhe I Lac Z promoter RIBS Omp A stop RIBS pelb Gene III (aa )stopstop Light chain Heavy chain

63 Πλασµατοκύτταρο Βλαστικό κύτταρο 1, 2 Β κύτταρο Αντιγόνο 5 Αντιγόνο Μη ανασυνδυασµένα V-γονίδια Ανασυνδυασµένα V- γονίδια 3 Β κύτταρο 4 Κύτταρο µνήµης Αντιγόνο Αντιγόνο V-γονίδια 4 1 E. coli E. coli V-γονίδια σε φαγεµίδιο

64 Η Μ Ι Ο Υ Υ Ρ Γ Ι Α mab κατασκευασµένα µε τον παραδοσιακό τρόπο ανοσοποίηση µε αντιγόνο-στόχο Αποµόνωση σπληνοκυττάρων Ab εκφρασµένα στην επιφάνεια της ουράς του φάγου Επιλογή στο αντιγόνοστόχο Βιβλιοθήκες αντισωµάτων σε φάγους Αb από διαγονιδιακά ποντίκια ανοσοποίηση µε αντιγόνο-στόχο Αποµόνωση σπληνοκυττάρων Α Ρ Χ Ι Κ Ο Υ Κατασκευή υβριδωµάτων Κατασκευή υβριδωµάτων ιαλογή ιαλογή ιαλογή mab Π Ε Ρ Α Ι Τ Ε Ρ Ω Χ Ε Ι Ρ Ι Σ Μ Ο Ι ΑΠΟΤΕΛΕΣΜΑ Αποµόνωση καλύτερου mab Χιµαιρικό Αb Ανθρωποποιηµένο Ab Ανθρωποποιηµένο mab: 90-95% ανθρώπινο Χιµαιρικό mab: 60-70% ανθρώπινο H εξειδίκευση και η συγγένεια εξαρτάται από το αρχικό mab που προέρχεται από το τρωκτικό ηµιουργία ποικιλόµορφων Επιλογή στο αντιγόνοστόχο ιαλογή (εκατοντάδες) Κατασκευή επιθυµητού µορίου Πλήρως ανθρώπινο mab H εξειδίκευση, η συγγένεια και η βιολογική ενεργότητα εξαρτάται από την ελεγχόµενη διαδικασία επιλογής Αποµόνωση καλύτερου mab Περιορισµένος αριθµός τροποποιήσεων Πλήρως ανθρώπινο mab H εξειδίκευση και η συγγένεια εξαρτάται από την ανοσολογική απάντηση του διαγονιδιακού ποντικού

65 ΙΑΓΟΝΙ ΙΑΚΑ ΑΝΘΡΩΠΟΠΟΙΗΜΕΝΑ ΠΟΝΤΙΚΙΑ Τα ενδογενή γονίδια των ανοσοσφαιρινών έχουν αδρανοποιηθεί Φέρουν γονιδιακούς τόπους των ανθρώπινων γονιδίων των ανοσοσφαιρινών

66 Αποµόνωση ανθρώπινων αντισωµάτων από «ανθρωποποιηµένα» ποντίκια

67 Ιn vitro ωρίµανση συγγένειας chain shuffling 1η βιβλιοθήκη 2η βιβλιοθήκη 3η βιβλιοθήκη

68 Η in vivo διάγνωση αναπτύσσεται κυρίως µε τµήµατα αντισωµάτων scfv Γρήγορη προσέγγιση του όγκου (τo scfv 7 φορές γρηγορότερα από το Fab) Καλύτερη απεικόνιση του όγκου Γρήγορη αποµάκρυνση από τα όργανα, ιστούς Αυξηµένο ποσοστό που προσεγγίζει τον στόχο

69 Θεραπευτική προσέγγιση µε ανασυνδυασµένα αντισώµατα I. Mεταµόσχευση οργάνων, ιστών II. Προστασία έναντι ιών III. Ογκολογία IV. Aυτοάνοσα νοσήµατα

70

71 Ανοσολογικά χαρακτηριστικά της απόρριψης ΑPC Κύτταρα µοσχεύµατος CD4 ΤΗ ΤΗ CD8 ΤC ΙL-2 TNFγ κυτταροκίνες B ΙL-2 IL-4 IL-5 TNF β IFN γ Μφ Eνεργοποίηση Αντίσωµα Συµπλήρωµα ΤC Κυταροτοξικότητα µεσολαβούµενη από τα κύτταρα Κυταροτοξικότητα µεσολαβούµενη από τα κύτταρα εξαρτώµενη από αντίσωµα (ADCC) Λυτική βλάβη Αγγειακή θρόµβωση Φλεγµονώδεις διαµεσολαβητές Επιδράσεις στο µόσχευµα

72 Ανοσοκαταστολή για επιβίωση του µοσχεύµατος Mεταµόσχευση στο ζώο Εγχυση αντι-cd4 mab Mεταµόσχευση στο ζώο + έγχυση αντι-cd4 mab Πρώτη απόρριψη µοσχεύµατος Επιβίωση Αναµονή µέχρι το αντι-cd4 mab εξαφανιστεί από την κυκλοφορία Επιβίωση µοσχεύµατος Επιβίωση Χρόνος Χρόνος Mεταµόσχευση στο ζώο ξανά Mεταµόσχευση στο ζώο Mεταµόσχευση στο ζώο ξανά Επιταχυνόµενη (2η) απόρριψη µοσχεύµατος Επιβίωση Πρώτη απόρριψη µοσχεύµατος Επιβίωση Επιβίωση µοσχεύµατος Επιβίωση Χρόνος Χρόνος Χρόνος

73 ΑΝΤΙ-ΙΙΚΗ ΡΑΣΤΙΚΟΤΗΤΑ ΤΩΝ ΑΝΤΙΣΩΜΑΤΩΝ Τα εξουδετερωτικά αντισώµατα είναι σηµαντικά για προστασία µέσω εµβολίων Εξουδετερωτικά Ab (anti-env) ιός εξουδετέρωση κυτταροτοξικότητα µέσω συµπληρώµατος και φαγοκυττάρωση Κυτταρική προστασία από Ab (Πρέπει να έχουν µεγάλη συγγένεια για το αντιγόνο) Εξουδετέρωση (προκαλούνται αλλαγές στη διαµόρφωση των πρωτεϊνών του φακέλου ή καψιδίου) ADCC και φαγοκυττάρωση Mακροφάγα συµπλήρωµα

74 Εξουδετερωτικά Ab µόλυνση Μή-εξουδετερωτικά Ab Μολυσµένο ραστικοί µηχανισµοί µέσω Fc Κυτταρική σηµατοδότηση Κυτταρική λύση Αναστολή ιικής αντιγραφής κύτταρο Στερική παρεµπόδιση; Αναστολή απελευθέρωσης του ιού Μή-εξουδετερωτικά Ab Στερική παρεµπόδιση; Αναστολή µεταφοράς από κύτταρο σε κύτταρο

75 ΑΝΤΙΣΤΡΟΦΗ ΠΑΡΑΓΩΓΗ ΕΜΒΟΛΙΩΝ Τα εξουδετερωτικά αντισώµατα είναι σηµαντικά για προστασία µέσω εµβολίων Ανθρώπινα αντισώµατα Ανθρώπινα εξουδετερωτικά αντισώµατα αντιγόνο Μοριακός χαρακτηρισµός της αλληλεπίδρασης αντισώµαατοςπαθογόνου-αντιγόνου Σχεδιασµός ανοσογόνου και δοκιµασία Συνδυασµός διαφόρων ανοσογόνων = εµβόλιο

76 ΙΙ. Ογκολογία: 1. Αύξηση δραστικών λειτουργιών 2. Άµεσος οπλισµός των αντισωµάτων 3. Έµµεσος οπλισµός των αντισωµάτων 4. Προ-στόχευση

77 ΘΕΡΑΠΕΥΤΙΚΗ ΠΡΟΣΕΓΓΙΣΗ ΤΟΥ ΚΑΡΚΙΝΟΥ ΜΕ ΑΝΤΙΣΩΜΑΤΑ 1. Αύξηση δραστικών λειτουργιών ραστικό κύτταρο (ουδετερόφιλα, µακροφάγα, ΝΚ) ADCC (κυτταροτοξικότητα µέσω αντισωµάτων) Μεταλλαγές και/ή τροποποιηµένη γλυκοσυλίωση (αυξάνουν την πρόσδεση στον FcγR, C1q) Καρκινικό κύτταρο Φαγοκυττάρωση ή λύση κυττάρου MAC (σύµπλεγµα προσβολής της µεµβράνης) λύση Φαγοκυττάρωση ή λύση κυττάρου CDC (κυτταροτοξικότητα µέσω συµπληρώµατος) ραστικό κύτταρο

78 ΘΕΡΑΠΕΥΤΙΚΗ ΠΡΟΣΕΓΓΙΣΗ ΤΟΥ ΚΑΡΚΙΝΟΥ ΜΕ ΑΝΤΙΣΩΜΑΤΑ 2. Άµεσος οπλισµός των αντισωµάτων Το αντιγόνο στόχος πρέπει να εκφράζεται στα καρκινικά κύτταρα και να απουσιάζει ή να εκφράζεται σε πολύ χαµηλά επίπεδα στα φυσιολογικά κύτταρα) ΙgG Fab scfv κυτταροκίνη ανοσοκυτταροκίνη Καρκινικό κύτταρο Μικρά µόρια ή τοξίνες Τοξίνη φυτών: ricin A chain Βακτηριακή τοξίνη: Pseudomonas exotoxin Μετά την ενδοκυττάρωση το µόριο απελευθερώνεται από το αντίσωµα και ενεργοποιείται. IL-2, IL-12, GM-CSF Ραδιενεργό στοιχείο Ενεργοποίηση ανοσoδραστικών κυττάρων (Τ, Β, ΝΚ) 131 Ι, 90 yttrium, 186 rhodium, 188 rhodium: β-σωµατίδια (κυτταροτοξικά σε µεγάλη ακτίνα) 212 Bismuth, 213 Bismuth, 211 astotine): α-σωµατίδια (κυτταροτοξικά σε µικρή απόσταση, ειδικά για µικροµεταστάσεις και νεοπλάσµατα)

79 ΘΕΡΑΠΕΥΤΙΚΗ ΠΡΟΣΕΓΓΙΣΗ ΤΟΥ ΚΑΡΚΙΝΟΥ ΜΕ ΑΝΤΙΣΩΜΑΤΑ 3. Έµµεσος οπλισµός των αντισωµάτων Η απελευθέρωση χηµειοθεραπευτικών ουσιών που είναι συµπυκνωµένες σε κάψουλες σε σύγκριση µε τις ελεύθερες µειώνουν την κυτταροτοξικότητα Καρκινικό κύτταρο Τµήµα scfv Αb δύο ειδικοτήτων Ραδιενεργό στοιχείο, τοξίνη ή ανοσοδραστικό κύτταρο ανοσολιποσώµατα ΙgG PEG Fab scfv Χηµειοθεραπευτική ουσία Φωσφωλιπιδικά κυστίδια

