ΠΑΝΕΠΙΣΤΗΜΙΟ ΠΑΤΡΩΝ ΣΧΟΛΗ ΕΠΙΣΤΗΜΩΝ ΥΓΕΙΑΣ ΤΜΗΜΑ ΙΑΤΡΙΚΗΣ ΠΑΘΟΛΟΓΙΚΗ ΚΛΙΝΙΚΗ-EN ΟΚΡΙΝΟΛΟΓΙΚΟ ΤΜΗΜΑ ΙΕΥΘΥΝΤΗΣ: ΚΑΘΗΓΗΤΗΣ ΑΠΟΣΤΟΛΟΣ ΒΑΓΕΝΑΚΗΣ

Μέγεθος: px
Εμφάνιση ξεκινά από τη σελίδα:

Download "ΠΑΝΕΠΙΣΤΗΜΙΟ ΠΑΤΡΩΝ ΣΧΟΛΗ ΕΠΙΣΤΗΜΩΝ ΥΓΕΙΑΣ ΤΜΗΜΑ ΙΑΤΡΙΚΗΣ ΠΑΘΟΛΟΓΙΚΗ ΚΛΙΝΙΚΗ-EN ΟΚΡΙΝΟΛΟΓΙΚΟ ΤΜΗΜΑ ΙΕΥΘΥΝΤΗΣ: ΚΑΘΗΓΗΤΗΣ ΑΠΟΣΤΟΛΟΣ ΒΑΓΕΝΑΚΗΣ"

Transcript

1 ΠΑΝΕΠΙΣΤΗΜΙΟ ΠΑΤΡΩΝ ΣΧΟΛΗ ΕΠΙΣΤΗΜΩΝ ΥΓΕΙΑΣ ΤΜΗΜΑ ΙΑΤΡΙΚΗΣ ΠΑΘΟΛΟΓΙΚΗ ΚΛΙΝΙΚΗ-EN ΟΚΡΙΝΟΛΟΓΙΚΟ ΤΜΗΜΑ ΙΕΥΘΥΝΤΗΣ: ΚΑΘΗΓΗΤΗΣ ΑΠΟΣΤΟΛΟΣ ΒΑΓΕΝΑΚΗΣ Η ΣΧΕΣΗ ΤΗΣ ΚΛΙΝΙΚΗΣ ΚΑΙ ΥΠΟΚΛΙΝΙΚΗΣ ΜΟΡΦΗΣ ΑΙΜΟΧΡΩΜΑΤΩΣΕΩΣ ΜΕ ΤΟ ΣΑΚΧΑΡΩ Η ΙΑΒΗΤΗ ΙΩΑΝΝΗΣ ΧΑΜΠΑΙΟΣ ΙΑΤΡΟΣ Ι ΑΚΤΟΡΙΚΗ ΙΑΤΡΙΒΗ ΠΑΤΡΑ

2 ΤΡΙΜΕΛΗΣ ΕΞΕΤΑΣΤΙΚΗ ΕΠΙΤΡΟΠΗ ΑΠΟΣΤΟΛΟΣ ΒΑΓΕΝΑΚΗΣ ΚΑΘΗΓΗΤΗΣ ΠΑΘΟΛΟΓΙΑΣ ΠΑΝΕΠΙΣΤΗΜΙΟΥ ΠΑΤΡΩΝ ΕΠΙΒΛΕΠΩΝ ΚΑΘΗΓΗΤΗΣ ΑΓΑΘΟΚΛΗΣ ΨΥΡΟΓΙΑΝΝΗΣ ΕΠ. ΚΑΘΗΓΗΤΗΣ ΠΑΘΟΛΟΓΙΑΣ ΠΑΝΕΠΙΣΤΗΜΙΟΥ ΠΑΤΡΩΝ ΜΕΛΟΣ ΤΡΙΜΕΛΟΥΣ ΣΥΜΒΟΥΛΕΥΤΙΚΗΣ ΕΠΙΤΡΟΠΗΣ ΠΑΝΑΓΙΩΤΑ ΜΑΤΣΟΥΚΑ ΕΠ. ΚΑΘΗΓΗΤΡΙΑ ΑΙΜΑΤΟΛΟΓΙΑΣ ΠΑΝΕΠΙΣΤΗΜΙΟΥ ΠΑΤΡΩΝ ΜΕΛΟΣ ΤΡΙΜΕΛΟΥΣ ΣΥΜΒΟΥΛΕΥΤΙΚΗΣ ΕΠΙΤΡΟΠΗΣ ΕΠΤΑΜΕΛΗΣ ΕΞΕΤΑΣΤΙΚΗ ΕΠΙΤΡΟΠΗ ΑΠΟΣΤΟΛΟΣ ΒΑΓΕΝΑΚΗΣ ΚΑΘΗΓΗΤΗΣ ΠΑΘΟΛΟΓΙΑΣ ΠΑΝΕΠΙΣΤΗΜΙΟΥ ΠΑΤΡΩΝ ΕΠΙΒΛΕΠΩΝ ΚΑΘΗΓΗΤΗΣ ΑΓΑΘΟΚΛΗΣ ΨΥΡΟΓΙΑΝΝΗΣ ΕΠ. ΚΑΘΗΓΗΤΗΣ ΠΑΘΟΛΟΓΙΑΣ ΠΑΝΕΠΙΣΤΗΜΙΟΥ ΠΑΤΡΩΝ ΜΕΛΟΣ ΤΡΙΜΕΛΟΥΣ ΣΥΜΒΟΥΛΕΥΤΙΚΗΣ ΕΠΙΤΡΟΠΗΣ ΠΑΝΑΓΙΩΤΑ ΜΑΤΣΟΥΚΑ ΕΠ. ΚΑΘΗΓΗΤΡΙΑ ΑΙΜΑΤΟΛΟΓΙΑΣ ΠΑΝΕΠΙΣΤΗΜΙΟΥ ΠΑΤΡΩΝ ΜΕΛΟΣ ΤΡΙΜΕΛΟΥΣ ΣΥΜΒΟΥΛΕΥΤΙΚΗΣ ΕΠΙΤΡΟΠΗΣ 2

3 ΝΙΚΟΛΑΟΣ ΖΟΥΜΠΟΣ ΚΑΘΗΓΗΤΗΣ ΑΙΜΑΤΟΛΟΓΙΑΣ ΠΑΝΕΠΙΣΤΗΜΙΟΥ ΠΑΤΡΩΝ ΜΕΛΟΣ ΕΠΤΑΜΕΛΟΥΣ ΣΥΜΒΟΥΛΕΥΤΙΚΗΣ ΕΠΙΤΡΟΠΗΣ ΑΘΑΝΑΣΙΟΣ ΣΚΟΥΤΕΛΗΣ ΚΑΘΗΓΗΤΗΣ ΠΑΘΟΛΟΓΙΑΣ ΠΑΝΕΠΙΣΤΗΜΙΟΥ ΠΑΤΡΩΝ ΜΕΛΟΣ ΕΠΤΑΜΕΛΟΥΣ ΣΥΜΒΟΥΛΕΥΤΙΚΗΣ ΕΠΙΤΡΟΠΗΣ ΑΘΑΝΑΣΙΟΣ ΠΑΠΑΒΑΣΙΛΕΙΟΥ ΚΑΘΗΓΗΤΗΣ ΒΙΟΧΗΜΕΙΑΣ ΠΑΝΕΠΙΣΤΗΜΙΟΥ ΠΑΤΡΩΝ ΜΕΛΟΣ ΕΠΤΑΜΕΛΟΥΣ ΣΥΜΒΟΥΛΕΥΤΙΚΗΣ ΕΠΙΤΡΟΠΗΣ ΒΕΝΕΤΣΑΝΑ ΚΥΡΙΑΖΟΠΟΥΛΟΥ ΕΠ. ΚΑΘΗΓΗΤΡΙΑ ΕΝ ΟΚΡΙΝΟΛΟΓΙΑΣ ΠΑΝΕΠΙΣΤΗΜΙΟΥ ΠΑΤΡΩΝ ΜΕΛΟΣ ΕΠΤΑΜΕΛΟΥΣ ΣΥΜΒΟΥΛΕΥΤΙΚΗΣ ΕΠΙΤΡΟΠΗΣ 3

4 ΣΤΗ ΓΥΝΑΙΚΑ ΜΟΥ ΣΤΟ ΓΙΩΡΓΟ ΚΑΙ ΤΗΝ ΕΥΗ 4

5 ΠΡΟΛΟΓΟΣ σελίδα 5 ΚΑΤΑΛΟΓΟΣ ΣΥΝΤΜΗΣΕΩΝ σελίδα 6 ΕΙΣΑΓΩΓΗ σελίδα 10 ΣΑΚΧΑΡΩ ΗΣ ΙΑΒΗΤΗΣ σελίδα 12 ΚΑΤΑΝΟΜΗ ΣΙ ΗΡΟΥ σελίδα 19 ΡΥΘΜΙΣΗ ΑΠΟΡΟΦΗΣΗΣ ΣΙ ΗΡΟΥ σελίδα 22 ΤΟΞΙΚΗ ΡΑΣΗ ΣΙ ΗΡΟΥ σελίδα 29 ΜΟΡΙΑΚΟΙ ΜΗΧΑΝΙΣΜΟΙ ΚΑΙ ΟΜΟΙΟΣΤΑΣΙΑ ΤΟΥ ΕΝ ΟΚΥΤΑΡΙΟΥ ΣΙ ΗΡΟΥ σελίδα 30 ΤΟ ΓΟΝΙ ΙΟ HFE σελίδα 33 ΕΠΙ ΗΜΙΟΛΟΓΙΑ ΚΛΗΡΟΝΟΜΙΚΗΣ ΑΙΜΟΧΡΩΜΑΤΩΣΗΣ σελίδα 40 ΑΙΤΙΕΣ ΣΥΣΣΩΡΕΥΣΗΣ ΣΙ ΗΡΟΥ σελίδα 43 ΚΛΙΝΙΚΑ ΧΑΡΑΚΤΗΡΙΣΤΙΚΑ ΤΗΣ ΚΛΗΡΟΝΟΜΙΚΗΣ ΑΙΜΟΧΡΩΜΑΤΩΣΗΣ σελίδα 45 ΙΑΓΝΩΣΗ σελίδα 49 ΘΕΡΑΠΕΙΑ ΤΗΣ ΚΛΗΡΟΝΟΜΙΚΗΣ ΑΙΜΟΧΡΩΜΑΤΩΣΗΣ σελίδα 51 ΑΙΜΟΧΡΩΜΑΤΩΣΗ ΚΑΙ ΣΑΚΧΑΡΩ ΗΣ ΙΑΒΗΤΗΣ σελίδα 52 ΣΚΟΠΟΣ ΤΗΣ ΜΕΛΕΤΗΣ σελίδα 57 ΣΧΕ ΙΑΣΜΟΣ ΤΗΣ ΜΕΛΕΤΗΣ σελίδα 58 ΥΛΙΚΑ ΚΑΙ ΜΕΘΟ ΟΙ σελίδα 60 ΑΠΟΤΕΛΕΣΜΑΤΑ σελίδα 71 ΣΥΖΗΤΗΣΗ σελίδα 88 ΑΝΑΦΟΡΕΣ σελίδα 93 5