80 ΘΕΡΑΠΕΥΤΙΚΗ ΠΡΟΣΕΓΓΙΣΗ ΤΟΥ ΚΑΡΚΙΝΟΥ ΜΕ ΑΝΤΙΣΩΜΑΤΑ 4. Προ-στόχευση Απαιτούνται 2-3 συστατικά και θεραπευτικά στάδια Μείωση συστηµατικής τοξικότητας 4-12Χ αύξηση της συγκέντρωσης στους ιστούς 5Χ µείωση της συγκέντρωσης έξω από στους ιστούς Βιοτίνη-ραδιενεργό στοιχείο Καρκινικό κύτταρο στρεπταβιδίνη 1. Το Ab στοχεύει τον όγκο 2. Αποβολή των ελεύθερων κυκλοφορούντων Ab 3. Χορήγηση ενός κυτταροτοξικού παράγοντα που συλλαµβάνεται ή ενεργοποιείται από το Ab που βρίσκεται είδη στον όγκο. Προφάρµακο scfv-ένζυµο φάρµακο ADEPT (= Ab-dependent enzyme mediated prodrug therapy) (Το προφάρµακο ενεργοποιείται µόνο µετά την επαφή µε την πρωτείνη σύντηξης ενίσχυση της κυτταροτοξικής δράσης)

81 Aνοσοθεραπεία µελανώµατος Στο µελάνωµα υπερεκφράζονται τα γλυκολιπίδια GD2 και GM2 Μελάνωµα το οποίο δεν απάντησε σε ακτινοθεραπεία Το ίδιο µελάνωµα µετά από τοπική έγχυση αντι- GD2 και αντι-gm2 Abs

82 Πλασµατική µεµβράνη (ΑΝΤΙΓΟΝΙΚΗ ΤΡΟΠΟΠΟΙΗΣΗ)

83 ΑΝΤΙΓΟΝΙΚΗ ΤΡΟΠΟΠΟΙΗΣΗ ΑΝΟΣΟΘΕΡΑΠΕΙΑ

84

Αντιγόνα & Ανοσοσφαιρίνες

Αντιγόνα & Ανοσοσφαιρίνες Αντιγόνα & Ανοσοσφαιρίνες Ανοσολογικά χαρακτηριστικά των αντιγόνων I Τα αντιγόνα είναι ουσίες ικανές να επάγουν ειδική ανοσιακή απάντηση (ανοσογόνα) Ανοσογονικότητα (immunogenicity) ικανότητα επαγωγής

Διαβάστε περισσότερα

Επίκτητη Ανοσιακή Απάντηση (χυμικό σκέλος) Β λεμφοκύτταρα

Επίκτητη Ανοσιακή Απάντηση (χυμικό σκέλος) Β λεμφοκύτταρα Επίκτητη Ανοσιακή Απάντηση (χυμικό σκέλος) Β λεμφοκύτταρα φυσική ή μη ειδική ανοσία δεν απαιτεί προηγούμενη έκθεση στο παθογόνο και δεν διαθέτει μνήμη. σε επίκτητη ή ειδική ανοσία χυμική ανοσία με παραγωγή

Διαβάστε περισσότερα

Αντιγόνο. ξένη) με μια σχετικά ισχυρή δύναμη σύνδεσης.

Αντιγόνο. ξένη) με μια σχετικά ισχυρή δύναμη σύνδεσης. Αντιγόνα Αντισώματα Αντιγόνο Ως αντιγόνο ορίζεται κάθε ουσία που προέρχεται από το εξωτερικό ή εσωτερικό περιβάλλον και είναι ικανή να αντιδράσει με τα προϊόντα της ανοσιακής απάντησης (αναγνωρίζεται από

Διαβάστε περισσότερα

Ανοσιακή απάντηση (immune response)

Ανοσιακή απάντηση (immune response) Ανοσιακή απάντηση (immune response) Το σύνολο των μηχανισμών που καθιστούν τον οργανισμό ικανό να αναγνωρίζει,να εξουδετερώνει και να απομακρύνει κάθε ξένη ουσία προς αυτόν χαρακτηρίζεται ως ανοσία. Αποτέλεσμα

Διαβάστε περισσότερα

ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ Ο.Ε.Φ.Ε. 2004 ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ Γ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ

ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ Ο.Ε.Φ.Ε. 2004 ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ Γ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ Ο.Ε.Φ.Ε. 2004 ΘΕΜΑ 1 Ο Α. Να επιλέξετε την ορθή πρόταση: ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ Γ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 1. Το κωδικόνιο του mrna που κωδικοποιεί το αµινοξύ µεθειονίνη είναι α. 5 GUA

Διαβάστε περισσότερα

ΑΡΧΕΣ ΑΝΟΣΟΛΟΓΙΑΣ ΕΙΣΑΓΩΓΗ ΣΤΟ ΑΝΟΣΟΠΟΙΗΤΙΚΟ ΣΥΣΤΗΜΑ

ΑΡΧΕΣ ΑΝΟΣΟΛΟΓΙΑΣ ΕΙΣΑΓΩΓΗ ΣΤΟ ΑΝΟΣΟΠΟΙΗΤΙΚΟ ΣΥΣΤΗΜΑ ΑΡΧΕΣ ΑΝΟΣΟΛΟΓΙΑΣ ΕΙΣΑΓΩΓΗ ΣΤΟ ΑΝΟΣΟΠΟΙΗΤΙΚΟ ΣΥΣΤΗΜΑ Χρειάζεται η µελέτη της ανοσολογία; Εµβόλια Άµυνα κατά µικροοργανισµών Ανοσολογικές ασθένειες Αλλεργίες - υπερευαισθησίες, αυτοανοσίες, ανοσοανεπάρκειες,

Διαβάστε περισσότερα

Εργαλεία Μοριακής Γενετικής

Εργαλεία Μοριακής Γενετικής Εργαλεία Μοριακής Γενετικής Αρχές Μοριακής κλωνοποίησης Τα περιοριστικά ένζυμα: αναγνωρίζουν αλληλουχίες (θέσεις περιορισμού). 2 τύποι ενζύμων: -Τύπος I = Κόβουν κοντά στη θέση περιορισμού -σπάνια χρησιμοποιούνται.

Διαβάστε περισσότερα

Σάββατο, 25 Μαΐου 2002 Γ ΛΥΚΕΙΟΥ ΓΕΝΙΚΗ ΠΑΙ ΕΙΑ. Βιολογία

Σάββατο, 25 Μαΐου 2002 Γ ΛΥΚΕΙΟΥ ΓΕΝΙΚΗ ΠΑΙ ΕΙΑ. Βιολογία Σάββατο, 25 Μαΐου 2002 Γ ΛΥΚΕΙΟΥ ΓΕΝΙΚΗ ΠΑΙ ΕΙΑ Βιολογία ΘΕΜΑ 1 Στις ερωτήσεις 1 5, να γράψετε στο τετράδιό σας τον αριθµό της ερώτησης και δίπλα του το γράµµα που αντιστοιχεί στη σωστή απάντηση. 1. Ποιο

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΙΑΓΩΝΙΣΜΑ Θέµα 1 ο 1. Τα άτοµα που είναι ετερόζυγα για τη β-θαλασσαιµία: α. Εµφανίζουν ήπια αναιµία β. Έχουν ευαισθησία στην ελονοσία γ. Συνθέτουν µεγάλη ποσότητα HbF δ.

Διαβάστε περισσότερα

ΟΜΟΣΠΟΝ ΙΑ ΕΚΠΑΙ ΕΥΤΙΚΩΝ ΦΡΟΝΤΙΣΤΩΝ ΕΛΛΑ ΟΣ (Ο.Ε.Φ.Ε.) ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ 2014

ΟΜΟΣΠΟΝ ΙΑ ΕΚΠΑΙ ΕΥΤΙΚΩΝ ΦΡΟΝΤΙΣΤΩΝ ΕΛΛΑ ΟΣ (Ο.Ε.Φ.Ε.) ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ 2014 ΤΑΞΗ: ΚΑΤΕΥΘΥΝΣΗ: ΜΑΘΗΜΑ: Γ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗ ΒΙΟΛΟΓΙΑ Ηµεροµηνία: Παρασκευή 25 Απριλίου 2014 ιάρκεια Εξέτασης: 3 ώρες ΕΚΦΩΝΗΣΕΙΣ ΘΕΜΑ Α Να γράψετε στο τετράδιό σας τον αριθµό καθεµιάς από τις παρακάτω

Διαβάστε περισσότερα

ANOΣΟΓΗΡΑΝΣΗ. Ιωάννα Οικονοµίδου. Αναπληρώτρια Καθηγήτρια Ιατρικής Πανεπιστηµίου Αθηνών

ANOΣΟΓΗΡΑΝΣΗ. Ιωάννα Οικονοµίδου. Αναπληρώτρια Καθηγήτρια Ιατρικής Πανεπιστηµίου Αθηνών ANOΣΟΓΗΡΑΝΣΗ Ιωάννα Οικονοµίδου Αναπληρώτρια Καθηγήτρια Ιατρικής Πανεπιστηµίου Αθηνών Το ανοσιακό σύστηµα θεωρείται αποφασιστικός παράγοντας για την διατήρηση της υγείας και την επιβίωση στους ηλικιωµένους

Διαβάστε περισσότερα

Ποιες είναι οι ομοιότητες και οι διαφορές μεταξύ της αντιγραφής και της

Ποιες είναι οι ομοιότητες και οι διαφορές μεταξύ της αντιγραφής και της ΚΕΦ. 2 ο ΕΡΩΤΗΣΕΙΣ ΚΡΙΣΕΩΣ Ποιες είναι οι ομοιότητες και οι διαφορές μεταξύ της αντιγραφής και της μεταγραφής; Διαφορές Αντιγραφή Μεταγραφή 1. Διατηρείται και μεταβιβάζεται η 1. Μεταβιβάζεται η γενετική

Διαβάστε περισσότερα

ΑΙΜΟΠΑΘΟΛΟΓΟΑΝΑΤΟΜΙΑ

ΑΙΜΟΠΑΘΟΛΟΓΟΑΝΑΤΟΜΙΑ ΑΙΜΟΠΑΘΟΛΟΓΟΑΝΑΤΟΜΙΑ Η συµβολή της µοριακής ανάλυσης Eλισάβετ Οικονοµάκη Βιολόγος Αιµοπαθολογοανατοµικό Εργαστήριο ΠΓΝΑ > ΜΟΡΙΑΚΕΣ ΜΕΘΟ ΟΙ (Μη µορφολογικές) Αλυσιδωτή Αντίδραση Πολυµεράσης

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ Γ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 2008