6 ΠΡΟΛΟΓΟΣ Αισθανόµενος την υποχρέωση να ευχαριστήσω όσους συνέβαλαν στην επιτυχή περάτωση της παρούσης διατριβής, αναφέροµαι ιδιαίτερα στον διευθυντή µου, καθηγητή κ Απόστολο Βαγενάκη, καθοδηγητή και ουσιαστικό αρωγό στην επιστηµονικά σωστή ανάλυση και σύνθεση των δεδοµένων που απετέλεσαν την δοµή της εργασίας, µη παραβλέποντας την ηθική του υποστήριξη. Θα ήταν παράλειψη η µη αναφορά στην καθοριστική συµβολή του διευθυντού του εργαστηρίου βιολογικής χηµείας, καθηγητού κ Αθανάσιου Παπαβασιλείου στο εργαστήριο του οποίου διενεργήθηκε το πειραµατικό στάδιο της εργασίας. Ευχαριστώ πολύ τον κ Αγαθοκλή Ψυρόγιαννη επ. καθηγητή παθολογίας του πανεπιστηµίου Πατρών και διευθυντή του διαβητολογικού κέντρου όπως και την κυρία Ματσουκά επ. καθηγήτρια παθολογίας του πανεπιστηµίου Πατρών για τις εύστοχες παρατηρήσεις τους, συµβάλλοντας στην αρτιότερη παρουσίαση της διατριβής. Εκφράζω τις ευχαριστίες µου στην επιτροπή ερευνών του πανεπιστηµίου Πατρών µέσω της οποίας και δια του οικονοµικού προγράµµατος «Κ Καραθεοδωρή» εξασφαλίστικε η υλικοτεχνική υποδοµή της παρούσης µελέτης. Τέλος ευχαριστώ όλους εκείνους, οι οποίοι συνέβαλαν ουσιαστικά στην περάτωση της παρούσης µελέτης από διάφορες άλλες θέσεις. 6

7 ΚΑΤΑΛΟΓΟΣ ΣΥΝΤΜΗΣΕΩΝ ΚΑΙ ΑΓΓΛΙΚΩΝ ΟΡΩΝ HFE: Το γονίδιο της κλασσικής αιµοχρωµάτωσης C282Y: Σηµειακή µετάλλαξη µε αποτέλεσµα αλλαγή του αµινοξέος κυστείνη στη θέση 282 µε το αµινοξύ τυροσίνη. H63D: Σηµειακή µετάλλαξη µε αποτέλεσµα αλλαγή του αµινοξέος ιστιδίνη στη θέση 63 µε το αµινοξύ ασπαρτικό οξύ. HDL: (High density lipoproteins): Υψηλής πυκνότητος λιποπρωτείνες. LDL: (Low density lipoproteins): Χαµηλής πυκνότητος λιποπρωτείνες. M.O.D.Y: (Maturity onset diabetes of the youth): Σακχαρώδης διαβήτης τύπου ενηλίκων εµφανιζόµενος σε νεαρά άτοµα και κληρονοµείται κατά τον σωµατικό επικρατούντα χαρακτήρα. HNF-1a: (Hepatocyte nuclear factor-1a): Ηπατοκυτταρικός παράγων 1 α. HNF-4a: (Hepatocyte nuclear factor-4a): Ηπατοκυτταρικός παράγων 4 α. ADA: (American diabetes association): Αµερικανική διαβητολογική εταιρεία. OGTT: (Oral glucose tolerance test): οκιµασία ανοχής γλυκόζης. Fe: (iron): Σίδηρος. TfR: (Transferin receptor): Υποδοχέας τρανσφερίνης. DMT1: (Divalent metal transporter1): Μεταφορέας δισθενών µετάλλων τύπου 1. Transferin: Τρανσφερίνη. Hepcidin: Πρωτείνη ηπατικής προέλευσης που κυκλοφορεί στο πλάσµα και επηρεάζει την απορρόφηση σιδήρου από το έντερο.της έχει αποδοθεί ο ρόλος του ρυθµιστού των αποθηκών του οργανισµού σε σίδηρο (stores regulator). Ferroportin 1: Μεταφορέας σιδήρου στην κυτταροπλασµατική µεµβράνη. 7

8 Hephaestin: Μεµβρανική πρωτείνη επικουρική της Ferroportin 1 στη µεταφορά του σιδήρου µε ιδιότητες οξειδοαναγωγάσης. IRE (Iron response element): Ρυθµιστική περιοχή στον απαγωγέα γονιδίων όπου προσδένονται οι πρωτείνες ανίχνευσης των επιπέδων σιδήρου και µε αυτό τον τρόπο επηρεάζουν τον ρυθµό µεταγραφής των γονιδίων αυτών. IRP (Iron response protein): πρωτείνη ανίχνευσης των επιπέδων σιδήρου του κυττάρου. MHC (Major histocompatibility complex):κυριο σύστηµα ιστοσυµβατότητας. Screening: οκιµασία επιλογής των δειγµάτων. TIBC (Total iron binding capacity): Ολική δεσµευτική ικανότητα σιδήρου του ορού. UIBC (Unbound iron binding capacity): Ποσότητα τρανσφερίνης που δεν έχει δεσµεύσει σίδηρο. PCR (polymerase chain reaction): Αλυσιδωτή αντίδραση πολυµεράσης. RFLP (Restriction fragment length polymorphism). SPSS: Στατιστικό πρόγραµµα Rsa1: Ενζυµο περιορισµού. Dpn2: Ενζυµο περιορισµού. Linkage disequelibrium: Γενετική σύνδεση. Insulin resistance syndrome: Μεταβολικό σύνδροµο. Hepatic iron overload-hio: αυξηµένο φορτίο ήπατος σε σίδηρο. TBE: Tris- borate-edta. Ethidium bromide: Βρωµιούχο αιθίδιο. Proteinase K: Πρωτεινική κινάση Κ. SDS (sodium dodesyl sulphate). d NTPs (deoxy nucleotide triphosphate): εοξυνουκλεοτίδια τριφωσφορικά. BSA (bovine serum albumin): Αλβουµίνη ορού βοοειδών. 8

9 MS-PCR (Mutant specific polymerase chain reaction): Αλυσιδωτή αντίδραση πολυµεράσης µε υποκκινητές ικανούς να προσδένονται µε ειδικότητα και να ξεχωρίζουν το φυσιολογικό γονίδιο απο το µεταλλαγµένο. T-TEST: Στατιστική δοκιµασία σύγκρισης των µέσων τιµών αριθµητικής µεταβλητής ανάµεσα σε δύο δείγµατα, αντιπροσωπευτικά του πληθυσµού. ΠΠΓΝΠ: Πανεπιστηµιακό περιφερειακό γενικό νοσοκοµείο Πατρών. Σ : Σακχαρώδης διαβήτης. 9

10 ΓΕΝΙΚΟ ΜΕΡΟΣ ΚΛΗΡΟΝΟΜΙΚΗ ΑΙΜΟΧΡΩΜΑΤΩΣΗ ΚΑΙ ΣΑΚΧΑΡΩ ΗΣ ΙΑΒΗΤΗΣ 10

11 ΕΙΣΑΓΩΓΗ Η κληρονοµική αιµοχρωµάτωση είναι µια συχνή κληρονοµική διαταραχή του µεταβολισµού του σιδήρου που χαρακτηρίζεται από προοδευτική εναπόθεση σιδήρου στα παρεγχυµατικά κύτταρα του ήπατος, παγκρέατος, καρδιάς, δέρµατος, αρθρώσεων, υποφύσεως και άλλων οργάνων που τελικά τα οδηγεί σε ανεπάρκειά τους. Το κλινικό σύνδροµο του σακχαρώδη διαβήτη, της κιρρώσεως του ήπατος και της υπέρχρωσης του δέρµατος, περιγράφτηκε αρχικά το 1865 από τον Trousseau. 1 Το 1935,ο Joseph Seldon κατέληξε στο συµπέρασµα ότι η νόσος είναι οικογενής και οφείλεται σε διαταραχή του µεταβολισµού του σιδήρου. Η απόδειξη για την γενετική φύση της νόσου ήρθε 41 χρόνια αργότερα όταν ο Simon 2 έδειξε τη στενή συσχέτιση της αιµοχρωµάτωσης µε το αντιγόνο ιστοσυµβατότητας HLA-A3. Το γονίδιο της κληρονοµικής αιµοχρωµάτωσης (HFE) παρέµενε άγνωστο µέχρι το 1996, όταν οµάδα ερευνητών της Mercator genetics ανακάλυψε το γονίδιο χρησιµοποιώντας την τεχνική positional cloning 3. Το γονίδιο φάνηκε ότι µοιάζει µε τα γονίδια του συστήµατος ιστοσυµβατότητος (MHC 1). Μελέτες στη συνέχεια έδειξαν ότι 85%-90% των ασθενών µε κλινικά χαρακτηριστικά κληρονοµικής αιµοχρωµάτωσης ήσαν οµόζυγοι µε µετάλλαξη στο νουκλεοτίδιο 845 από G σε A µε αποτέλεσµα αντικατάσταση του αµινοξέως κυστείνη στη θέση 282 µε το αµινοξύ τυροσίνη (C282Y). 3-9 Μία δεύτερη µετάλλαξη του HFE (C σε G στο νουκλεοτίδιο 187) έχει σαν αποτέλεσµα αντικατάσταση του αµινοξέως ιστιδίνη στη θέση 63 µε ασπαρτκό οξύ (H63D). Η µετάλλαξη αυτή, δεν επηρεάζει την εναπόθεση σιδήρου στόν ίδιο βαθµό µε την µετάλλαξη C282Y. 3 Τελευταία περιγράφτηκαν ποντίκια χωρίς το γονίδιο HFE (HFE knockout mice) που παρουσίασαν µεταβολές στο µεταβολισµό του σιδήρου παρόµοιες µε αυτές 11

12 που παρατηρούνται σε ανθρώπους µε κληρονοµική αιµοχρωµάτωση, πράγµα που υποστηρίζει την άποψη ότι µεταλλάξεις στο γονίδιο HFE είναι δυνατόν να προκαλέσουν κληρονοµική αιµοχρωµάτωση. 10 Η ανακάλυψη του γονιδίου HFE αναθέρµανε το ερευνητικό ενδιαφέρον τόσο σε επίπεδο κλινικής όσο και βασικής έρευνας. Οι γενετικές εξετάσεις για την εύρεση µεταλλάξεων του γονιδίου HFE παρέχουν ένα εύκολο τρόπο για τη διάγνωση, τη µελέτη οικογενειών όπως και για τον προληπτικό έλεγχο του γενικού πληθυσµού. Ο καθορισµός της πρωτείνης του γονιδίου HFE είναι πολύ πιθανό να διευκρινίσει θέµατα που αφορούν το µεταβολισµό του σιδήρου, τους µηχανισµούς βλάβης του κυττάρου από το σίδηρο και το ρόλο του σιδήρου στο να τροποποιεί τη βλάβη του κυττάρου σε άλλες νοσηρές καταστάσεις όπως η αλκοολική ηπατοπάθεια, η µη αλκοολική στεατοηπατίτιδα, η ηπατίτιδα C, η δερµατική πορφυρία, ο σακχαρώδης διαβήτης. 12