ΒΙΟΛΟΓΙΑ Γ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 2008 ΒΙΟΛΟΓΙΑ Γ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 2008 ΕΚΦΩΝΗΣΕΙΣ ΘΕΜΑ 1ο Να γράψετε στο τετράδιό σας τον αριθµό καθεµιάς από τις παρακάτω ηµιτελείς προτάσεις 1 έως 5 και δίπλα το γράµµα που αντιστοιχεί στη λέξη

Διαβάστε περισσότερα

Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΒΙΟΛΟΓΙΑ. Óõíåéñìüò ΕΚΦΩΝΗΣΕΙΣ. Να επιλέξετε τη φράση που συµπληρώνει ορθά κάθε µία από τις ακόλουθες προτάσεις:

Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΒΙΟΛΟΓΙΑ. Óõíåéñìüò ΕΚΦΩΝΗΣΕΙΣ. Να επιλέξετε τη φράση που συµπληρώνει ορθά κάθε µία από τις ακόλουθες προτάσεις: 1 Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ 1 o ΒΙΟΛΟΓΙΑ ΕΚΦΩΝΗΣΕΙΣ Να επιλέξετε τη φράση που συµπληρώνει ορθά κάθε µία από τις ακόλουθες προτάσεις: 1. Το DNA ενός ανθρώπινου κυττάρου αποτελείται από 6 10 9

Διαβάστε περισσότερα

ΓΕΝΕΤΙΚΑ ΤΡΟΠΟΠΟΙΗΜΕΝΑ ΦΥΤΑ. ΑΡΧΕΣ ΓΟΝΙ ΙΑΚΟΥ ΧΕΙΡΙΣΜΟΥ ΙΙ (ΜΑΘΗΜΑ 3ο)

ΓΕΝΕΤΙΚΑ ΤΡΟΠΟΠΟΙΗΜΕΝΑ ΦΥΤΑ. ΑΡΧΕΣ ΓΟΝΙ ΙΑΚΟΥ ΧΕΙΡΙΣΜΟΥ ΙΙ (ΜΑΘΗΜΑ 3ο) ΓΕΝΕΤΙΚΑ ΤΡΟΠΟΠΟΙΗΜΕΝΑ ΦΥΤΑ ΑΡΧΕΣ ΓΟΝΙ ΙΑΚΟΥ ΧΕΙΡΙΣΜΟΥ ΙΙ (ΜΑΘΗΜΑ 3ο) 1 ΦΟΡΕΙΣ πλασµίδια βακτηρίων βακτηριοφάγοι ιοί συνδυασµός πλασµιδίου βακτηριοφάγου (κοσµίδια) 2 ΦΟΡΕΙΣ Βακτηριοφάγοι Χαρακτηριστικά

Διαβάστε περισσότερα

Θέµατα Βιολογίας Θετικής Κατεύθυνσης Γ Λυκείου 2000

Θέµατα Βιολογίας Θετικής Κατεύθυνσης Γ Λυκείου 2000 Θέµατα Βιολογίας Θετικής Κατεύθυνσης Γ Λυκείου 2000 ΕΚΦΩΝΗΣΕΙΣ Ζήτηµα 1ο Στις ερωτήσεις 1-5, να γράψετε στο τετράδιο σας τον αριθµό της ερώτησης και δίπλα το γράµµα που αντιστοιχεί στη σωστή απάντηση.

Διαβάστε περισσότερα

ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ

ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΘΕΜΑ Α Να γράψετε στο τετράδιό σας τον αριθμό καθεμιάς από τις παρακάτω ημιτελείς προτάσεις Α1 έως Α5 και δίπλα το γράμμα που αντιστοιχεί στη λέξη

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ Α ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Να γράψετε στο τετράδιό σας τον αριθμό καθεμιάς από τις παρακάτω ημιτελείς προτάσεις Α1 έως Α5 και δίπλα το γράμμα που αντιστοιχεί στη λέξη ή τη φράση, η οποία συμπληρώνει

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙ ΕΙΑΣ

ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙ ΕΙΑΣ ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙ ΕΙΑΣ Συγκρίνατε την πρωτογενή µε τη δευτερογενή ανοσοβιολογική απόκριση και απεικονίστε αυτές στο ίδιο διάγραµµα αξόνων. Πρωτογενή ανοσοβιολογική απόκριση ονοµάζουµε την απόκριση του

Διαβάστε περισσότερα

ΑΡΧΗ 1ΗΣ ΣΕΛΙΔΑΣ Γ ΗΜΕΡΗΣΙΩΝ

ΑΡΧΗ 1ΗΣ ΣΕΛΙΔΑΣ Γ ΗΜΕΡΗΣΙΩΝ ΑΡΧΗ 1ΗΣ ΣΕΛΙΔΑΣ Γ ΗΜΕΡΗΣΙΩΝ ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΠΕΜΠΤΗ 11 ΙΟΥΝΙΟΥ 2015 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΣΥΝΟΛΟ ΣΕΛΙΔΩΝ: ΠΕΝΤΕ (5) ΘΕΜΑ

Διαβάστε περισσότερα

Παραγωγή φαρμακευτικών πρωτεϊνών με βιοτεχνολογικές μεθόδους Μεταφορά γονιδίων σε ευκαρυωτικά κύτταρα (Γονιδιακή θεραπεία)

Παραγωγή φαρμακευτικών πρωτεϊνών με βιοτεχνολογικές μεθόδους Μεταφορά γονιδίων σε ευκαρυωτικά κύτταρα (Γονιδιακή θεραπεία) Παραγωγή φαρμακευτικών πρωτεϊνών με βιοτεχνολογικές μεθόδους Μεταφορά γονιδίων σε ευκαρυωτικά κύτταρα (Γονιδιακή θεραπεία) Παραγωγή ινσουλίνης από βακτήρια Παρελθόν: απομόνωση ινσουλίνης από πάνγκρεας

Διαβάστε περισσότερα

Ανοσολογικό σύστημα και λοιμώξεις Μηχανισμοί άμυνας μεγαλοοργανισμού

Ανοσολογικό σύστημα και λοιμώξεις Μηχανισμοί άμυνας μεγαλοοργανισμού Ανοσολογικό σύστημα και λοιμώξεις Μηχανισμοί άμυνας μεγαλοοργανισμού Γεωργία Σ. Βρυώνη Ιατρός Βιοπαθολόγος Λέκτορας Μικροβιολογίας gvrioni@med.uoa.gr 23/01/08 Μαθήματα Ειδικευόμενων Εισαγωγή στην Ανοσολογία

Διαβάστε περισσότερα

ÍÅÏ ÄÕÍÁÌÉÊÏ ÓÔÁÕÑÏÕÐÏËÇ

ÍÅÏ ÄÕÍÁÌÉÊÏ ÓÔÁÕÑÏÕÐÏËÇ 1 ΘΕΜΑ 1 o Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΕΚΦΩΝΗΣΕΙΣ ΒΙΟΛΟΓΙΑ Α. Για τις ερωτήσεις 1 5 να γράψετε στο τετράδιό σας τον αριθµό της ερώτησης και δίπλα του το γράµµα, που αντιστοιχεί στη σωστή απάντηση. 1.

Διαβάστε περισσότερα

Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΒΙΟΛΟΓΙΑ ΑΠΑΝΤΗΣΕΙΣ ÏÅÖÅ

Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΒΙΟΛΟΓΙΑ ΑΠΑΝΤΗΣΕΙΣ ÏÅÖÅ 1 Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΒΙΟΛΟΓΙΑ ΘΕΜΑ 1 o 1 Β 2 3 Γ 4 5 Β. ΘΕΜΑ 2 o ΑΠΑΝΤΗΣΕΙΣ Α. Όπως στο σχολικό, σελίδα 20: «Κάθε φυσιολογικό µεταφασικό ως προς τη θέση του κεντροµεριδίου» και σελίδα «Κατά

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ Α Να γράψετε στο τετράδιό σας τον αριθμό καθεμιάς από τις παρακάτω ημιτελείς προτάσεις Α1 έως Α5 και δίπλα το γράμμα που αντιστοιχεί στη λέξη ή φράση, η οποία συμπληρώνει σωστά

Διαβάστε περισσότερα

Κεφάλαιο 19 Ρύθμιση της γονιδιακής έκφρασης σε βακτήρια και βακτηριοφάγους. Ο καταστολέας του οπερονίου lac προσδεδεμένος στο DNA.

Κεφάλαιο 19 Ρύθμιση της γονιδιακής έκφρασης σε βακτήρια και βακτηριοφάγους. Ο καταστολέας του οπερονίου lac προσδεδεμένος στο DNA. Κεφάλαιο 19 Ρύθμιση της γονιδιακής έκφρασης σε βακτήρια και βακτηριοφάγους Ο καταστολέας του οπερονίου lac προσδεδεμένος στο DNA. 1 -Ρυθμιζόμενα, ιδιοστατικά γονίδια και γονίδια κυτταρικής οικονομίας:

Διαβάστε περισσότερα

ΠΡΟΤΕΙΝΟΜΕΝΑ ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ

ΠΡΟΤΕΙΝΟΜΕΝΑ ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΠΡΟΤΕΙΝΟΜΕΝΑ ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΘΕΜΑ 1 Ο Α. Να βάλετε σε κύκλο το γράμμα που αντιστοιχεί στη σωστή απάντηση ή στη φράση που συμπληρώνει σωστά την πρόταση. 1. H β- θαλασσαιμία είναι

Διαβάστε περισσότερα

Για το χρώµα σπέρµατος επικρατής είναι η ιδιότητα κίτρινο και η υπολειπόµενη το πράσινο. Συµβολίζουµε: Κ:Κίτρινο κ: Πράσινο Κ>κ

Για το χρώµα σπέρµατος επικρατής είναι η ιδιότητα κίτρινο και η υπολειπόµενη το πράσινο. Συµβολίζουµε: Κ:Κίτρινο κ: Πράσινο Κ>κ Απαντήσεις Βιολογία Κατεύθυνσης 2011 ΘΕΜΑ Α Α1 α Α2 δ Α3 γ Α4 β Α5 β ΘΕΜΑ Β Β1 Σελ. 13 «Το 1928 γίνεται αυτό» Β2 Σελ 101 «βλάβες στους επιδιορθωτικά ένζυµα» (Χωρίς να απαιτείται θα θεωρηθεί σωστό να γίνει

Διαβάστε περισσότερα

γ ρ α π τ ή ε ξ έ τ α σ η σ τ ο μ ά θ η μ α ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ

γ ρ α π τ ή ε ξ έ τ α σ η σ τ ο μ ά θ η μ α ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ γ ρ α π τ ή ε ξ έ τ α σ η σ τ ο μ ά θ η μ α ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ' ΛΥΚΕΙΟΥ Τάξη: Γ Λυκείου Τμήμα: Βαθμός: Ονοματεπώνυμο: Καθηγητές: Θ Ε Μ Α A 1. Να επιλέξετε τη σωστή απάντηση: Α1. Το γονίδιο

Διαβάστε περισσότερα

Μαυροματάκης Γιώργος Βιολόγος

Μαυροματάκης Γιώργος Βιολόγος Βιολογία Γ'Λυκείου Κατεύθυνσης Εικονογραφημένη Επανάληψη Μαυροματάκης Γιώργος Βιολόγος (gmavromat@gmail.com) Χανιά 2009-2010 1 Κεφάλαιο 1ο Το γενετικό υλικό 2 3 Με τη βοήθεια της φωτογραφίας που ακολουθεί

Διαβάστε περισσότερα

ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ ΤΑΞΗ

ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ ΤΑΞΗ ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ Σ ΕΣΠΕΡΙΝΟΥ ΕΝΙΑΙΟΥ ΛΥΚΕΙΟΥ ΠΑΡΑΣΚΕΥΗ 2 ΙΟΥΝΙΟΥ 2006 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ: ΒΙΟΛΟΓΙΑ ΣΥΝΟΛΟ ΣΕΛΙ ΩΝ: ΠΕΝΤΕ (5) ΘΕΜΑ 1ο Α. Για τις ημιτελείς προτάσεις

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑΤΑ ΘΕΜΑ Α Να γράψετε στο τετράδιό σας τον αριθμό κάθε μίας από τις παρακάτω ημιτελείς προτάσεις Α1 έως Α5 και δίπλα το γράμμα, που αντιστοιχεί στη λέξη ή στη φράση, η οποία

Διαβάστε περισσότερα

Η ζητούμενη σειρά έχει ως εξής: αδενίνη < νουκλεοτίδιο < νουκλεόσωμα < γονίδιο < χρωματίδα < χρωμόσωμα < γονιδίωμα.