13 ΣΑΚΧΑΡΩ ΗΣ ΙΑΒΗΤΗΣ Σακχαρώδης διαβήτης είναι µία οµάδα µεταβολικών νόσων που χαρακτηρίζονται από υπεργλυκαιµία λόγω ελαττωµατικής έκκρισης ινσουλίνης, η δράσης ινσουλίνης, η και των δύο µαζί. Η χρόνια υπεργλυκαιµία του διαβήτη σχετίζεται µε µακροχρόνιες επιπλοκές και ανεπάρκεια διαφόρων οργάνων, ιδιαίτερα των οφθαλµών, των νεφρών, των νεύρων, της καρδιάς και των αγγείων. ιάφοροι παθογενετικοί µηχανισµοί ενέχονται στην ανάπτυξη του διαβήτη. Σε αυτούς περιλαµβάνονται από την αυτοάνοση καταστροφή των β κυττάρων του παγκρέατος µε συνέπεια την ανεπάρκεια ινσουλίνης, µέχρι ανωµαλίες που έχουν σαν επακόλουθο την αντίσταση στη δράση της ινσουλίνης. Η βάση των ανωµαλιών στο µεταβολισµό υδατανθράκων, λιπών και πρωτεινών στο διαβήτη, είναι η υπολειµατική δράση ινσουλίνης στα όργανα στόχους. Υπολειµµατική δράση ινσουλίνης προκύπτει από ανεπαρκή έκκριση η / και µειωµένη απάντηση των ιστών στην ινσουλίνη σε κάποια από τα πολλαπλά και περίπλοκα µονοπάτια της δράσης της. Η πλήρης αιτιολογική κατάταξη του σακχαρώδους διαβήτη φαίνεται στον πίνακα 1. Η µεγάλη πλειοψηφία των περιπτώσεων σακχαρώδη διαβήτη εµπίπτουν σε µία από τις δύο ευρείες κατηγορίες : Σακχαρώδης διαβήτης τύπου 1 και σακχαρώδης διαβήτης τύπου 2. Στην πρώτη περίπτωση, αιτία είναι η απόλυτη ανεπάρκεια ινσουλίνης από αυτοάνοσο καταστροφή των νησιδίων του παγκρέατος. Στη δεύτερη και πολύ πιο συχνή, αιτία είναι ο συνδιασµός αντίστασης στη δράση της ινσουλίνης και ανεπαρκούς αντιρροπιστικής απάντησης του β κυττάρου στις αυξηµένες ανάγκες της περιφέρειας. Τα κύρια κλασσικά όργανα στόχοι της δράσης 13

14 της ινσουλίνης είναι το µυικό κύτταρο, το ηπατοκύτταρο και το λιποκύτταρο, η δε γενετική του τύπου 2 διαβήτη πιστεύεται ότι είναι πολυγονιδιακή. Τα κύρια χαρακτηριστικά του σακχαρώδους διαβήτη τύπου 2 από απόψεως παθοφυσιολογίας υδατανθράκων είναι ελαττωµένη χρησιµοποίηση γλυκόζης από το µυικό κύτταρο, απρόσφορη παραγωγή γλυκόζης από το ηπατοκύτταρο και µη ικανοποιητική έκκριση ινσουλίνης από το β κύτταρο του παγκρέατος. Ο όρος µεταβολικό σύνδροµο περιλαµβάνει το σακχαρώδη διαβήτη (η την παθολογική ανοχή στη γλυκόζη), την αντίσταση στην ινσουλίνη, την παχυσαρκία(συγκεκριµένα την κεντρική παχυσαρκία),την υπέρταση, και την δυσλιπιδαιµία (υψηλά τριγλυκερίδια, χαµηλή HDL και υψηλή η όχι LDL). Άλλες καταστάσεις που σχετίζονται µε αυτό η αποτελούν µέρος του ιδίου συνδρόµου είναι: υπερουριχαιµία, λιπώδες ήπαρ, διαταραχή στο σύστηµα πήξης και ινοδώλυσης. Τελευταία, το φορτίο του ήπατος σε σίδηρο σχετίστηκε µε την αντίσταση στην ινσουλίνη και το µεταβολικό σύνδροµο γενικότερα Tο µεταβολικό σύνδροµο συνδυάζεται µε σηµαντικά αυξηµένη επίπτωση στεφαναίας νόσου, αγγειακών εγκεφαλικών επεισοδίων και περιφερικής αγγειοπάθειας. ιάφορες µορφές σακχαρώδους διαβήτη, σχετίζονται µε ελλείµµατα στην έκκριση ινσουλίνης λόγω βλάβης ενός συγκεκριµένου γονιδίου και µεταβιβάζονται κληρονοµικά κατά τον αυτοσωµατικό επικρατούντα χαρακτήρα µε εκδήλωση υπεργλυκαιµίας γενικά πριν την ηλικία των 25 ετών. Οι µορφές αυτές φέρουν τον τίτλο σακχαρώδης διαβήτης τύπου ενηλίκων που εµφανίζεται στη νεαρή ηλικία(m.o.d.y). Γονίδια που ευθύνονται για αυτές τις µορφές διαβήτη είναι: α) O ηπατοκυτταρικός πυρηνικός παράγων 1α (HNF-1a), ένας µεταγραφικός παράγων που αποτελεί αιτία του MODY3, β) Ο ηπατοκυτταρικός πυρηνικός παράγων 4α (HNF-4a), άλλος µεταγραφικός παράγων που αποτελεί αιτία του MODY1, και η ανεπάρκεια γλυκοκινάσης που αποτελεί αιτία του MODY2. 14

15 Μεταλλάξεις του υποδοχέα της ινσουλίνης, (π.χ τύπου Α αντίσταση στην ινσουλίνη) µπορεί να οδηγήσουν σε σοβαρή αντίσταση στη δράση της ινσουλίνης και σακχαρώδη διαβήτη. ιάφορες ενδοκρινοπάθειες µπορούν να οδηγήσουν στην εµφάνιση σακχαρώδη διαβήτη λόγω είτε µειωµένης παραγωγής ινσουλίνης, είτε αντίστασης στη δράση της ινσουλίνης. Ετσι η ακροµεγαλία προκαλεί ελάττωση της δράσης της ινσουλίνης στο µυικό κύτταρο. Το σύνδροµο Cushing, το γλυκαγόνοµα, ο υπερθυρεοειδισµός και το φαιοχρωµοκύττωµα, προκαλεί απρόσφορο παραγωγή γλυκόζης από το ηπατοκύτταρο, µειωµένη έκκριση ινσουλίνης και µειωµένη δράση ινσουλίνης στο µυικό κύτταρο. Ο υπεραλδοστερονισµός προκαλεί µειωµένη παραγωγή ινσουλίνης και µειωµένη δράση της ινσουλίνης στο µυικό κύτταρο, πιθανόν λόγω της σοβαρής υποκαλιαιµίας που προκαλεί. Νοσήµατα της εξωκρινούς µοίρας του παγκρέατος όπως παγκρεατίτιδα, κυστική ίνωση και αιµοχρωµάτωση προκαλούν κυρίως µειωµένη έκκριση ινσουλίνης. Ειδικά στην κληρονοµική αιµοχρωµάτωση, ο σακχαρώδης διαβήτης οφείλεται στην εναπόθεση σιδήρου τόσο στο β κύτταρο όσο και στο ηπατοκύτταρο. 15

16 Πίνακας 1 Αιτιολογική κατάταξη του σακχαρώδους διαβήτη σύµφωνα µε την ADA Ι. Τύπου 1 διαβήτης Α.ανοσολογικού τύπου Β. ιδιοπαθής ΙΙ. Τύπου 2 διαβήτης ΙΙΙ. Αλλοι ειδικοί τύποι Α. Γενετικές διαταραχές στη λειτουργία του β κυττάρου 1.HNF-1A (MODY3) 2.HNF-4A (MODY1) 3.Γλυκοκινάση 4.Μιτοχονδριακό DNA. Β. Γενετικές διαταραχές στη δράση της ινσουλίνης 1.τύπου Α αντίσταση στην ινσουλίνη 2.συνδροµο Leprechaunism 3.σύνδροµο Rabson-Mendenhall 4.λιποατροφικός διαβήτης Γ. Νοσήµατα της εξωκρινούς µοίρας του παγκρέατος 1.παγκρεατίτιδα 2.τραύµα-παγκρεατεκτοµή 3.νεοπλασία 4.κυστική ίνωση 5.αιµοχρωµάτωση 6.ασβεστοποιός νόσος του παγκρέατος 16

17 . Ενδοκρινοπάθειες 1.µεγαλακρία 2.σύνδροµο cushing 3. γλυκαγόνοµα 4.φαιοχρωµοκύτωµα 5.υπερθυρεοειδισµός 6.σωµατοστατίνωµα 7.αλδοστερόνοµα Ε. Προκαλούµενος από φάρµακα η τοξικές ουσίες 1.Πενταµιδίνη 2.νικοτινικό οξύ 3.γλυκοκορτικοειδή 4.θυροξίνη 5.διαζοξείδιο 6.β αγωνιστές 7.θειαζιδικά διουρητικά 8.διφαινυλυδαντοίνη 9.α-ιντερφερόνη F.Λοιµώξεις 1.συγγενής ερυθρά 2.κυτταροµεγαλοιός ΣΤ.ασυνήθεις µορφές αυτοανοσίας 1.σύνδροµο stiff-man 2.αντισώµατα έναντι του υποδοχέα της ινσουλίνης Ζ.Αλλα γενετικά σύνδροµα που ενδέχεται να σχετίζονται µε σακχαρώδη διαβήτη 1.σύνδροµο Down 17

18 2. σύνδροµο Klinefelter 3 σύνδροµο Turner 4.σύνδροµο Wolfram 5.αταξία Friedreich s 6.χορεία Huntington 7.σύνδροµο Laurence-Moon-Biedl 8.µυοτονική δυστροφία 9.πορφυρία 10.σύνδροµο Prader-Willi ΙV.Σακχαρώδης διαβήτης της εγκυµοσύνης 18

19 Πίνακας 2 Κριτήρια για τη διάγνωση του σακχαρώδους διαβήτη 1.Συµπτώµατα διαβήτη και τυχαία µέτρηση γλυκόζης πλάσµατος >200 mg/dl 2.Γλυκόζη πλάσµατος νηστείας >126 mg/dl 3.Γλυκόζη πλάσµατος>200 mg/dl, δύο ώρες µετά από χορήγηση 75 γραµµαρίων γλυκόζης από το στόµα.(ogt Πίνακας 3 Κριτήρια για τη διάγνωση διαταραχής στην ανοχή γλυκόζης 1.Γλυκόζη νηστείας Γλυκόζη πλάσµατος MG/DL δύο ώρες µετά από χορήγηση 75 γραµµαρίων γλυκόζης από το στόµα 19

20 ΚΑΤΑΝΟΜΗ ΤΟΥ ΣΙ ΗΡΟΥ Η κατανοµή του σιδήρου στους ανθρώπινους ιστούς φαίνεται στις εικόνες 1 και 2. Ενήλικες άντρες έχουν φυσιολογικά mg σιδήρου ανα χιλιόγραµµο βάρους σώµατος. Πάνω από τα δύο τρίτα αυτού βρίσκεται µε την µορφή αιµοσφαιρίνης σε πρώιµα και ώριµα ερυθροκύτταρα.(εικόνα 1) H πρόσληψη σιδήρου από τα πρόδροµα κύτταρα της ερυθράς σειράς εξαρτάται από την ενδοκυττάρωση του συµπλέγµατος δισθενούς σιδήρουτρανσφερίνης-υποδοχέα της τρανσφερίνης (Fe-Tf-TfR).(εικόνα 2). Το χαµηλό ph εντός του ενδοσώµατος συνεπάγεται την αποδέσµευση του Fe από τον υποδοχέα τρανσφερίνης (TfR) και την εν συνεχεία µεταφορά του στο κυτταρόπλασµα µέσω του µεταφορέα σιδήρου (divalent metal transporter 1-DMT1). Επειδή οι ερυθροβλάστες χρειάζονται περί τα 20 mg σιδήρου ηµερησίως, αλλά µόνο 1-2 mg φυσιολογικά εισέρχονται στο σώµα κάθε µέρα µέσω του εντέρου (εικόνα 1), ο Fe ανακυκλώνεται συνεχώς µε τη διάσπαση των γηρασµένων ερυθροκυττάρων από τα µακροφάγα και την εν συνεχεία απόδοση του Fe στο πλάσµα οπου δεσµευµένος στη τρανσφερίνη (transferin-tf) αποδίδεται στο µυελό των οστών για να χρησιµοποιηθεί. Από τον υπόλοιπο σίδηρο το µεγαλύτερο µέρος (0.5-1 g) βρίσκεται στα ηπατοκύτταρα τα οποία αποθηκεύουν Fe µε τη µορφή φερριτίνης και αιµοσιδηρίνης. Από την άλλη µεριά, 1-2 mg Fe χάνονται από το σώµα καθηµερινά (εικόνα 1) και αυτό το ποσό αναπληρώνεται µε την απορρόφηση του Fe των τροφών από το βλεννογόνο του δωδεκαδακτύλου. 20