Η ζητούμενη σειρά έχει ως εξής: αδενίνη < νουκλεοτίδιο < νουκλεόσωμα < γονίδιο < χρωματίδα < χρωμόσωμα < γονιδίωμα. ΚΕΦ. 1 ο ΕΡΩΤΗΣΕΙΣ ΚΡΙΣΕΩΣ 1. Να κατατάξετε σε σειρά αυξανόμενου μεγέθους τις παρακάτω έννοιες που σχετίζονται με το γενετικό υλικό των οργανισμών: νουκλεόσωμα, χρωμόσωμα, αδενίνη, νουκλεοτίδιο, γονίδιο

Διαβάστε περισσότερα

Πρόλογος Ομότ. Καθηγητού κου Μαραγκουδάκη...v Πρόλογος της συγγραφέως...vii. Καμπύλες δόσης - ανταπόκρισης... 3. Μηχανισμοί δράσης των φαρμάκων 9

Πρόλογος Ομότ. Καθηγητού κου Μαραγκουδάκη...v Πρόλογος της συγγραφέως...vii. Καμπύλες δόσης - ανταπόκρισης... 3. Μηχανισμοί δράσης των φαρμάκων 9 Περιεχόμενα Πρόλογος Ομότ. Καθηγητού κου Μαραγκουδάκη...v Πρόλογος της συγγραφέως...vii Κεφάλαιο 1 2 3 4 Εισαγωγή 1 Καμπύλες δόσης - ανταπόκρισης.... 3 Μηχανισμοί δράσης των φαρμάκων 9 1 Δράση μέσω φυσικοχημικών

Διαβάστε περισσότερα

Βιολογία Γ Γενικού Λυκείου Θετικής κατεύθυνσης. Κεφάλαιο 1α Το Γενετικό Υλικό

Βιολογία Γ Γενικού Λυκείου Θετικής κατεύθυνσης. Κεφάλαιο 1α Το Γενετικό Υλικό Βιολογία Γ Γενικού Λυκείου Θετικής κατεύθυνσης Κεφάλαιο 1α Το Γενετικό Υλικό Το DNA είναι το γενετικό υλικό Αρχικά οι επιστήμονες θεωρούσαν ότι οι πρωτεΐνες αποτελούσαν το γενετικό υλικό των οργανισμών.

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΘΕΜΑ 1ο Να γράψετε στο τετράδιο σας τον αριθμό καθεμιάς από τις παρακάτω ημιτελείς προτάσεις 1 έως 5 και δίπλα το γράμμα που αντιστοιχεί στη φράση που συμπληρώνει

Διαβάστε περισσότερα

Δ. Ιακωβίδης. Πνευμονολόγος Aν. Διευθυντής Μονάδα επεμβατικής Πνευμονολογίας Γ.Π.Ν. «Γ. Παπανικολάου

Δ. Ιακωβίδης. Πνευμονολόγος Aν. Διευθυντής Μονάδα επεμβατικής Πνευμονολογίας Γ.Π.Ν. «Γ. Παπανικολάου Δ. Ιακωβίδης Πνευμονολόγος Aν. Διευθυντής Μονάδα επεμβατικής Πνευμονολογίας Γ.Π.Ν. «Γ. Παπανικολάου Νέα διαγνωστικά μέσα για τη λανθάνουσα φυματίωση Η στοχευμένη δοκιμασία δερματικής φυματινοαντίδρασης

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ. 3. Τι γνωρίζετε για τον πυρήνα του ευκαρυωτικού κυττάρου;

ΒΙΟΛΟΓΙΑ. 3. Τι γνωρίζετε για τον πυρήνα του ευκαρυωτικού κυττάρου; ΒΙΟΛΟΓΙΑ 1,Να αντιστοιχίσετε της όρους της αριστερής στήλης με τις προτάσεις της δεξιάς στήλης: α. κυτταρική μεμβράνη 1. πολλαπλασιάζονται με εκβλάστηση β. αμοιβάδα 2.κέντρα παραγωγής ενέργειας γ. μιτοχόνδρια

Διαβάστε περισσότερα

Περικλέους Σταύρου 31 34100 Χαλκίδα Τ: 2221-300524 & 6937016375 F: 2221-300524 @: chalkida@diakrotima.gr W: www.diakrotima.gr

Περικλέους Σταύρου 31 34100 Χαλκίδα Τ: 2221-300524 & 6937016375 F: 2221-300524 @: chalkida@diakrotima.gr W: www.diakrotima.gr Περικλέους Σταύρου 31 Προς: Μαθητές Α, Β & Γ Λυκείου / Κάθε ενδιαφερόμενο Αγαπητοί Φίλοι Όπως σίγουρα γνωρίζετε, από τον Ιούνιο του 2010 ένα νέο «ΔΙΑΚΡΟΤΗΜΑ» λειτουργεί και στη Χαλκίδα. Στο Φροντιστήριό

Διαβάστε περισσότερα

Παραγωγή, απομόνωση και καθαρισμός της φαρμακευτικής πρωτεΐνης.

Παραγωγή, απομόνωση και καθαρισμός της φαρμακευτικής πρωτεΐνης. ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΕΝΙΑΙΟΥ ΛΥΚΕΙΟΥ ΤΡΙΤΗ 1 ΙΟΥΝΙΟΥ 2004 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 1 ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ 1o 1. δ 2. β 3. β 4. γ 5. δ ΘΕΜΑ 2o 1. Σχολικό βιβλίο, σελ.

Διαβάστε περισσότερα

Α2. Το αντικωδικόνιο είναι τριπλέτα νουκλεοτιδίων του α. mrna β. snrna γ. trna δ. rrna Μονάδες 5

Α2. Το αντικωδικόνιο είναι τριπλέτα νουκλεοτιδίων του α. mrna β. snrna γ. trna δ. rrna Μονάδες 5 ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ Α Να γράψετε στο τετράδιό σας τον αριθμό καθεμιάς από τις παρακάτω ημιτελείς προτάσεις Α1 έως Α5 και δίπλα στο γράμμα που αντιστοιχεί στη λέξη ή στη φράση, η οποία συμπληρώνει

Διαβάστε περισσότερα

ΟΡΟΛΟΓΙΑ 1 ΟΥ ΚΕΦΑΛΑΙΟΥ

ΟΡΟΛΟΓΙΑ 1 ΟΥ ΚΕΦΑΛΑΙΟΥ ΟΡΟΛΟΓΙΑ 1 ΟΥ ΚΕΦΑΛΑΙΟΥ 1. In vitro 2. In vivo 3. Αναστολείς μίτωσης 4. Απλοειδές κύτταρο 5. Απλοειδής οργανισμός 6. Αριθμός ή αλληλουχία βάσεων 7. Αυτοσωμικά χρωμοσώματα 8. Βήμα έλικας 9. Γονιδίωμα κυττάρου

Διαβάστε περισσότερα

Περιβαλλοντικά Καρκινογόνα Κυρίως τρεις τύποι: Χηµικά (µόλυνση, κάπνισµα, αµίαντος) Φυσικά (ιονίζουσα ακτινοβολία, µή- ιονίζουσα???) Βιολογικά (ιοί π.χ.. HPV) Καρκίνος παχέος εντέρου ΓΕΝΕΤΙΚΟΣ

Διαβάστε περισσότερα

Γ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΑΠΑΝΤΗΣΕΙΣ

Γ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΑΠΑΝΤΗΣΕΙΣ Επαναληπτικά Θέµατα ΟΕΦΕ 2005 1 ε π α ν α λ η π τ ι κ ά θ έ µ α τ α 2 0 0 5 Γ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ 1 Ο A: 1-Α, 2-, 3-Γ, 4-Β, 5-Β ΜΟΝΑ ΕΣ 15 (3Χ5) Β. 1. Σωστή, 2. Λανθασµένη,

Διαβάστε περισσότερα

γραπτή εξέταση στo μάθημα ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ Γ ' ΛΥΚΕΙΟΥ

γραπτή εξέταση στo μάθημα ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ Γ ' ΛΥΚΕΙΟΥ γραπτή εξέταση στo μάθημα ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ Γ ' ΛΥΚΕΙΟΥ Τάξη: Γ Λυκείου Τμήμα: Βαθμός: Ονοματεπώνυμο: Καθηγητής: Θ Ε Μ Α A 1. Να επιλέξετε τη σωστή απάντηση: Α1. Η ρύθμιση της θερμοκρασίας του

Διαβάστε περισσότερα

Μεταβολικές ανάγκες ανοσοκυττάρων

Μεταβολικές ανάγκες ανοσοκυττάρων Μεταβολικές ανάγκες ανοσοκυττάρων Στέργιος Κατσιουγιάννης PhD Μεταδιδακτορικός συνεργάτης Χαροκόπειο Πανεπιστήµιο Τµήµα Επιστήµης ιαιτολογίας και ιατροφής Μεταβολισµός και Ανοσολογία Ιστορικά το καλύτερο

Διαβάστε περισσότερα

ΛΥΣΗ ΤΗΣ ΑΣΚΗΣΗΣ ΕΠΑΝΑΛΗΨΗΣ

ΛΥΣΗ ΤΗΣ ΑΣΚΗΣΗΣ ΕΠΑΝΑΛΗΨΗΣ ΛΥΣΗ ΤΗΣ ΑΣΚΗΣΗΣ ΕΠΑΝΑΛΗΨΗΣ 1. Ο γενετικός κώδικας είναι ένας κώδικας αντιστοίχισης των κωδικονίων του mrna με αμινοξέα στην πολυπεπτιδική αλυσίδα. Σύμφωνα με αυτόν η 3 μετάφραση όλων των mrna αρχίζει