21 Εικόνα 1. Κατανοµή του σιδήρου στους ανθρώπινους ιστούς.στην κατάσταση ισορροπίας σίδηρος απορροφάται από το έντερο (dietary iron) και κυκλοφορεί στο πλάσµα δεσµευµένος από την τρανσφερίνη (transferin).ο περισσότερος σίδηρος χρησιµοποιείται από τον µυελό των οστών(bone marrow).(nejm 1999;341: ). 21

22 Εικόνα 2. ισθενής σίδηρος(fe) δεσµευµένος στην τρανσφερίνη(tf) µέσω του υποδοχέα της (TfR) µεταφέρεται στο εσωτερικό του κυττάρου µε την µορφή ενδοσώµατος (endosome). Το χαµηλό p H στο εσωτερικό του ενδοσώµατος προκαλεί αποδέσµευση του Fe από την Tf και τον υποδοχέα της (TfR), ο οποίος στη συνέχεια µεταφέρεται µέσω του µεταφορέα DMT1 στο κυτταρόπλασµα του κυττάρου. (NEJM 1999;341: ). 22

23 ΡΥΘΜΙΣΗ ΤΗΣ ΑΠΟΡΡΟΦΗΣΗΣ ΤΟΥ ΣΙ ΗΡΟΥ Αν και το ποσό του σιδήρου που προσλαµβάνεται από τη δίαιτα είναι µικρό, η ρύθµιση της απορρόφησής του καθίσταται κριτικής σηµασίας εφ όσον δεν υπάρχει φυσιολογική οδός απέκκρισης. Τα κύτταρα των κρυπτών του εντέρου, αντιλαµβάνονται τις απαιτήσεις του οργανισµού σε σίδηρο και προγραµµατίζονται µε βάσει αυτή την πληροφορία καθώς αυτά εξελίσσονται σε ώριµα εντεροκύτταρα(εικονα 4). Τα εντεροκύτταρα που επικαλύπτουν τις λάχνες του εντέρου κοντά στη γαστροδωδεκαδακτυλική συµβολή, είναι υπεύθυνα για την απορρόφηση του σιδήρου(εικόνα 4). H ρύθµιση της απορρόφησης σιδήρου από τον εντερικό αυλό καθορίζεται από το ποσό του σιδήρου στη διατροφή (dietary regulator), τις αποθήκες σιδήρου όπως αυτές αντικατοπτρίζονται στον κορεσµό τρανσφερίνης (stores regulator) και από τις ανάγκες για ερυθροποίηση (erythropoietic regulator). Πρόσφατα πιθανολογήθηκε η ταυτοποίηση του µορίου που µεταφέρει στο έντερο την πληροφορία σχετικά µε τις αποθήκες του οργανισµού σε σίδηρο και ονοµάζεται hepcidin. Ένας πιθανολογούµενος µηχανισµός περιλαµβάνει την πρόσληψη Fe από το ηπατοκύτταρο µέσω TfR-2, η οποία τροποποιεί την έκφραση της hepcidin, που µε τη σειρά της, αφού εισέλθει στην κυκλοφορία, αλληλεπιδρά µε το σύµπλεγµα HFE-TfR1 των κυττάρων της κρύπτης του δωδεκαδακτύλου για να ρυθµίσει την απορρόφηση του σιδήρου. Το µοντέλο αυτό θέλει τις ανάγκες του ερυθρόνα σε σίδηρο να αποτελούν την πρώτη προτεραιότητα στην όλη κινητική του σιδήρου. Ο σίδηρος της τροφής παρουσία του χαµηλού ph του γαστρικού υγρού, ανάγεται σε δισθενή σίδηρο µε τη βοήθεια της αναγωγάσης της κυτταρικής µεµβράνης.(εικόνα 3). Ο µεταφορέας δισθενών µετάλλων DMT1 είναι η πρωτείνη που τον µεταφέρει µέσα στο κυτταρόπλασµα. Ο DMT1 δεν είναι ειδικός µόνο για τη µεταφορά σιδήρου, 23

24 αλλά µπορεί να µεταφέρει επίσης άλλα δισθενή µέταλλα όπως µαγγάνιο, κοβάλτιο, χαλκό, ψευδάργυρο, κάδµιο, και µόλυβδο. Μέσα στο εντεροκύτταρο ο σίδηρος µπορεί να αποθηκευτεί µε τη µορφή φερριτίνης η να µεταφερθεί δια µέσου του κορυφαίου τµήµατος της κυτταρικής µεµβράνης στο πλάσµα. Ο µεταφορέας σιδήρου του κορυφαίου τµήµατος της κυτταρικής µεµβράνης πρόσφατα ταυτοποιήθηκε και ονοµάζεται ferroportin 1. Ο µεταφορέας αυτός της κορυφαίου τµήµατος της µεµβράνης χρειάζεται µια βοηθητική πρωτείνη που ονοµάζεται Ηφαιστίνη(Hephaestin) (εικόνα 3), η οποία οµοιάζει µε την σερουλοπλασµίνη και παίζει το ρόλο οξειδάσης του σιδήρου. Η ελευθέρωση σιδήρου από το δικτυοενδοθηλιακό σύστηµα στο πλάσµα για να δεσµευτεί από την τρανσφερίνη είναι επίσης διαδικασία σηµαντική.(εικόνα 5). Η όλη διαδικασία του µεταβολισµού του σιδήρου σε επίπεδο οργανισµού φαίνεται στην εικόνα 6. Στην εικόνα αυτή αναπαρίσταται ο µεταβολισµός του σιδήρου στη φυσιολογική κατάσταση(a), στη σιδηροπενία(b), στη δευτεροπαθή αιµοχρωµάτωση(c) αι στην κληρονοµική αιµοχρωµάτωση(d). Στην εικόνα 6Α συγκεκριµένα αναπαρίσταται το άωρο εντεροκύτταρο (crypt cell), το ώριµο εντεροκύτταρο (villus enterocyte), ο µυελός των οστών (bone marrow), και το ηπατοκύτταρο (hepatocyte).το άωρο εντεροκύτταρο προσλαµβάνει σίδηρο συνδεδεµένο µε τρανσφερίνη (Tf-fe) από την κυκλοφορία µέσω του υποδοχέα τρανσφερίνης ο οποίος βρίσκεται σε στενή σχέση µε το µόριο HFE. Το ώριµο εντεροκύτταρο προσλαµβάνει σίδηρο από τον εντερικό αυλό µέσω του µεταφορέα σιδήρου DMT1. o σίδηρος αυτός στη συνέχεια µεταφέρεται µέσω του µεταφορέα ferroportin και την βοήθεια της πρωτείνης Hephaestin που εντοπίζονται στην πλευρά της κυτταρικής µεµβράνης προς την κυκλοφορία, στο πλάσµα του αίµατος. Εκεί ο σίδηρος δεσµεύεται από την τρανσφερίνη. Ο σίδηρος αυτός αποδίδεται στον µυελό των οστών, όπου και χρησιµοποιείται στη σύνθεση της αιµοσφαιρίνης. Τα µακροφάγα προσλαµβάνουν σίδηρο µε δύο οδούς. α) φαγοκυτταρώνουν γηρασµένα 24

25 ερυθρά αιµοσφαίρια β) φέρουν υποδοχείς τρανσφερίνης (TfR1) και µέσω αυτών προσλαµβάνουν σίδηρο µε τη µορφή Tf-fe. To ηπατοκύτταρο προσλαµβάνει σίδηρο κυρίως µέσω των υποδοχέων τρανσφερίνης 2 (TfR2)

26 Εικόνα 3. Απορρόφηση Fe2+ µέσω του ώριµου εντεροκυττάρου της λάχνης του δωδεκαδακτύλου. O τρισθενής σίδηρος Fe 3+ ανάγεται σε δισθενή Fe2+µέσω της αναγωγάσης (ferric reductase) της κυτταροπλασµατικής µεµβράνης της κορυφαίας επιφάνειας (apical surface). Ο σίδηρος µπορεί είτε να αποθηκευτεί σαν φερριτίνη (ferritin) είτε να µεταφερθεί από τον µεταφορέα σιδήρου (basolateral transporter) στην βασική πλευρά της κυτταροπλασµατικής µεµβράνης (basolateral surface) προς την κυκλοφορία του αίµατος..(nejm 1999;341: ) 26

27 Εικόνα 4.Το ανώριµο εντεροκύτταρο στον πυθµένα της κρύπτης(crypt) λαµβάνει µηνύµατα για την κατάσταση του οργανισµού σε Fe (stores regulator και erythroid regulator) και µεταφέρει την πληροφορία αυτή κατά την εξελιξή του σε ώριµο εντεροκύτταρο στην κορυφή της λάχνης(absorptive villus) (NEJM 1999;341: ) 27

28 Εικόνα 5. α) Απορρόφηση σιδήρου από το εντεροκύτταρο. Φαίνεται ο µεταφορέας σιδήρου στη βασική πλευρά της µεµβράνης (ferroportin1) και η βοηθητική πρωτείνη Hephaestin. β) Αποβολή σιδήρου από το µακροφάγο. Φαίνεται ο µεταφορέας σιδήρου Ferroportin1 µέσω του οποίου το µακροφάγο µεταφέρει σίδηρο από το κυτταρόπλασµα του στην κυκλοφορία(jci 2001;108: ). 28

29 Εικόνα 6. Α: φυσιολογικός µεταβολισµός. Β: σιδηροπενική αναιµία. C: δευτεροπαθής αιµοσιδήρωση. D: κληρονοµική αιµοχρωµάτωση.το πάχος των βελών δείχνει και το µέγεθος της µεταφοράς σιδήρου ανάµεσα στα διάφορα 29

30 ΤΟΞΙΚΗ ΡΑΣΗ ΤΟΥ ΣΙ ΗΡΟΥ Ο σίδηρος είναι σηµαντικός για την κυτταρική διαίρεση και ανάπτυξη, αλλά η αυστηρή ρύθµιση της ενδοκυττάριας συγκέντρωσης του είναι απαραίτητη καθ ότι ο σίδηρος και το οξυγόνο µπορεί να αλληλεπιδράσουν και να σχηµατίσουν ρίζες ROS(superoxide and hydroxyl radicals). Fe 2+ +O2 Fe 3+ + O2 O2 +2H + H2O2 + O2 Fe 2+ + H2O2 OH + OH + Fe 3+ Οι ρίζες υδροξυλίου, ίσως το πιο ισχυρό οξειδωτικό σε βιολογικά συστήµατα, µπορούν να προσβάλουν πρωτείνες, πυρηνικά οξέα, και υδατάνθρακες. ιάφοροι µηχανισµοί έχουν προταθεί για τα επιβλαβή αποτελέσµατα της εναπόθεσης σιδήρου στα κύτταρα. Αυτοί περιλαµβάνουν: 1)Υπεροξείδωση πολυακόρεστων λιπαρών οξέων φωσφολιπιδίων της µεµβράνης µε αποτέλεσµα βλάβη της 2) αυξηµένη παραγωγή κολλαγόνου (ο σίδηρος είναι συµπαράγων του ενζύµου προλυλο-υδροξυλάση (prolyl hydroxylase) και ως τέτοιος θεωρείται ότι προάγει την ίνωση) 3)βλάβη του DNA. Αλληλεπιδράσεις σιδήρου και DNA µπορούν να προκαλέσουν µεταλλάξεις. 30