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ Γ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 2004

ΒΙΟΛΟΓΙΑ Γ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 2004 ΒΙΟΛΟΓΙΑ Γ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 2004 ΕΚΦΩΝΗΣΕΙΣ ΘΕΜΑ 1ο Να γράψετε στο τετράδιό σας τον αριθµό καθεµιάς από τις παρακάτω ηµιτελείς προτάσεις 1 έως 5 και δίπλα το γράµµα που αντιστοιχεί στη φράση

Διαβάστε περισσότερα

γραπτή εξέταση στo μάθημα ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ

γραπτή εξέταση στo μάθημα ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ γραπτή εξέταση στo μάθημα ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ' ΛΥΚΕΙΟΥ Τάξη: Γ Λυκείου Τμήμα: Βαθμός: Ονοματεπώνυμο: Καθηγητές: ΠΑΣΣΙΑ Α. Θ Ε Μ Α A 1. Να επιλέξετε τη σωστή απάντηση: Α1. Κάθε μεταφορικό RNA

Διαβάστε περισσότερα

ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ ΤΗΣ Γ' ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ

ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ ΤΗΣ Γ' ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ ΤΗΣ Γ' ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΟΙ ΛΥΣΕΙΣ ΤΩΝ ΘΕΜΑΤΩΝ ΑΠΟ ΤΟΝ ΚΑΘΗΓΗΤΗ κύριο ΤΡΙΓΚΑ ΓΕΩΡΓΙΟ του ΦΡΟΝΤΙΣΤΗΡΙΟΥ του ΦΡΟΝΤΙΣΤΗΡΙΟΥ www.orion.edu.gr ΘΕΜΑ A A1. γ A2. β A3.

Διαβάστε περισσότερα

ΘΕΡΑΠΕΥΤΙΚΗ ΑΝΤΙΜΕΤΩΠΙΣΗ ΟΓΚΩΝ ΤΟΥ ΕΓΚΕΦΑΛΟΥ. Β. ΠΑΝΑΓΙΩΤΟΠΟΥΛΟΣ Λέκτορας Νευροχειρουργικής Π.Γ.Ν.Π.

ΘΕΡΑΠΕΥΤΙΚΗ ΑΝΤΙΜΕΤΩΠΙΣΗ ΟΓΚΩΝ ΤΟΥ ΕΓΚΕΦΑΛΟΥ. Β. ΠΑΝΑΓΙΩΤΟΠΟΥΛΟΣ Λέκτορας Νευροχειρουργικής Π.Γ.Ν.Π. ΘΕΡΑΠΕΥΤΙΚΗ ΑΝΤΙΜΕΤΩΠΙΣΗ ΟΓΚΩΝ ΤΟΥ ΕΓΚΕΦΑΛΟΥ Β. ΠΑΝΑΓΙΩΤΟΠΟΥΛΟΣ Λέκτορας Νευροχειρουργικής Π.Γ.Ν.Π. ΓΛΟΙΩΜΑΤΑ ΕΓΚΕΦΑΛΟΥ ΓΛΟΙΩΜΑΤΑ ΕΓΚΕΦΑΛΟΥ ΠΙΛΟΚΥΤΤΑΡΙΚΟ ΑΣΤΡΟΚΥΤΩΜΑ (WHO I) ΑΣΤΡΟΚΥΤΩΜΑ (WHO II) ΑΝΑΠΛΑΣΤΙΚΟ

Διαβάστε περισσότερα

(αδρές αποικίες) Θέρμανση (λείες αποικίες) ζωντανά ποντίκια ζωντανά ποντίκια νεκρά ποντίκια

(αδρές αποικίες) Θέρμανση (λείες αποικίες) ζωντανά ποντίκια ζωντανά ποντίκια νεκρά ποντίκια Το DNA είναι το γενετικό υλικό 1. Πείραμα Griffith (1928) Βακτήριο πνευμονιόκοκκου (Diplococcus pneumoniae) Χωρίς κάλυμμα Με κάλυμμα (αδρές αποικίες) Θέρμανση (λείες αποικίες) ζωντανά ποντίκια ζωντανά

Διαβάστε περισσότερα

ΘΕΜΑΤΑ ΚΑΙ ΑΠΑΝΤΗΣΕΙΣ ΕΠΑΝΑΛΗΠΤΙΚΩΝ ΠΑΝΕΛΛΑΔΙΚΩΝ ΕΞΕΤΑΣΕΩΝ 2014 ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ

ΘΕΜΑΤΑ ΚΑΙ ΑΠΑΝΤΗΣΕΙΣ ΕΠΑΝΑΛΗΠΤΙΚΩΝ ΠΑΝΕΛΛΑΔΙΚΩΝ ΕΞΕΤΑΣΕΩΝ 2014 ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ ΘΕΜΑ Α Να γράψετε στο τετράδιό σας τον αριθμο καθεμιάς από τις παρακάτω ημιτελείς προτάσεις Α1 έως Α5 και, δίπλα, το γράμμα που αντιστοιχεί στη λέξη ή στη φράση, η οποία συμπληρώνει

Διαβάστε περισσότερα

ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ ΤΑΞΗ

ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ ΤΑΞΗ ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ Σ ΕΣΠΕΡΙΝΟΥ ΕΝΙΑΙΟΥ ΛΥΚΕΙΟΥ ΠΑΡΑΣΚΕΥΗ 6 ΙΟΥΝΙΟΥ 2003 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ: ΒΙΟΛΟΓΙΑ ΣΥΝΟΛΟ ΣΕΛΙ ΩΝ: ΤΕΣΣΕΡΙΣ (4) ΘΕΜΑ 1ο Στις ηµιτελείς προτάσεις

Διαβάστε περισσότερα

Δασική Γενετική Εισαγωγή: Βασικές έννοιες

Δασική Γενετική Εισαγωγή: Βασικές έννοιες Δασική Γενετική Εισαγωγή: Βασικές έννοιες Χειμερινό εξάμηνο 2014-2015 Γενετική Πειραματική επιστήμη της κληρονομικότητας Προέκυψε από την ανάγκη κατανόησης της κληρονόμησης οικονομικά σημαντικών χαρακτηριστικών

Διαβάστε περισσότερα

ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΤΕΤΑΡΤΗ 4 ΙΟΥΝΙΟΥ 2014. Ενδεικτικές απαντήσεις Θέµα Β

ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΤΕΤΑΡΤΗ 4 ΙΟΥΝΙΟΥ 2014. Ενδεικτικές απαντήσεις Θέµα Β ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΤΕΤΑΡΤΗ 4 ΙΟΥΝΙΟΥ 2014 Θέµα Α Α1. δ Α2. γ Α3. β A4. γ A5. β Ενδεικτικές απαντήσεις Θέµα Β Β1. Η σειρά των βημάτων που οδηγούν στην κατασκευή καρυοτύπου

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ 16-2-2014 ΘΕΜΑ 1 ο Α. Να βάλετε σε κύκλο το γράμμα που αντιστοιχεί στη σωστή απάντηση. (Μονάδες 25)

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ 16-2-2014 ΘΕΜΑ 1 ο Α. Να βάλετε σε κύκλο το γράμμα που αντιστοιχεί στη σωστή απάντηση. (Μονάδες 25) ΤΣΙΜΙΣΚΗ &ΚΑΡΟΛΟΥ ΝΤΗΛ ΓΩΝΙΑ THΛ: 270727 222594 ΑΡΤΑΚΗΣ 12 - Κ. ΤΟΥΜΠΑ THΛ: 919113 949422 ΕΠΩΝΥΜΟ:... ΟΝΟΜΑ:... ΤΜΗΜΑ:... ΗΜΕΡΟΜΗΝΙΑ:... ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ 16-2-2014 ΘΕΜΑ 1 ο Α. Να βάλετε σε

Διαβάστε περισσότερα

ΧΡΗΣΗ ΜΟΡΙΑΚΩΝ ΜΕΘΟΔΩΝ ΣΕ ΕΡΓΑΣΤΗΡΙΟ ΕΛΕΓΧΟΥ ΠΟΙΟΤΗΤΑΣ ΝΕΡΟΥ

ΧΡΗΣΗ ΜΟΡΙΑΚΩΝ ΜΕΘΟΔΩΝ ΣΕ ΕΡΓΑΣΤΗΡΙΟ ΕΛΕΓΧΟΥ ΠΟΙΟΤΗΤΑΣ ΝΕΡΟΥ ΧΡΗΣΗ ΜΟΡΙΑΚΩΝ ΜΕΘΟΔΩΝ ΣΕ ΕΡΓΑΣΤΗΡΙΟ ΕΛΕΓΧΟΥ ΠΟΙΟΤΗΤΑΣ ΝΕΡΟΥ Μανδηλαρά Γεωργία Βιολόγος PhD, Επιστημονικός Συνεργάτης Εθνική Σχολή Δημόσιας Υγείας Τμήμα Μικροβιολογίας Υδατογενείς λοιμώξεις: χρήση νερού

Διαβάστε περισσότερα

igenetics ΜΑΘΗΜΑ 3 Το γενετικό υλικό

igenetics ΜΑΘΗΜΑ 3 Το γενετικό υλικό igenetics ΜΑΘΗΜΑ 3 Το γενετικό υλικό ΛΕΙΤΟΥΡΓΙΕΣ ΤΟΥ ΓΕΝΕΤΙΚΟΥ ΥΛΙΚΟΥ ΑΠΟΘΗΚΕΥΣΗ Στο DNA (RNA ιών) οι πληροφορίες για τα χαρακτηριστικά ενός οργανισμού (γονίδια) ΔΙΑΤΗΡΗΣΗ Από κύτταρο σε κύτταρο και από

Διαβάστε περισσότερα

Ηδοµή των λιπαρών οξέων

Ηδοµή των λιπαρών οξέων Μεµβρανική Μεταφορά Ηδοµή των λιπαρών οξέων Λιπαρά οξέα-λιπίδια- µεµβράνες Κυτταρικές µεµβράνες: ρόλος διαχωριστικού τοίχους ιαφορετικές λειτουργίες της κυτταρικής µεµβράνης Ενδoκυτταρικές µεµβράνες

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ Α. Α1. δ Α2. γ Α3. β Α4. γ Α5. β ΘΕΜΑ Β. Β1. 4-2-1-6-3-5 Β2. α) DNA πολυμεράσες β) πριμόσωμα γ) DNA δεσμάσεις δ) DNA ελικάσες ε) RNA πολυμεράσες Β3. σελ 98:

Διαβάστε περισσότερα

Πανελλαδικές εξετάσεις Γ Τάξης Ημερήσιου Γενικού Λυκείου Βιολογία Θετικής Κατεύθυνσης Τετάρτη 4 Ιουνίου 2014

Πανελλαδικές εξετάσεις Γ Τάξης Ημερήσιου Γενικού Λυκείου Βιολογία Θετικής Κατεύθυνσης Τετάρτη 4 Ιουνίου 2014 Πανελλαδικές εξετάσεις Γ Τάξης Ημερήσιου Γενικού Λυκείου Βιολογία Θετικής Κατεύθυνσης Τετάρτη 4 Ιουνίου 2014 ΘΕΜΑ Α Α1.δ Α2.γ Α3.β Α4.γ Α5.β ΘΕΜΑ Β Β1. 4,2,1,6,3,5 Β2. α. DNA πολυμεράση β. πριμόσωμα γ.

Διαβάστε περισσότερα

ΤΕΛΟΣ 1ΗΣ ΑΠΟ 5 ΣΕΛΙΔΕΣ

ΤΕΛΟΣ 1ΗΣ ΑΠΟ 5 ΣΕΛΙΔΕΣ ΑΡΧΗ 1ΗΣ ΣΕΛΙΔΑΣ ΑΠΑΝΤΗΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΚΑΙ ΕΠΑΛ (ΟΜΑΔΑ Β ) ΣΑΒΒΑΤΟ 26 ΟΚΤΩΒΡΙΟΥ 2013 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ ΣΥΝΟΛΟ ΣΕΛΙΔΩΝ: ΠΕΝΤΕ (5) Θέμα Α Μονάδες 25 Α1.

Διαβάστε περισσότερα

ΑΠΑΝΤΗΣΕΙΣ ΣΤΟ 1 ο ΔΙΑΓΩΝΙΣΜΑ ΒΙΟΛΟΓΙΑΣ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ

ΑΠΑΝΤΗΣΕΙΣ ΣΤΟ 1 ο ΔΙΑΓΩΝΙΣΜΑ ΒΙΟΛΟΓΙΑΣ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ ΑΠΑΝΤΗΣΕΙΣ ΣΤΟ 1 ο ΔΙΑΓΩΝΙΣΜΑ ΒΙΟΛΟΓΙΑΣ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ ΘΕΜΑ 1 ο Α. Ερωτήσεις πολλαπλής επιλογής 1. γ 2. α 3. β 4. δ 5. δ Β. Ερωτήσεις σωστού - λάθους 1. Σωστό 2. Λάθος 3. Λάθος 4. Λάθος 5. Σωστό ΘΕΜΑ

Διαβάστε περισσότερα

Προβλήματα σχετιζόμενα με την τυποποίηση αντιγόνων Ι

Προβλήματα σχετιζόμενα με την τυποποίηση αντιγόνων Ι Β Προβλήματα Φαινότυπος Β(Α): ασθενής αντίδραση με αντι-α, έντονη αντίδραση με αντι-β, και ο ορός αντιδρά με ερυθρά Α₁. Ο αντιορός Α περιέχει τον κλώνο ΜΗΟ4? Επίκτητος Β φαινότυπος: έντονη αντίδραση με

Διαβάστε περισσότερα

ΕΡΓΑΣΤΗΡΙΑΚΗ ΔΙΕΡΕΥΝΗΣΗ ΑΥΤΟΑΝΟΣΗΣ ΑΙΜΟΛΥΤΙΚΗΣ ΑΝΑΙΜΙΑΣ. Μαρία Γκανίδου Νοσοκομειακή Υπηρεσία Αιμοδοσίας ΓΝΘ Γ.Παπανικολάου

ΕΡΓΑΣΤΗΡΙΑΚΗ ΔΙΕΡΕΥΝΗΣΗ ΑΥΤΟΑΝΟΣΗΣ ΑΙΜΟΛΥΤΙΚΗΣ ΑΝΑΙΜΙΑΣ. Μαρία Γκανίδου Νοσοκομειακή Υπηρεσία Αιμοδοσίας ΓΝΘ Γ.Παπανικολάου ΕΡΓΑΣΤΗΡΙΑΚΗ ΔΙΕΡΕΥΝΗΣΗ ΑΥΤΟΑΝΟΣΗΣ ΑΙΜΟΛΥΤΙΚΗΣ ΑΝΑΙΜΙΑΣ Μαρία Γκανίδου Νοσοκομειακή Υπηρεσία Αιμοδοσίας ΓΝΘ Γ.Παπανικολάου Αυτοάνοση Αιμολυτική Αναιμία (ΑΑΑ) 1.Αυξημένη καταστροφή των ερυθρών αιμοσφαιρίων

Διαβάστε περισσότερα

ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ Γ ΗΜΕΡΗΣΙΩΝ

ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ Γ ΗΜΕΡΗΣΙΩΝ ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ Γ ΗΜΕΡΗΣΙΩΝ ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΚΑΙ ΕΠΑΛ (ΟΜΑΔΑ Β ) TETAPTH 4 IOYNIOY 2014 - ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΣΥΝΟΛΟ ΣΕΛΙΔΩΝ: ΠΕΝΤΕ

Διαβάστε περισσότερα

ΘΕΜΑ 1ο ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ Γ ΤΑΞΗ

ΘΕΜΑ 1ο ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ Γ ΤΑΞΗ ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ ΘΕΜΑ 1ο ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ Σ ΗΜΕΡΗΣΙΟΥ ΕΝΙΑΙΟΥ ΛΥΚΕΙΟΥ ΣΑΒΒΑΤΟ 4 ΙΟΥΝΙΟΥ 2005 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΣΥΝΟΛΟ ΣΕΛΙ ΩΝ: ΠΕΝΤΕ (5) Να γράψετε στο τετράδιό σας

Διαβάστε περισσότερα

Θέματα πριν τις εξετάσεις. Καλό διάβασμα Καλή επιτυχία

Θέματα πριν τις εξετάσεις. Καλό διάβασμα Καλή επιτυχία Θέματα πριν τις εξετάσεις Καλό διάβασμα Καλή επιτυχία 2013-2014 Θέματα πολλαπλής επιλογής Μετουσίωση είναι το φαινόμενο α. κατά το οποίο συνδέονται δύο αμινοξέα για τον σχηματισμό μιας πρωτεΐνης β. κατά

Διαβάστε περισσότερα

Η γονιδιακή θεραπεία στην καταπολέμηση συγγενών νόσων

Η γονιδιακή θεραπεία στην καταπολέμηση συγγενών νόσων , Φυσικός MSc Η γονιδιακή θεραπεία στην καταπολέμηση συγγενών νόσων Γονιδιακή θεραπεία είναι η εισαγωγή γονιδίων στα κύτταρα και τους ιστούς ενός οργανισμού που εκδηλώνει μια κληρονομική ως επί το πλείστον

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΚΕΦ. 6 ο ΜΕΤΑΛΛΑΞΕΙΣ

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΚΕΦ. 6 ο ΜΕΤΑΛΛΑΞΕΙΣ ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΚΕΦ. 6 ο ΜΕΤΑΛΛΑΞΕΙΣ Μεταλλάξεις είναι οι αλλαγές στην αλληλουχία των νουκλεοτιδίων που συμβαίνουν στο γενετικό υλικό ενός οργανισμού τόσο σε γονιδιακό επίπεδο (γονιδιακές μεταλλάξεις)

Διαβάστε περισσότερα

Βιολογία Θετικής Κατεύθυνσης Γ' Λυκείου 2001

Βιολογία Θετικής Κατεύθυνσης Γ' Λυκείου 2001 Βιολογία Θετικής Κατεύθυνσης Γ' Λυκείου 2001 ΕΚΦΩΝΗΣΕΙΣ Ζήτηµα 1ο Α1. Από τη διασταύρωση ενός λευκού µ ένα µαύρο ποντικό όλοι οι απόγονοι είναι γκρίζοι. Τα γονίδια που καθορίζουν το χρώµα τους είναι: α.

Διαβάστε περισσότερα

ΑΠΑΝΤΗΣΕΙΣ ΣΤΟ ΔΙΑΓΩΝΙΣΜΑ ΒΙΟΛΟΓΙΑΣ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ Γ ΛΥΚΕΙΟΥ

ΑΠΑΝΤΗΣΕΙΣ ΣΤΟ ΔΙΑΓΩΝΙΣΜΑ ΒΙΟΛΟΓΙΑΣ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ Γ ΛΥΚΕΙΟΥ 23 10 2011 ΘΕΡΙΝΑ ΑΠΑΝΤΗΣΕΙΣ ΣΤΟ ΔΙΑΓΩΝΙΣΜΑ ΒΙΟΛΟΓΙΑΣ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ Γ ΛΥΚΕΙΟΥ ΘΕΜΑ 1 Ο Α. Να επιλέξετε τη φράση που συμπληρώνει ορθά κάθε μία από τις ακόλουθες προτάσεις: 1. Όλα τα βακτήρια: Α. διαθέτουν

Διαβάστε περισσότερα

Ψαλλίδας Ιωάννης, Μαγκούτα Σοφία, Παππάς Απόστολος, Μόσχος Χαράλαµπος, Βαζακίδου Μαρία Ελένη, Χαράλαµπος Ρούσσος, Σταθόπουλος Γέωργιος, Καλοµενίδης

Ψαλλίδας Ιωάννης, Μαγκούτα Σοφία, Παππάς Απόστολος, Μόσχος Χαράλαµπος, Βαζακίδου Μαρία Ελένη, Χαράλαµπος Ρούσσος, Σταθόπουλος Γέωργιος, Καλοµενίδης Ψαλλίδας Ιωάννης, Μαγκούτα Σοφία, Παππάς Απόστολος, Μόσχος Χαράλαµπος, Βαζακίδου Μαρία Ελένη, Χαράλαµπος Ρούσσος, Σταθόπουλος Γέωργιος, Καλοµενίδης Ιωάννης µορφή κακοήθειας που αναπτύσεται από

Διαβάστε περισσότερα

Βιολογία Γενικής Παιδείας Κεφάλαιο 1 ο : Άνθρωπος και Υγεία

Βιολογία Γενικής Παιδείας Κεφάλαιο 1 ο : Άνθρωπος και Υγεία Βιολογία Γενικής Παιδείας Κεφάλαιο 1 ο : Άνθρωπος και Υγεία Ομοιόσταση: η ικανότητα του οργανισμού να διατηρεί σταθερές τις συνθήκες του εσωτερικού περιβάλλοντος (θερμοκρασία, συγκεντρώσεις διάφορων συστατικών

Διαβάστε περισσότερα

ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ 2015 Β ΦΑΣΗ Γ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ / ΓΕΝΙΚΗΣ ΠΑΙ ΕΙΑΣ ΑΠΑΝΤΗΣΕΙΣ

ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ 2015 Β ΦΑΣΗ Γ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ / ΓΕΝΙΚΗΣ ΠΑΙ ΕΙΑΣ ΑΠΑΝΤΗΣΕΙΣ ΤΑΞΗ: ΜΑΘΗΜΑ: ΘΕΜΑ A Γ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ / ΓΕΝΙΚΗΣ ΠΑΙ ΕΙΑΣ Ηµεροµηνία: Μ. Τετάρτη 8 Απριλίου 2015 ιάρκεια Εξέτασης: 3 ώρες Α1 - γ, Α2 - δ, Α3 - α, Α4 - β, Α5 - α ΘΕΜΑ Β ΑΠΑΝΤΗΣΕΙΣ Β1. Παθογόνα