31 ΜΟΡΙΑΚΟΙ ΜΗΧΑΝΙΣΜΟΙ ΚΑΙ ΟΜΟΙΟΣΤΑΣΙΑ ΤΟΥ ΕΝ ΟΚΥΤΤΑΡΙΟΥ ΣΙ ΗΡΟΥ Οι ρυθµιστικές πρωτείνες του σιδήρου (IRPs), είναι ενδοκυττάριες πρωτείνες που ανιχνεύουν τα επίπεδα σιδήρου στο κυτταρόπλασµα και τροποποιούν σε επίπεδο µεταγραφής η µετάφρασης άλλες πρωτείνες που ενέχονται στο µεταβολισµό του όπως φερριτίνη, TfR1, ferroportin 1, DMT1(εικόνα 7). Παραδόξως, το γονίδιο HFE δεν περιέχει στοιχεία ρύθµισης µέσω των IRPs (iron response elemens-ires) και δεν είναι γνωστό αν ρυθµίζεται από τα ενδοκυττάρια επίπεδα σιδήρου. Πρόσφατα ευρήµατα δείχνουν ότι η έκφραση του TfR ρυθµίζεται σε επίπεδο σταθερότητας του m-rna από τα επίπεδα του ενδοκυττάριου σιδήρου ύο οµάδες ερευνητών ανακάλυψαν το γονίδιο του µεταφορέα σιδήρου στο έντερο και το ονόµασαν µεταφορέα δισθενών µετάλλων τύπου 1(DMT-1). 14 m-rna του µεταφορέα DMT-1 ανιχνεύεται σε όλα τα κύτταρα και ιδιαίτερα στα εντεροκύτταρα του δωδεκαδακτύλου. Το ποσό του m-rna του DMT-1 φαίνεται να ρυθµίζεται από το επίπεδο των αποθηκών του σιδήρου. Μεταλλάξεις του DMT-1 βρέθηκαν ιδιαίτερα καθοριστικές για τη µεταφορά του σιδήρου από τον εντερικό αυλό στο εντεροκύτταρο και από το εσωτερικό του ενδοσώµατος στο κυτταρόπλασµα. Γενικά η µεταβολή της ενδοκυτάριας συγκέντρωσης σιδήρου µέσω του συστήµατος των παραγόντων IRPs σηµατοδοτεί µια σειρά από περίπλοκες εξεργασίες που ελέγχουν την οµοιοστασία του σιδήρου. Σε διαφορετικά είδη κυττάρων το σύστηµα µπορεί να λειτουργεί µε διαφορετικούς τρόπους ανάλογα µε τη σχετική λειτουργία των πρωτεϊνών στόχων. Για παράδειγµα, τα ταχέως αναπτυσσόµενα κύτταρα (αρχέγονα 31

32 κύτταρα κρυπτών εντέρου, πρόδροµα κύτταρα ερυθράς σειράς) εξαρτώνται αποκλειστικά από την έκφραση υποδοχέων TfR1 για την απόκτηση σιδήρου από το πλάσµα. Η ελεύθερη δεξαµενή σιδήρου και οι IRPs ελέγχουν την απορρόφηση σιδήρου από το έντερο. Στα εντερικά κύτταρα ο σίδηρος πρέπει να περάσει µέσα από δύο µεµβράνες λιπιδίων, την κορυφαία προς τον εντερικό αυλό, και την βασική προς την κυκλοφορία. Τα κύτταρα της κορυφής της λάχνης και του πυθµένα της κρύπτης έχουν τελείως διαφορετική έκφραση πρωτεϊνών που ενέχονται στη φυσιολογία του σιδήρου, και κατά συνέπεια τελείως διαφορετικό ρόλο στη µεταφορά του. Τα κύτταρα της κρύπτης δεν έχουν µεταφορείς σιδήρου( DMT-1) και δεν απορροφούν σίδηρο. Απεναντίας, όπως τα πρόδροµα κύτταρα του ερυθρόνα, έχουν TfR1 και προσλαµβάνουν σίδηρο από την κυκλοφορία. Τα ώριµα κύτταρα στην κορυφή της λάχνης απορροφούν σίδηρο από τον αυλό του εντέρου µέσω του DMT-1 και τον αποδίδουν στην κυκλοφορία µέσω του µεταφορέα ferroportin 1στην βασική πλευρά του κυττάρου. Η πληροφορία την οποία αποκτούν τα άωρα κύτταρα της κρύπτης (πλούσια σε υποδοχείς TfR1) κατά την εξέλιξή τους, σχετικά µε την κατάσταση του οργανισµού σε σίδηρο, τελικά µεταφέρεται στα ώριµα εντεροκύτταρα που θα απορροφήσουν το σίδηρο από τον αυλό του εντέρου.(εικόνα 6Α) Από την άλλη µεριά, τα παρεγχυµατικά κύτταρα του ήπατος χρησιµοποιούνται ως αποθήκη σιδήρου και εκφράζουν πολύ λίγους υποδοχείς TfR1 κάτω από κανονικές συνθήκες, και καθόλου µετά από φόρτιση µε σίδηρο, ενώ αντιθέτως εκφράζουν υποδοχείς TfR2. Τα ηπατοκύτταρα όταν χρειάζεται, αποβάλουν το σίδηρο µέσω του συστήµατος της ferroportin 1(εικόνα 6Α). 32

33 Εικόνα 7. Φαίνονται οι µοριακοί µηχανισµοί µέσω των οποίων οι ενδοκυττάριες πρωτείνες ανίχνευσης σιδήρου (iron response proteins-irp) επηρεάζουν µόρια σηµαντικά για την οµοιοστασία του σιδήρου, όπως η φερριτίνη και ο υποδοχέας τρανσφερίνης. 33

34 ΤΟ ΓΟΝΙ ΙΟ HFE Το γονίδιο HFE κωδικοποιεί µια διαµεµβρανική πρωτεΐνη µε 348 αµινοξέα που µοιάζει µε τις πρωτεΐνες του συστήµατος ιστοσυµβατότητος MHC τύπου 1 και της οποίας η λειτουργία και η σχέση µε το µεταβολισµό του σιδήρου δεν έγινε εξ αρχής αντιληπτή. Η πλήρης αλληλουχία αµινοξέων φαίνεται στην εικόνα 8. ύο µεταλλάξεις (C282Y και H63D) βρέθηκαν σε ανθρώπους µε κληρονοµική αιµοχρωµάτωση σε ποσοστό 85%-90% των ασθενών µε τυπικό φαινότυπο κληρονοµικής αιµοχρωµάτωσης. H µετάλλαξη C282Y αφορά την αλλαγή του αµινοξέως κυστείνη σε τυροσίνη στη θέση 282. Η µετάλλαξη H63D αφορά την αλλαγή του αµινοξέως ιστιδίνη σε ασπαρτικό στη θέση 63 της αλυσίδας των αµινοξέων. Ένα ποσοστό ασθενών µε κληρονοµική αιµοχρωµάτωση ήσαν οµόζυγοι ως προς τη µετάλλαξη C282Y και ένα µικρότερο ποσοστό ήταν διπλοί ετεροζυγώτες (C282Y/H63D). Bιοχηµικές και δοµικές αναλύσεις του γόνου HFE έδειξαν ότι το προϊόν της µετάλλαξης C282Y καθιστούσε το µόριο ακατάλληλο για αλληλεπίδραση µε τη β2 µικροσφαιρίνη και σε πειράµατα κυτταρικής διαµόλυνσης (cell transfection) η µετάλλαξη αυτή ελλάτωσε σηµαντικά την έκφραση του συµπλέγµατος HFE-B2-microglobulin στην επιφάνεια των κυττάρων. 15 Η µετάλλαξη H63D δεν είχε σηµαντική επίδραση στην αλληλεπίδραση HFE και b2-microglobulin ούτε στην έκφραση του HFE στην επιφάνεια του κυττάρου. Ο πιθανός ρόλος του HFE στο µεταβολισµό του σιδήρου φάνηκε από µελέτες που έδειξαν ότι η πρωτεΐνη HFE αλληλεπιδρά µε τον υποδοχέα της 34

35 τρανσφερρίνης TfR. 16,17 Ανακοινώθηκε ότι η HFE συνδέεται µε την TfR και αυτή η αλληλεπίδραση συνεπάγεται ελάττωση της συγγένειας του υποδοχέα TfR για την τρανσφερρίνη (Tf). Σε πειράµατα κυτταρικής διαµόλυνσης (cell transfection) η µεταλλαγµένη πρωτεΐνη C282Y αφού δεν εκφράσθηκε στην επιφάνεια του κυττάρου, προφανώς δεν συνδέθηκε µε την TfR και κατά συνέπεια δεν επηρέασε τη συγγένεια ανάµεσα στην TfR και την Tf. Αντιθέτως η µεταλλαγµένη πρωτεΐνη H63D που εκφράζεται στην επιφάνεια του κυττάρου ναι µεν ελάττωσε την συγγένεια µεταξύ TfR και Tf αλλά όχι στο βαθµό που την ελάττωσε η φυσιολογική HFE πρωτεΐνη. Η σχέση ανάµεσα στην HFE και την b2-microglobulin υποδείχθηκε για πρώτη φορά από πειράµατα knockout του γονιδίου της b2-microglobulin.). Τα ποντίκια αυτά παρουσίασαν σηµαντική συσσώρευση σιδήρου ως επί κληρονοµικής αιµοχρωµάτωσης. 18 Η τρισδιάστατη δοµή του µορίου της πρωτεΐνης HFE καθορίσθηκε µε κρυσταλλογραφία που επέτρεψε την επιβεβαίωση της αλληλεπίδρασης HFE µε τον υποδοχέα τρανσφερίνης (TfR ) και την εντόπιση των µεταλλάξεων C282Y και H63D. 19 (εικόνα 9) Βιοχηµικές µελέτες απέδειξαν ότι η HFE συνδέεται µε µεγάλη συγγένεια µε τον υποδοχέα τρανσφερίνης (TfR) και αυτός µε τη σειρά του µπορεί να δεσµεύσει τρανσφερίνη. 20 Η HFE εκφράζεται σε όλα τα κύτταρα εκτός του εγκεφάλου. 3 Ιδιαίτερα σηµαντικά εκφράζεται στα εντεροκύτταρα των εν τω βάθει κρυπτών του δωδεκαδακτύλου. Σε πειράµατα διαµόλυνσης κυττάρων hamsters έγιναν λειτουργικές µελέτες εκφράζοντας ταυτόχρονα TfR, b2-microglobulin και είτε φυσιολογική HFE είτε µεταλλαγµένη. Στα πειράµατα αυτά ούτε η φυσιολογική ούτε η µεταλλαγµένη HFE επηρέασε την συγγένεια της TfR µε την Tf αλλά και οι δύο µεταλλάξεις C282Y και H63D ελάττωσαν το ρυθµό ενδοκυττάριας συσσώρευσης σιδήρου µέσω TfR µε το να ελαττώσουν το ρυθµό ενδοκυττάρωσης και ανακύκλωσης του TfR. 35

36 Συµπερασµατικά, τα αρχικά ευρήµατα συνηγορούν υπέρ της πρότασης ότι ο ρόλος της HFE στα κύτταρα του εντερικού βλενογόνου είναι να καθορίζει την πρόσληψη σιδήρου συνδεδεµένου µε τρανσφερρίνη, ο οποίος στη συνέχεια λειτουργεί σαν ανιχνευτής των αποθηκών σε σίδηρο. Μια πρόσφατη µελέτη επιβεβαίωσε ότι η πρωτεΐνη HFE αλληλεπιδρά ειδικά µε την TfR1 και όχι µε την TfR2 που εκφράζεται πολύ στα ηπατοκύτταρα και στα µονοκύτταρα του αίµατος. Κατ αναλογία µε την αλληλεπίδραση ανάµεσα στο HFE και τον υποδοχέα TfR1, τα µόρια MHC τύπου 1 αλληλεπιδρούν µε τον υποδοχέα της ινσουλίνης στην ίδια κυτταρική µεµβράνη. Η µετάλλαξη C282Y µπορεί να εµποδίζει την είσοδο σιδήρου στο εντεροκύτταρο µέσω TfR και έτσι παρέχει το λανθασµένο σήµα ότι οι αποθήκες σιδήρου είναι άδειες. Κατά συνέπεια τα διαφοροποιηµένα εντεροκύτταρα αυξάνουν την παραγωγή DMT-1 και απορροφούν περισσότερο σίδηρο. Ποντίκια χωρίς το γονίδιο HFE (HFE knockout mice) αναπτύσσουν νόσο παρόµοια µε αυτή της κληρονοµικής αιµοχρωµάτωσης σε ανθρώπους. 36