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 2005 ΕΚΦΩΝΗΣΕΙΣ

ΒΙΟΛΟΓΙΑ Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 2005 ΕΚΦΩΝΗΣΕΙΣ ΘΕΜΑ 1ο ΒΙΟΛΟΓΙΑ Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 2005 ΕΚΦΩΝΗΣΕΙΣ Να γράψετε στο τετράδιό σας τον αριθµό καθεµιάς από τις παρακάτω ηµιτελείς προτάσεις 1 έως 5 και δίπλα το γράµµα που αντιστοιχεί στη λέξη

Διαβάστε περισσότερα

ΑΝΟΣΟΙΣΤΟΧΗΜΙΚΕΣ ΚΑ! ΜΟΡΙΑΚΕΣ ΤΕΧΝΙΚΕΣ ΣΤΗΝ ΟΓΚΟΛΟΓΙΑ. Β. Ζουμπουρλήςΐ

ΑΝΟΣΟΙΣΤΟΧΗΜΙΚΕΣ ΚΑ! ΜΟΡΙΑΚΕΣ ΤΕΧΝΙΚΕΣ ΣΤΗΝ ΟΓΚΟΛΟΓΙΑ. Β. Ζουμπουρλήςΐ ΑΝΟΣΟΙΣΤΟΧΗΜΙΚΕΣ ΚΑ! ΜΟΡΙΑΚΕΣ ΤΕΧΝΙΚΕΣ ΣΤΗΝ ΟΓΚΟΛΟΓΙΑ Β. Ζουμπουρλήςΐ 1. Εργαστήριο Μοριακής Ογκολογίας και Βιοτεχνολογίας, Εθνικό Ίδρυμα Ερευνών, Αθήνα. Η Μοριακή Βιολογία και κατ' επέκταση η Μοριακή

Διαβάστε περισσότερα

Αλέξης Ν. Πολύδωρος Αναπλ. Καθηγητής Μοριακής Βελτίωσης Εργαστήριο Γενετικής και Βελτίωσης Φυτών ΑΠΘ email: palexios@agro.auth.gr

Αλέξης Ν. Πολύδωρος Αναπλ. Καθηγητής Μοριακής Βελτίωσης Εργαστήριο Γενετικής και Βελτίωσης Φυτών ΑΠΘ email: palexios@agro.auth.gr ΜΟΡΙΑΚΗ ΓΕΝΕΤΙΚΗ Αλέξης Ν. Πολύδωρος Αναπλ. Καθηγητής Μοριακής Βελτίωσης Εργαστήριο Γενετικής και Βελτίωσης Φυτών ΑΠΘ email: palexios@agro.auth.gr Παρουσιάσεις μαθήματος http://users.auth.gr/~palexios/

Διαβάστε περισσότερα

ΣΥΝΔΡΟΜΟ ΥΠΕΡ-IgM. Hyper-IgM Syndrome (HIgM)

ΣΥΝΔΡΟΜΟ ΥΠΕΡ-IgM. Hyper-IgM Syndrome (HIgM) INTERNATIONAL PATIENT ORGANISATION FOR PRIMARY IMMUNODEFICIENCIES ΠΑΓΚΟΣΜΙΟΣ ΟΡΓΑΝΙΣΜΟΣ ΑΣΘΕΝΩΝ ΓΙΑ ΠΡΩΤΟΠΑΘΕΙΣ ΑΝΟΣΟANΕΠΑΡΚΕΙΕΣ ΣΥΝΔΡΟΜΟ ΥΠΕΡ-IgM Hyper-IgM Syndrome (HIgM) ΑΡΜΟΝΙΑ Σύλλογος Φίλων Ασθενών

Διαβάστε περισσότερα

ΣΧΕΔΙΟ ΜΑΘΗΜΑΤΟΣ ΤΕΧΝΟΛΟΓΙΑ ΑΝΑΣΥΝΔΥΑΣΜΕΝΟΥ DNA (ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ)

ΣΧΕΔΙΟ ΜΑΘΗΜΑΤΟΣ ΤΕΧΝΟΛΟΓΙΑ ΑΝΑΣΥΝΔΥΑΣΜΕΝΟΥ DNA (ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ) ΣΧΕΔΙΟ ΜΑΘΗΜΑΤΟΣ ΤΕΧΝΟΛΟΓΙΑ ΑΝΑΣΥΝΔΥΑΣΜΕΝΟΥ DNA (ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ) Ι) ΠΡΟΑΠΑΙΤΟΥΜΕΝΕΣ ΓΝΩΣΕΙΣ ΚΑΙ ΔΕΞΙΟΤΗΤΕΣ Οι μαθητές θα πρέπει : Να γνωρίζουν ποιο μόριο είναι ο φορέας της γενετικής

Διαβάστε περισσότερα

ΕΚΦΡΑΣΗ ΤΟΥ ΧΑΡΑΚΤΗΡΙΣΤΙΚΟΥ ΤΩΝ ΡΥΘΜΙΣΤΙΚΩΝ Τ- ΚΥΤΤΑΡΩΝ ΓΟΝΙΔΙΟΥ Foxp3 ΣΤΟΝ ΚΑΡΚΙΝΟ ΤΟΥ ΠΝΕΥΜΟΝΑ

ΕΚΦΡΑΣΗ ΤΟΥ ΧΑΡΑΚΤΗΡΙΣΤΙΚΟΥ ΤΩΝ ΡΥΘΜΙΣΤΙΚΩΝ Τ- ΚΥΤΤΑΡΩΝ ΓΟΝΙΔΙΟΥ Foxp3 ΣΤΟΝ ΚΑΡΚΙΝΟ ΤΟΥ ΠΝΕΥΜΟΝΑ Μονάδα Ανοσολογίας Καρκίνου, Εργαστήριο Ανοσολογίας-Ιστοσυμβατότητας Πνευμονολογική Κλινική, Πανεπιστημιακό Νοσοκομείο Λάρισας Τμήμα Ιατρικής, Πανεπιστήμιο Θεσσαλίας ΕΚΦΡΑΣΗ ΤΟΥ ΧΑΡΑΚΤΗΡΙΣΤΙΚΟΥ ΤΩΝ ΡΥΘΜΙΣΤΙΚΩΝ

Διαβάστε περισσότερα

ΕΡΕΥΝΗΤΙΚΕΣ ΕΦΑΡΜΟΓΕΣ ΤΗΣ ΚΥΤΤΑΡΟΜΕΤΡΙΑΣ ΡΟΗΣ

ΕΡΕΥΝΗΤΙΚΕΣ ΕΦΑΡΜΟΓΕΣ ΤΗΣ ΚΥΤΤΑΡΟΜΕΤΡΙΑΣ ΡΟΗΣ ΕΡΕΥΝΗΤΙΚΕΣ ΕΦΑΡΜΟΓΕΣ ΤΗΣ ΚΥΤΤΑΡΟΜΕΤΡΙΑΣ ΡΟΗΣ Σπυριδούλα Βασιλείου Βιολόγος, PhD Αιματολογική Κλινική-Μονάδα Μεταμόσχευσης Μυελού Οστών, Γ.Ν.Α. Κυτταρομετρία Ροής (ΚΡ): απαραίτητο εργαλείο

Διαβάστε περισσότερα

ΘΕΜΑ Α. Α1 δ Α2 γ Α3 β Α4 γ Α5 β ΘΕΜΑ Β 3-2 - 5-1 - 6-4. α-dna πολυμεράση β-πριμόσημα γ- DNA δεσμάση δ- DNA ελικάση ε- RNA πολυμεράση

ΘΕΜΑ Α. Α1 δ Α2 γ Α3 β Α4 γ Α5 β ΘΕΜΑ Β 3-2 - 5-1 - 6-4. α-dna πολυμεράση β-πριμόσημα γ- DNA δεσμάση δ- DNA ελικάση ε- RNA πολυμεράση ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΚΑΙ ΕΠΑΛ (ΟΜΑΔΑ Β ) Τετάρτη, 4 Ιουνίου 2014 - ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗ ΚΑΤΕΥΘΥΝΣΗΣ ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ Α Α1 δ Α2 γ Α3 β Α4 γ Α5 β ΘΕΜΑ Β

Διαβάστε περισσότερα

Σύγχρονες μεθοδολογίες μοριακής βιολογίας και γενετικής στη γυναικολογία

Σύγχρονες μεθοδολογίες μοριακής βιολογίας και γενετικής στη γυναικολογία ΣΥΓΧΡΟΝΕΣ ΜΕΘΟΔΟΛΟΓΙΕΣ ΜΟΡΙΑΚΗΣ ΒΙΟΛΟΓΙΑΣ - ΓΕΝΕΤΙΚΗΣ Σύγχρονες μεθοδολογίες μοριακής βιολογίας και γενετικής στη γυναικολογία ΠΑΠΑΝΙΚΟΛΑΟΥ ΕΛΕΝΗ, Ph.D. Λέκτορας Εργαστήριο Βιολογίας, Ιατρική Σχολή Αθηνών

Διαβάστε περισσότερα

Σας αποστέλλουμε τις προτεινόμενες απαντήσεις που αφορούν τα θέματα της Βιολογίας Γενικής Παιδείας των Ημερησίων Γενικών Λυκείων και ΕΠΑΛ (Ομάδας Β ).

Σας αποστέλλουμε τις προτεινόμενες απαντήσεις που αφορούν τα θέματα της Βιολογίας Γενικής Παιδείας των Ημερησίων Γενικών Λυκείων και ΕΠΑΛ (Ομάδας Β ). Αθήνα, 20/5/2015 ΠΑΝΕΛΛΗΝΙΑ ΕΝΩΣΗ ΒΙΟΕΠΙΣΤΗΜΟΝΩΝ Σας αποστέλλουμε τις προτεινόμενες απαντήσεις που αφορούν τα θέματα της Βιολογίας Γενικής Παιδείας των Ημερησίων Γενικών Λυκείων και ΕΠΑΛ (Ομάδας Β ). Η

Διαβάστε περισσότερα

ΦΥΛΟΣΥΝΔΕΤΗ ΑΓΑΜΜΑΣΦΑΙΡΙΝΑΙΜΙΑ (Χ-α-γ-σφαιριναιμία) X-Linked Agammaglobulinaemia (XLA)

ΦΥΛΟΣΥΝΔΕΤΗ ΑΓΑΜΜΑΣΦΑΙΡΙΝΑΙΜΙΑ (Χ-α-γ-σφαιριναιμία) X-Linked Agammaglobulinaemia (XLA) INTERNATIONAL PATIENT ORGANISATION FOR PRIMARY IMMUNODEFICIENCIES ΠΑΓΚΟΣΜΙΟΣ ΟΡΓΑΝΙΣΜΟΣ ΑΣΘΕΝΩΝ ΓΙΑ ΠΡΩΤΟΠΑΘΕΙΣ ΑΝΟΣΟANΕΠΑΡΚΕΙΕΣ ΦΥΛΟΣΥΝΔΕΤΗ ΑΓΑΜΜΑΣΦΑΙΡΙΝΑΙΜΙΑ X-Linked Agammaglobulinaemia (XLA) ΑΡΜΟΝΙΑ

Διαβάστε περισσότερα

Α3. Η εισαγωγή ανασυνδυασμένου DNA σε βακτήριο-ξενιστή ονομάζεται α. μικροέγχυση β. μετασχηματισμός γ. εμβολιασμός δ. κλωνοποίηση.