37 Εικόνα 8. Αλληλουχία αµινοξέων της πρωτεΐνης HFE. Οι θέσεις των δυνητικών σηµειακών µεταλλάξεων φαίνονται µε έντονη γραφή. MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLF VFYDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTVDFWTIMENHNHSKE SHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWE RHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRAL NYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQV EHPGLDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAE RE 37

38 Εικόνα 9α. Κρυσταλλική δοµή της πρωτείνης HFE όπως αλληλεπιδρά µε τον υποδοχέα τρανσφερίνης.(tfr). 38

39 Εικόνα 9β. Αλληλεπίδραση ανάµεσα στην πρωτείνη HFE και τον υποδοχέα τρανσφερίνης.(tfr). Μοντέλο µε βάση τις κρυσταλικές τους δοµές. 39

40 Εικόνα 9γ. Αλληλεπίδραση ανάµεσα στην πρωτείνη HFE και τον υποδοχέα τρανσφερίνης.(tfr). Μοντέλο µε βάση τις κρυσταλικές τους δοµές. 40

41 ΕΠΙ ΗΜΙΟΛΟΓΙΑ ΚΛΗΡΟΝΟΜΙΚΗΣ ΑΙΜΟΧΡΩΜΑΤΩΣΗΣ Η κληρονοµική αιµοχρωµάτωση απαντάται σε όλη την υφήλιο αλλά πιο συχνά σε άτοµα βορειο-ευρωπαϊκής καταγωγής. 21 Μελέτες της συχνότητας και της κατανοµής των µεταλλάξεων του HFE, επιβεβαίωσαν αυτή τη συσχέτιση. 22. Η συχνότητα της µεταλλάξεως C282Y είναι µεγαλύτερη σε άτοµα βορειοευρωπαικής καταγωγής όπου ένα τουλάχιστον αντίγραφο του µεταλλαγµένου γονιδίου βρίσκεται σε 10%-20% του πληθυσµού. Η µετάλλαξη C282Y είναι λιγότερο συχνή (2%-4%) σε πληθυσµούς της νότιας και ανατολικής Ευρώπης. 22,23 και σπάνια απαντάτε σε αυτόχθονες της Αφρικής, κεντρικής και νότιας Αµερικής, Ασίας και νήσων του Ειρηνικού ωκεανού. Η µετάλλαξη H63D έχει παρόµοια κατανοµή µε την µετάλλαξη C282Y. Η µετάλλαξη H63D είναι συχνότερη, ευρισκόµενη σε 15%-40% των Ευρωπαίων. Η οµόζυγος κατάσταση C282Y/ C282Y, βρίσκεται στο 60%- 100% των λευκών ατόµων µε κλινικά διαγνωσµένη κληρονοµική αιµοχρωµάτωση. 3-9 Υψηλότερα ποσοστά οµόζυγης µετάλλαξης C282Y βρίσκονται σε άτοµα µε βόρεια Ευρωπαική καταγωγή. Χαµηλότερα ποσοστά βρέθηκαν στη νότια Ευρώπη. 9,22,23 ενώ δεν έχουν ανακοινωθεί περιπτώσεις C282Y/ C282Y σε Αµερικανούς Αφρικανικής καταγωγής µε κληρονοµική αιµοχρωµάτωση. 24,25 Η συχνότητα των µεταλλάξεων του HFE έχει αναλυθεί σε διαφόρους πληθυσµούς από τη Ευρώπη και την βόρειο Αµερική. Αθροιστικά δεδοµένα από αυτές τις µελέτες υπολογίζουν τη συχνότητα της µετάλλαξης C282Y σε 6.8%, της δε H63D σε 17.6% σε λευκούς πληθυσµούς. Τα ευρήµατα αυτά δηλώνουν ότι 0,5% του λευκού 41

42 πληθυσµού πρέπει να είναι οµόζυγοι ως προς τη µετάλλαξη C282Y. Αυτή η συχνότητα 5:1000 βρίσκεται σε συµφωνία µε τη συχνότητα αιµοχρωµάτωσης σε πληθυσµούς λευκών ενηλίκων. 26,27 Η πρόσβαση σε τεχνικές µοριακής βιολογίας για τη διάγνωση της κληρονοµικής αιµοχρωµάτωσης έχει αυξήσει το ενδιαφέρον για έλεγχο του πληθυσµού µε σκοπό την πρώιµη διάγνωση και θεραπεία. Το ουσιαστικό ερώτηµα είναι ποια δοκιµασία επιλογής (screening test) πρέπει να χρησιµοποιηθεί και σε ποιά οµάδα πληθυσµού. Επί του παρόντος έλεγχος για µεταλλάξεις του HFE σε νεογέννητα η στο γενικό πληθυσµό φαίνεται µη πρακτικός όσον αφορά το κόστος αλλά και τις επιπτώσεις αυτής της πληροφορίας σχετικά µε γενετικές συµβουλές και θεραπεία. Αντίθετα οι γενετικές εξετάσεις παρέχουν ένα τρόπο επιβεβαίωσης της κληρονοµικής αιµοχρωµάτωσης σε άτοµα που έχουν ελεγχθεί µε λιγότερο κόστος εξετάσεις όπως ο σίδηρος ορού, η φερριτίνη και ο κορεσµός τρανσφερίνης. Αυτές οι εξετάσεις θα µπορούσαν καλύτερα να χρησιµοποιηθούν σε πληθυσµούς µε αυξηµένη συχνότητα κληρονοµικής αιµοχρωµάτωσης και σε µία ηλικία κατά την οποία έχει αρχίσει παθολογική εναπόθεση σιδήρου,αλλά όχι στο βαθµό που να έχει προκαλέσει µόνιµες βλάβες στα όργανα στόχους. Μία επιτροπή για τη δοκιµασία επιλογής (screening) του πληθυσµού ως προς την κληρονοµική αιµοχρωµάτωση κατέληξε στο συµπέρασµα ότι δεν µπορεί να συσταθεί γενικό screening επί του παρόντος. Ο κορεσµός της τρανσφερρίνης θα πρέπει να χρησιµοποιείται για την ανίχνευση περιπτώσεων οµάδων υψηλού κινδύνου, οι δε µοριακές εξετάσεις για τις µεταλλάξεις C282Y και H63D να χρησιµοποιούνται σε µελέτη οικογενειών και για επιβεβαίωση ότι η αιµοχρωµάτωση έχει σχέση µε το γονίδιο HFE. Η επιτροπή παραδέχτηκε ότι τελικά το γενικευµένο screening σε ηλικία 20 ετών µπορεί να καθιερωθεί. 28 ιάφορες µελέτες δοκιµασίας επιλογής (screening) πληθυσµού έχουν αρχίσει στις Ηνωµένες πολιτείες Αµερικής,Καναδά,Ευρώπη και Αυστραλία. 24,27,29-31 Χρήσιµοι 42

43 τρόποι διενέργειας screening του πληθυσµού θα µπορούσαν να αποτελέσουν, ο κορεσµός της τρανσφερίνης και η φερριτίνη. Βεβαίως το επίπεδο πάνω από το οποίο οι δείκτες αυτοί θα πρέπει να θεωρούνται ενδεικτικοί αιµοχρωµάτωσης δεν έχει επακριβώς καθορισθεί. Επί παραδείγµατι, τιµές κορεσµού τρανσφερρίνης 62%, 26,27 60%, 32 50% 29 και 45% 33 έχουν χρησιµοποιηθεί σε screening πληθυσµών για κληρονοµική αιµοχρωµάτωση. Μια πρόσφατη µελέτη από την Αυστραλία ισχυρίζεται ότι χρησιµοποιώντας επίπεδο κορεσµού τρανσφερρίνης 45% ανίχνευσαν το 98% των οµοζυγοτών C282Y/ C282Y χωρίς ψευδώς θετικές τιµές. 30 Μια σηµαντική αναλογία ατόµων µε κλινική εικόνα κληρονοµικής αιµοχρωµάτωσης ιδιαίτερα από περιοχές της νότιας Ευρώπης δεν έχουν µεταλλάξεις του HFE. Πρόσφατα ο Pietrangelo et al. ανακοίνωσε µία οικογένεια στην Ιταλία µε άτυπη αιµοχρωµάτωση κληρονοµούµενη κατά τον αυτοσωµατικό επικρατούντα χαρακτήρα. Σ αυτά τα άτοµα βρέθηκε στη συνέχεια ότι έχουν µεταλλαγµένο το γονίδιο που κωδικοποιεί την ferroportin1. Τελευταία έχουν βρεθεί επίσης µεταλλάξεις στο γονίδιο TfR2 που οδηγούν στην εµφάνιση συνδρόµου κληρονοµικής αιµοχρωµάτωσης

44 ΑΙΤΙΕΣ ΣΥΣΣΩΡΕΥΣΗΣ ΣΙ ΗΡΟΥ Οι αιτίες συσσώρευσης σιδήρου αναφέρονται στον πίνακα 4. Σε αυτές περιλαµβάνονται κληρονοµικές µορφές όπως: κληρονοµική αιµοχρωµάτωση σχετιζόµενη µε το γονίδιο HFE, κληρονοµική αιµοχρωµάτωση µη σχετιζόµενη µε το γονίδιο HFE, νεογνική αιµοχρωµάτωση, εφηβική αιµοχρωµάτωση, αιµοχρωµατωση µεταδιδόµενη µε τον αυτοσωµατικό επικρατούντα χαρακτήρα και επίκτητες νόσοι όπως: µεσογειακή αναιµία, σιδηροβλαστική αναιµία, χρόνιες αιµολυτικές αναιµίες, υπερβολική πρόσληψη σιδήρου µε τις τροφές ηπατίτιδα C, αλκοολική ηπατοπάθεια, µη αλκοολική στεατοηπατίτιδα δερµατική πορφυρία. Ειδικά στη µορφή κληρονοµικής αιµοχρωµάτωσης σχετιζόµενη µε µεταλλάξεις της πρωτεΐνης HFE, οι αναφερθέντες συνδυασµοί είναι: α)οµόζυγη µετάλλαξη και στα δύο αντίγραφα του γόνου HFE στη θέση C282Y. (C282Y/ C282Y). β) ιπλή ετεροζυγωτία όπου το µεν ένα αντίγραφο φέρει τη µετάλλαξη C282Y το δε άλλο αντίγραφο τη µετάλλαξη H63D. 44

45 Πίνακας 4 Κατάταξη των συνδρόµων υπερφόρτωσης µε σίδηρο Γενετική αιµοχρωµάτωση Σχετιζόµενη µε το HFE C282Y/C282Y C282Y/H63D Μη σχετιζόµενη µε το HFE Ferroportin1 TfR2 Επίκτητη συσσώρευση σιδήρου Αναιµία από µη αποδοτική ερυθροποίηση Μεσογειακή αναιµία Σιδηροβλαστική αναιµία Απλαστική αναιµία Ανεπάρκεια πυροσταφυλικής κινάσης Αναιµία που ανταποκρίνεται στην πυριδοξίνη Ηπατοπάθεια Αλκοολική ηπατοπάθεια Χρονία ιογενής ηπατίτιδα B και C ερµατική πορφυρία (porphyria cutanea tarda) Αναστόµωση πυλαίας µε κάτω κοίλη Μεταγγίσεις και παρεντερική χορήγηση σιδήρου Υπερβολική πρόσληψη σιδήρου µε τη δίαιτα ιάφορα Έλλειψη σερουλοπλασµίνης Συγγενής ατρανσφεριναιµία Νεογνική αιµοχρωµάτωση Αιµοχρωµάτωση της Αφρικής κάτωθεν της Σαχάρας 45