Α3. Η εισαγωγή ανασυνδυασμένου DNA σε βακτήριο-ξενιστή ονομάζεται α. μικροέγχυση β. μετασχηματισμός γ. εμβολιασμός δ. κλωνοποίηση. ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΚΑΙ ΕΠΑΛ (ΟΜΑΔΑ Β ) TETAPTH 4 IOYNIOY 2014 - ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΣΥΝΟΛΟ ΣΕΛΙΔΩΝ: ΠΕΝΤΕ (5) ΘΕΜΑ Α Να γράψετε στο τετράδιό

Διαβάστε περισσότερα

ΔΙΑΦΟΡΕΣ ΑΣΚΗΣΕΙΣ ΣΤΟ 1 ΚΕΦΑΛΑΙΟ

ΔΙΑΦΟΡΕΣ ΑΣΚΗΣΕΙΣ ΣΤΟ 1 ΚΕΦΑΛΑΙΟ 1 ΔΙΑΦΟΡΕΣ ΑΣΚΗΣΕΙΣ ΣΤΟ 1 ΚΕΦΑΛΑΙΟ Το μόριο DNA μιας χρωματίδας μεταφασικού χωμοσώματος ενός φυσιολογικού ευκαρυωτικού κυττάρου περιέχει το 29% των νουκλεoτιδίων του με αζωτούχα βάση την T. a. Ποιο είναι

Διαβάστε περισσότερα

1 ο ΔΙΑΓΩΝΙΣΜΑ ΒΙΟΛΟΓΙΑΣ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ

1 ο ΔΙΑΓΩΝΙΣΜΑ ΒΙΟΛΟΓΙΑΣ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ 1 ο ΔΙΑΓΩΝΙΣΜΑ ΒΙΟΛΟΓΙΑΣ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ ΘΕΜΑ 1 ο Α. Στις ερωτήσεις 1-5 να γράψετε στο τετράδιό σας τον αριθμό της ερώτησης και δίπλα του το γράμμα που αντιστοιχεί στη σωστή απάντηση. 1. Οι ομοιοστατικοί

Διαβάστε περισσότερα

Κεφάλαιο 20 Η ρύθμιση της γονιδιακής έκφρασης στους ευκαρυωτικούς οργανισμούς

Κεφάλαιο 20 Η ρύθμιση της γονιδιακής έκφρασης στους ευκαρυωτικούς οργανισμούς Κεφάλαιο 20 Η ρύθμιση της γονιδιακής έκφρασης στους ευκαρυωτικούς οργανισμούς Πυρίνας ανθρώπινου μεσοφασικού κυττάρου στον οποίο παρατηρούμε, με ανοσοφθορισμό, τη διάστικτη κατανομή της απακετυλάσης των

Διαβάστε περισσότερα

ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ ΓΕΝΙΚΗΣ ΠΑΙ ΕΙΑΣ Β ΛΥΚΕΙΟΥ ΑΠΟ ΤΟ ΒΙΒΛΙΟ ΜΟΥ (YΠΟ ΕΚ ΟΣΗ): ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙ ΕΙΑΣ Β ΛΥΚΕΙΟΥ

ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ ΓΕΝΙΚΗΣ ΠΑΙ ΕΙΑΣ Β ΛΥΚΕΙΟΥ ΑΠΟ ΤΟ ΒΙΒΛΙΟ ΜΟΥ (YΠΟ ΕΚ ΟΣΗ): ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙ ΕΙΑΣ Β ΛΥΚΕΙΟΥ ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ ΓΕΝΙΚΗΣ ΠΑΙ ΕΙΑΣ Β ΛΥΚΕΙΟΥ ΑΠΟ ΤΟ ΒΙΒΛΙΟ ΜΟΥ (YΠΟ ΕΚ ΟΣΗ): ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙ ΕΙΑΣ Β ΛΥΚΕΙΟΥ (Περιέχει 67 ερωτήσεις θεωρίας µε απαντήσεις, 116 ασκήσεις ανοικτού- κλειστού τύπου µε µ

Διαβάστε περισσότερα

A5. Μονάδες 5 ΘΕΜΑ B B1. Μονάδες 8 B2. Μονάδες 6 B3. Μονάδες 6 B4. Μονάδες 5 ΘΕΜΑ Γ Γ1. Μονάδες 18

A5. Μονάδες 5 ΘΕΜΑ B B1. Μονάδες 8 B2. Μονάδες 6 B3. Μονάδες 6 B4. Μονάδες 5 ΘΕΜΑ Γ Γ1. Μονάδες 18 ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ ΕΙΣΑΓΩΓΙΚΕΣ ΕΞΕΤΑΣΕΙΣ ΤΕΚΝΩΝ ΕΛΛΗΝΩΝ ΤΟΥ ΕΞΩΤΕΡΙΚΟΥ ΚΑΙ ΤΕΚΝΩΝ ΕΛΛΗΝΩΝ ΥΠΑΛΛΗΛΩΝ ΣΤΟ ΕΞΩΤΕΡΙΚΟ ΤΕΤΑΡΤΗ 7 ΣΕΠΤΕΜΒΡΙΟΥ 2011 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ: ΒΙΟΛΟΓΙΑ ΣΥΝΟΛΟ ΣΕΛΙ ΩΝ:

Διαβάστε περισσότερα

ÏÑÏÓÇÌÏ ÅËÁÓÓÏÍÁ Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗ ΚΑΤΕΥΘΥΝΣΗ ΒΙΟΛΟΓΙΑ ΑΠΑΝΤΗΣΕΙΣ. Απάντηση στο 1 ο Θέµα 1. α 2. γ 3. δ 4. β 5. β.

ÏÑÏÓÇÌÏ ÅËÁÓÓÏÍÁ Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗ ΚΑΤΕΥΘΥΝΣΗ ΒΙΟΛΟΓΙΑ ΑΠΑΝΤΗΣΕΙΣ. Απάντηση στο 1 ο Θέµα 1. α 2. γ 3. δ 4. β 5. β. 1 Απάντηση στο 1 ο Θέµα 1. α 2. γ 3. δ 4. β 5. β Απάντηση στο 2 ο Θέµα Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗ ΚΑΤΕΥΘΥΝΣΗ ΒΙΟΛΟΓΙΑ ΑΠΑΝΤΗΣΕΙΣ 1. Σχολικό σελ. 17 από «Το DNA τον έλεγχο της σύνθεσης των πρωτεϊνών». 2. Α. Τα χρωµοσώµατα

Διαβάστε περισσότερα

ΑΠΑΝΤΗΣΕΙΣ. ΘΕΜΑ Α Να επιλέξετε τη φράση που συμπληρώνει ορθά κάθε μία από τις ακόλουθες προτάσεις:

ΑΠΑΝΤΗΣΕΙΣ. ΘΕΜΑ Α Να επιλέξετε τη φράση που συμπληρώνει ορθά κάθε μία από τις ακόλουθες προτάσεις: ΑΡΧΗ 1ΗΣ ΣΕΛΙΔΑΣ Γ ΤΑΞΗ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΚΑΙ ΕΠΑΛ (ΟΜΑΔΑ Β ) ΠΑΡΑΣΚΕΥΗ 25/04/2014 - ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΣΥΝΟΛΟ ΣΕΛΙΔΩΝ: ΔΩΔΕΚΑ (12) ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ Α Να επιλέξετε τη φράση που

Διαβάστε περισσότερα

ΥΠΟΔΕΙΓΜΑΤΙΚΑ ΛΥΜΕΝΕΣ ΑΣΚΗΣΕΙΣ ΚΕΦ. 1ο

ΥΠΟΔΕΙΓΜΑΤΙΚΑ ΛΥΜΕΝΕΣ ΑΣΚΗΣΕΙΣ ΚΕΦ. 1ο ΥΠΟΔΕΙΓΜΑΤΙΚΑ ΛΥΜΕΝΕΣ ΑΣΚΗΣΕΙΣ ΚΕΦ. 1ο ΔΙΑΓΡΑΜΜΑΤΑ 1. Ένας άνθρωπος μολύνεται από έναν ιό. Το παρακάτω διάγραμμα απεικονίζει τις συγκεντρώσεις των αντιγόνων και των αντισωμάτων αυτού του ανθρώπου κατά

Διαβάστε περισσότερα

ΦΡΟΝΤΙΣΤΗΡΙΟ ΜΕΣΗΣ ΕΚΠΑΙΔΕΥΣΗΣ ΗΡΑΚΛΕΙΤΟΣ

ΦΡΟΝΤΙΣΤΗΡΙΟ ΜΕΣΗΣ ΕΚΠΑΙΔΕΥΣΗΣ ΗΡΑΚΛΕΙΤΟΣ ΠΑΝΕΛΛΗΝΙΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΚΑΙ ΕΠΑΛ (ΟΜΑΔΑ Β') ΠΑΡΑΣΚΕΥΗ 22 ΜΑΪΟΥ 2015 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Ε Ν Δ Ε Ι Κ Τ Ι Κ Ε Σ Α Π Α Ν Τ Η Σ Ε Ι Σ Θ Ε Μ Α Τ

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ 22 ΜΑΪΟΥ 2015 ΑΠΑΝΤΗΣΕΙΣ

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ 22 ΜΑΪΟΥ 2015 ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ Α Α1. Β Α2. Γ Α3. Α Α4. Α5. Γ ΘΕΜΑ Β ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ 22 ΜΑΪΟΥ 2015 ΑΠΑΝΤΗΣΕΙΣ B1. Α (Σωµατικά κύτταρα στην αρχή της µεσόφασης): 1, 4, 5, 6 Β (Γαµέτες): 2, 3, 7, 8 Β2. (Κάθε

Διαβάστε περισσότερα

BIO111 Μικροβιολογια ιαλεξη 13 Μικροβια και Ανθρωπος

BIO111 Μικροβιολογια ιαλεξη 13 Μικροβια και Ανθρωπος BIO111 Μικροβιολογια ιαλεξη 13 Μικροβια και Ανθρωπος Ετσι αρχισε η Ζωη? To δεντρο της Ζωης Και τι µας νοιαζει αν υπαρχουν µικροοργανισµοι η οχι? H ανυπολόγιστη αξία της Mικροβιολογίας για τη Βιολογια Το

Διαβάστε περισσότερα