46 ΑΠΟ ΤΟ ΓΟΝΟΤΥΠΟ ΣΤΟ ΦΑΙΝΟΤΥΠΟ ΚΛΙΝΙΚΑ ΧΑΡΑΚΤΗΡΙΣΤΙΚΑ ΤΗΣ ΚΛΗΡΟΝΟΜΙΚΗΣ ΑΙΜΟΧΡΩΜΑΤΩΣΗΣ Η κλινική εικόνα των ασθενών µε κληρονοµική αιµοχρωµάτωση φαίνεται στον πίνακα 5.Tα συµπτώµατα αυτά και τα φυσικά σηµεία οφείλονται στην εναπόθεση σιδήρου στους διάφορους ιστούς και την βλάβη τους λόγω τοξικής δράσης του σιδήρου. Η νοσηρότητα της νόσου µπορεί να ορισθεί µε βάση συµπτώµατα (αδυναµία,αρθραλγίες, ανικανότητα, πολυουρία, δύσπνοια), φυσικά ευρήµατα (υπέρχρωση δέρµατος, ηπατοµεγαλία, υπογοναδισµός, καρδιακή ανεπάρκεια, αρθροπάθεια), εργαστηριακές ανωµαλίες (αύξηση τρανσαµινασών, υπεργλυκαιµία, αύξηση του κορεσµού τρανσφερρίνης), ή ευρήµατα από τη βιοψία ήπατος (ίνωση, κίρρωση, ηπατοκυτταρικό καρκίνωµα). Σε ασθενείς που βρέθηκε ότι πάσχουν από κληρονοµική αιµοχρωµάτωση µετά από screening πληθυσµού, η νοσηρότητα βρέθηκε να σχετίζεται µε την ηλικία και το φύλο. Η νοσηρότητα πριν την ηλικία των 20 ετών είναι σπάνια και εµφανίζεται στους άνδρες συχνότερα και σε νεαρότερη ηλικία σε σχέση µε τις γυναίκες. Η νοσηρότητα της κληρονοµικής αιµοχρωµάτωσης σε άτοµα µε τη µετάλλαξη C282Y δεν έχει καθορισθεί ακριβώς και θα χρειαστούν µελέτες screening πληθυσµού. Σε µία πρόσφατη µελέτη από την Αυστραλία 36 σε ένα πληθυσµό λευκών ενηλίκων βορειοευρωπαικής καταγωγής, βρέθηκαν οµόζυγοι για την µετάλλαξη C282Y.σε ποσοστό 0.5%. Παρ,όλα αυτά µόνο οι µισοί είχαν κλινικά σηµεία αιµοχρωµάτωσης και µόνο 25% είχαν επίπεδα φερριτίνης που παρέµειναν πάνω από το φυσιολογικό σε διάστηµα παρακολούθησης τεσσάρων ετών. Σε µία πρόσφατη µελέτη, η διεισδυτικότητα της µετάλλαξης C282Y βρέθηκε πολύ µικρότερη από ότι 46

47 γενικά πιστευόταν µέχρι τώρα 61 Το ποσοστό διεισδυτικότητας των άλλων µεταλλάξεων είναι ακόµη λιγότερο γνωστό. Σε αναλύσεις ασθενών µε συσσώρευση σιδήρου, συµβατή µε κληρονοµική αιµοχρωµάτωση, οι συχνότητες των ετεροζυγοτών C282Y όπως και των H63D δεν είναι µεγαλύτερη από αυτή του γενικού πληθυσµού. 3-9 Παρ,όλα αυτά η συχνότητα των διπλών ετεροζυγοτών C282Y/H63D ήταν µεγαλύτερη σε άτοµα µε κλινική εικόνα κληρονοµικής αιµοχρωµάτωσης σε σχέση µε την οµάδα ελέγχου. Όµως, αν οι διπλοί ετεροζυγότες C282Y/H63D παρουσίαζαν όλοι συσσώρευση σιδήρου, αυτός ο γονότυπος (η συχνότητα του υπολογίζεται σε 1%) θα ήταν δύο φορές συχνότερος σε σχέση µε τον γονότυπο C282Y/ C282Y σε άτοµα µε κλινική εικόνα κληρονοµικής αιµοχρωµάτωσης. Όµως οι περιπώσεις διπλών ετεροζυγοτών C282Y/H63D αντιπροσωπεύουν µόνο ένα 2%-5% των τυπικών περιπτώσεων κληρονοµικής αιµοχρωµάτωσης. Αυτά τα ευρήµατα θα µπορούσαν να ερµηνευθούν ότι οφείλονται στην χαµηλή διεισδυτικότητα του γονοτύπου C282Y/H63D είτε στο ότι ο ρυθµός εναπόθεσης σιδήρου µε την ηλικία δεν είναι τόσο έντονος όσο στο γονότυπο C282Y/ C282Y. 3 Υπολογίζεται ότι το µεγαλύτερο του 90% των οµοζυγοτών C282Y/ C282Y αναπτύσσουν σηµαντικού βαθµού συσσώρευση σιδήρου κατά τη διάρκεια της ενήλικης ζωής σε σχέση µε µόνο του 5% των διπλών ετεροζυγοτών C282Y/H63D. Η συχνότητα αιµοχρωµάτωσης-µη σχετιζόµενης µε το γονίδιο HFE, ποικίλει ανάλογα µε τον πληθυσµό που εξετάζεται και είναι σχετικά µεγάλη στη νότια Ευρώπη. 9,23 Η αιτία για µερικές τουλάχιστον από αυτές τις περιπτώσεις είναι ετερόζυγος C282Y η H63D σε συνδυασµό µε ένα άλλο παράγοντα όπως ετερόζυγος β µεσογειακή αναιµία, χρόνια αιµόλυση, υπερβολική ποσότητα σιδήρου στη διατροφή, αλκοολισµός ηπατίτιδα C, µη αλκοολική στεατοηπατίτιδα

48 Πίνακας 5 Συµπτώµατα και αντικειµενικά ευρήµατα σε ασθενείς µε γενετική αιµοχρωµάτωση Συµπτώµατα Ασυµπτωµατικοι Μη ειδικά, συστηµατικά συµπτώµατα Αδυναµία Κακουχία Απάθεια Λήθαργος Απώλεια βάρους Ειδικά συµπτώµατα κατά συστήµατα Κοιλιακό άλγος Αρθραλγίες ιαβήτης Αµηνόρροια Απώλεια σεξουαλικής ορµής Συµφορητική καρδιακή ανεπάρκεια Αρρυθµίες 48

49 Αντικειµενικά ευρήµατα Ασυµπτωµατικοί Χωρίς αντικειµενικά ευρήµατα Ηπατοµεγαλία Συµπτωµατικοί Ηπατοµεγαλία Σπληνοµεγαλία ερµατικά σηµεία ηπατοπάθειας Ηπατική ανεπάρκεια(ασκίτης,, εγκεφαλοπάθεια κ.λ.π) Αρθρίτιδα ιατατική καρδιοµυοπάθεια, συµφορητική καρδιακή ανεπάρκεια Υπέρχρωση δέρµατος Ατροφία όρχεων Υπογοναδισµός Υποθυρεοειδισµός 49

50 ΙΑΓΝΩΣΗ Στην κληρονοµική αιµοχρωµάτωση, παρ ολον ότι υπάρχει γονιδιακή βλάβη, τα κλινικά συµπτώµατα και σηµεία της νόσου σπάνια εκδηλώνονται πριν από την ενήλικη ζωή. 32,34,35 Απαιτούνται έτη απορρόφησης σιδήρου από τις τροφές και εναπόθεσής του στα κύτταρα (γενικά πάνω από 5 gm αποθηκευµένος σίδηρος) πριν επέλθει βλάβη των ιστών. Η νόσος έτσι µπορεί να καταταχθεί σε τρία κλινικά στάδια 1) χωρίς αυξηµένες αποθήκες σιδήρου 2) αύξηση των αποθηκών σιδήρου χωρίς νοσηρότητα 3) αύξηση των αποθηκών σιδήρου µε κλινική νοσηρότητα. Η έκφραση της νόσου εξαρτάται από γενετικούς αλλά και από περιβαλλοντικούς παράγοντες, όπως το φύλο, η ηλικία, η απώλεια σιδήρου, το ποσό του σιδήρου στη δίαιτα, άλλοι παράγοντες που µπορούν να επηρεάσουν την απορρόφηση σιδήρου από το έντερο. Άπαξ και η υποψία κληρονοµικής αιµοχρωµάτωσης τεθεί, η οριστική διάγνωση είναι σχετικά εύκολη. Πρέπει να προσδιορισθεί ο κορεσµός τρανσφερίνης νηστείας και η φερριτίνη ορού. Ο κορεσµός τρανσφερίνης είναι πρωιµότερος δείκτης της κληρονοµικής αιµοχρωµάτωσης και µπορεί να είναι αυξηµένος και µε φυσιολογικά επίπεδα φερριτίνης σε αρχικά στάδια της νόσου. Μία µεγάλη επιδηµιολογική µελέτη από το San Diego έδειξε ότι περίπου 36% των οµοζυγωτών C282Y/ C282Y είχαν κορεσµό τρανσφερίνης < 45% και δεν είναι γνωστό αν αυτά τα άτοµα θα αναπτύξουν ποτέ συµπτωµατική υπερφόρτωση µε σίδηρο. 84 Επιπροσθέτως, τα επίπεδα φερριτίνης µπορεί να είναι αυξηµένα σε αλκοολική ηπατοπάθεια, µη αλκοολική στεατοηπατίτιδα, η χρόνια ηπατίτιδα C. Φλεγµονώδεις γενικά καταστάσεις (ρευµατοειδής αρθρίτιδα) και νεοπλαστικά νοσήµατα (λέµφωµα) µπορεί να συνοδεύονται από υψηλά επίπεδα φερριτίνης. 50

51 Μέχρι την ανακάλυψη του γονιδίου HFE η διάγνωση της κληρονοµικής αιµοχρωµάτωσης απαιτούσε την απόδειξη της συσσώρευσης σιδήρου στον οργανισµό ή µελέτες του HLA στην οικογένεια. Κριτήρια συσσώρευσης σιδήρου αποτελούσαν: 1) χρώση σιδήρου σε βιοψίες ήπατος 3 ου -4 ου βαθµού. 2) σίδηρος στο ήπαρ>4500mg/gm ξηρού βάρους ήπατος. 3) δείκτης σιδήρου ήπατος (συγκέντρωση σιδήρου/ηλικία)>1.9 4) Η αφαίρεση 5 gm σιδήρου µε τη µορφή αφαιµάξεων χωρίς την πρόκληση σιδηροπενίας. 3-9 Προφανώς αυτά τα κριτήρια είναι πολύ αυστηρά για τα άτοµα που είναι οµόζυγα ως προς τη µετάλλαξη C282Y, στα αρχικά στάδια πριν την σηµαντική εναπόθεση σιδήρου. Σήµερα όταν ο κορεσµός τρανσφερίνης είναι >45% συνιστάται γενετικός έλεγχος των µεταλλάξεων C282Y και H63D. Η ύπαρξη είτε οµοζυγωτίας C282Y / C282Y είτε διπλής ετεροζυγωτίας C282Y / H63D σε άτοµα κάτω των 40 ετών µε φυσιολογικά ηπατικά ένζυµα θεωρείται αρκετή απόδειξη και δεν συνιστάται περαιτέρω έλεγχος µε βιοψία ήπατος. Έτσι όσο το γενετικό test γίνεται ευρύτερα διαδεδοµένο η βιοψία ήπατος αποκτά µικρότερη αξία. Παρ όλα αυτά όταν γίνει βιοψία ήπατος η εναπόθεση σιδήρου βρίσκεται κυρίως στην περιπυλαία περιοχή του ηπατικού λοβίου (acinar zone 1) και λιγότερη στις περιοχές 2 και 3 του ηπατικού λοβίου. Σε περίπτωση βέβαια σηµαντικού φορτίου σιδήρου, ακόµη και τα κύτταρα Kupffer παρουσιάζουν εναπόθεση σιδήρου. Στη δευτεροπαθή αιµοσιδήρωση η εναπόθεση σιδήρου ξεκινά από τα κύτταρα Kupffer. 51

52 ΘΕΡΑΠΕΙΑ ΤΗΣ ΚΛΗΡΟΝΟΜΙΚΗΣ ΑΙΜΟΧΡΩΜΑΤΩΣΗΣ Η θεραπεία της κληρονοµικής αιµοχρωµάτωσης παραµένει απλή ανέξοδη και ασφαλής.και συνίσταται σε εβδοµαδιαίες αφαιµάξεις 500 ml αίµατος ( mg σιδήρου).οι θεραπευτικές αφαιµάξεις συνεχίζονται µέχρις ότου παρατηρηθεί µείωση της ερυθροποίησης λόγω έλλειψης σιδήρου, όπως αυτή εκτιµάται από την καθυστέρηση επανόδου της αιµοσφαιρίνης στα προηγούµενα επίπεδα πριν από κάθε αφαίµαξη. Είναι λογικό να παρακολουθείται ο κορεσµός τρανσφερίνης και η φερριτίνη περιοδικά. Οι αφαιµάξεις διακόπτονται όταν τα επίπεδα φερριτίνης κατέλθουν στα 50 ng/ml και ο κορεσµός τρανσφερίνης στο 45 %. 52

53 ΑΙΜΟΧΡΩΜΑΤΩΣΗ ΚΑΙ ΣΑΚΧΑΡΩ ΗΣ ΙΑΒΗΤΗΣ Η σχέση αιµοχρωµάτωσης και σακχαρώδους διαβήτη είναι πολυπαραγοντική. υνητικά, οι δύο καταστάσεις µπορεί να συσχετίζονται λόγω α) βλάβης του β κυττάρου από εναπόθεση τοξικών συγκεντρώσεων σιδήρου και διαταραχής της µικροκυκλοφορίας από ίνωση β) αυξηµένης αντίστασης στην ινσουλίνη από κίρρωση του ήπατος γ) Ο σίδηρος είναι καταλύτης ελευθέρων ριζών και ως εκ τούτου έχει προταθεί ότι οι ελεύθερες ρίζες και η οξείδωση λιπιδίων µπορεί να ενέχονται στην αιτιολογία του σακχαρώδη διαβήτη τύπου δ) η µετάλλαξη C282Y µπορεί να αποτελεί αµέσως η εµµέσως παράγοντα κινδύνου για σακχαρώδη διαβήτη τύπου ε) Ακόµη και µικρές εναποθέσεις σιδήρου στα κύτταρα είναι δυνατόν να επηρεάσουν τη λειτουργία τους (ελαττωµένη έκκριση ινσουλίνης από το β κύτταρο η µειωµένη απάντηση στη δράση της ινσουλίνης σε επίπεδο ηπατοκυττάρου η µυϊκού κυττάρου) στα αρχικά 44, στάδια πριν ακόµη εκδηλωθεί κλινικά η νόσος Η κεντρική παχυσαρκία, η διαταραχή στην ανοχή γλυκόζης (η σακχαρώδης διαβήτης), η αρτηριακή υπέρταση, και η δυσλιπιδαιµία µαζί µε την αντίσταση στην ινσουλίνη (όπως αυτή εκτιµάται από µελέτες ευγλυκαιµικής clamp), αποτελούν τα συστατικά στοιχεία του λεγόµενου µεταβολικού συνδρόµου(insulin resistance syndrome-irs). Τελευταία, φαίνεται πως το ηπατικό φορτίο σε σίδηρο ενδέχεται να αποτελεί επίσης στοιχείο του ανωτέρω συνδρόµου (insulin resistance associated hepatic iron overload-irhio, εικόνα10) Η συχνότητα αυξηµένου φορτίου σιδήρου ήπατος, λιπώδους ήπατος η και των δύο, είναι πιθανόν µεγαλύτερη σε άτοµα µε αντίσταση στην ινσουλίνη από ότι σε ινσουλινοευαίσθητα άτοµα. Αντίστροφα, έρευνα σε άτοµα µε χαρακτηριστικά µεταβολικού συνδρόµου, είναι πιθανόν να διαπιστωθεί ότι 53

54 πολλά άτοµα πιθανόν να φέρουν αυξηµένο φορτίο σιδήρου. Οι µηχανισµοί που µπορεί να υποκρύπτονται κάτω από την συσχέτιση µεταβολισµού του σιδήρου και µεταβολικού συνδρόµου, δεν έχουν προσδιορισθεί. ιάφορες µελέτες έχουν χρησιµοποιήσει διαφορετικούς ορισµούς του µεταβολικού συνδρόµου, όπως επίσης και διαφορετικούς τρόπους εκτίµησης του φορτίου µε σίδηρο.ένα στοιχείο που δεν εξηγείται επαρκώς είναι το γεγονός ότι το IRHIO φαίνεται να προτιµά άντρες ενώ όπως είναι γνωστό το IRS είναι συχνό στις µετεµηνοπαυσιακές γυναίκες. ιαταραχές τόσο στην έκκριση όσο και στη δράση της ινσουλίνης παρατηρούνται σε ασθενείς µε γενετική αιµοχρωµάτωση στο προκιρρωτικό στάδιο. Επίσης η γενετική αιµοχρωµάτωση είναι πιο συχνή ανάµεσα στους διαβητικούς τύπου 2 από ότι στους µη διαβητικούς σύµφωνα µε µία πρόσφατη µελέτη. 53 Έτσι, είναι δυνατόν να υπάρχει γενετική συσχέτιση ανάµεσα στο σακχαρώδη διαβήτη και την αιµοχρωµάτωση και η συνύπαρξη αυξηµένου ηπατικού φορτίου σιδήρου (hepatic iron overload- HIO) και µεταβολικού συνδρόµου (insulin resistance syndrome-irs) µπορεί απλά να αντανακλά την έκφραση γενετικών στοιχείων. Για παράδειγµα, ετερόζυγες µεταλλάξεις C282Y η H63D µπορεί να βρίσκονται σε γενετική σύνδεση (linkage disequilibrium) µε άγνωστα γονίδια που προδιαθέτουν στο σακχαρώδη διαβήτη τύπου 2. Στο φυσιολογικό επίπεδο, το αυξηµένο φορτίο σιδήρου του ήπατος, θα µπορούσε να εµποδίζει την κάθαρση ινσουλίνης από το ηπατοκύτταρο και να προκαλεί περιφερική υπερινσουλιναιµία µε αποτέλεσµα ελάττωση των υποδοχέων της ινσουλίνης και κατά συνέπεια µείωση της δράσης της στην περιφέρεια. Σε αυτό το µοντέλο οποιαδήποτε αιτία εναπόθεσης σιδήρου στο ήπαρ (πχ αιµοσιδήρωση από µεταγγίσεις) θα οδηγούσε σε υπερινσουλιναιµία και αντίσταση στην ινσουλίνη. Εναλλακτικά, η αντίσταση στην ινσουλίνη είναι δυνατόν µέσω της µη ελεγχόµενης λιπόλυσης και αυξηµένης προσφοράς λιπαρών οξέων στο 54

55 ήπαρ να προκαλέσει λιπώδη διήθηση αυτού. Είναι γνωστό ότι οι υποδοχείς τρανσφερίνης, όπως και οι υποδοχείς IGF2 και οι µεταφορείς γλυκόζης (GLUT4) συνυπάρχουν στις µικροσωµιακές µεµβράνες και κινητοποιούνται µαζί από τη δράση της ινσουλίνης στην κυτταροπλασµατική µεµβράνη, τουλάχιστον σε καλλιέργεια λιποκυττάρων 82. Έτσι η δράση της ινσουλίνης που αφορά την διευκόλυνση της µεταφοράς γλυκόζης µπορεί να είναι στενά συνυφασµένη µε την ανακατανοµή των υποδοχέων τρανσφερίνης στην κυτταροπλασµατική µεµβράνη και κατά συνέπεια την είσοδο σιδήρου στο ηπατοκύτταρο. Θεωρητικά η υπερινσουλιναιµία θα µπορούσε να προκαλέσει συσσώρευση σιδήρου στο ηπατοκύτταρο. Μία άλλη ερµηνεία του συνδρόµου είναι η εναπόθεση σιδήρου στο ήπαρ λόγω φλεγµονής. Αφού το σύνδροµο αντίστασης στην ινσουλίνη, είναι µια φλεγµονώδης διεργασία, η γενικευµένη ενεργοποίηση φλεγµονωδών κυτταροκινών στον υπενδοθηλιακό χώρο αυξάνει την µεταγραφή φερριτίνης στα µακροφάγα. Αυτά τα κύτταρα µπορούν στη συνέχεια να µεταφέρουν φερριτίνη στα ηπατοκύτταρα. Υπάρχει σειρά µελετών που δείχνει ότι στους διαβητικούς τύπου 2 τα επίπεδα φερριτίνης είναι αυξηµένα και σχετίζονται θετικά µε το βαθµό αντίστασης στην ινσουλίνη 70,72,85-86 Από πολλών ετών, ο σακχαρώδης διαβήτης θεωρήθηκε ως ένα από τα κλασσικά χαρακτηριστικά της κληρονοµικής αιµοχρωµάτωσης. Σε µία µελέτη 163 ασθενών µε κληρονοµική αιµοχρωµάτωση, 71% των κιρρωτικών και 20% των µη κιρρωτικών ασθενών ήσαν διαβητικοί. 45. Σε άλλες µελέτες η συχνότητα του σακχαρώδους διαβήτη τύπου 2 σε ασθενείς µε κληρονοµική αιµοχρωµάτωση αναφέρεται σε ποσοστό 20%-50% Η συχνότητα της κληρονοµικής αιµοχρωµάτωσης σε διαβητικούς τύπου 2 δεν έχει µελετηθεί επαρκώς, και τα συµπεράσµατα των µελετών είναι συχνά αντικρουόµενα. H συχνότητα της ανακοινώθηκε, οτι κυµαίνεται από 0,49%-0. 96% σε 3 σειρές ασθενών χωρίς οµάδα ελέγχου Σε µία 55

Παχυσαρκία και Σακχαρώδης Διαβήτης

Παχυσαρκία και Σακχαρώδης Διαβήτης Παχυσαρκία και Σακχαρώδης Διαβήτης Τι είναι ο Σακχαρώδης Διαβήτης τύπου 2 (ΣΔ2) Ο Σακχαρώδης Διαβήτης γενικά είναι μια πάθηση κατά την οποία ο οργανισμός και συγκεκριμένα το πάγκρεας δεν παράγει ή δεν

Διαβάστε περισσότερα

«β-μεσογειακή αναιμία: το πιο συχνό μονογονιδιακό νόσημα στη χώρα μας»

«β-μεσογειακή αναιμία: το πιο συχνό μονογονιδιακό νόσημα στη χώρα μας» Εργαστήριο Κυτταρογενετικής ΕΚΕΦΕ «Δημόκριτος» «β-μεσογειακή αναιμία: το πιο συχνό μονογονιδιακό νόσημα στη χώρα μας» Ζαχάκη Σοφία - Ουρανία Βιολόγος, MSc, PhD β μεσογειακή αναιμία Η θαλασσαιμία ή νόσος

Διαβάστε περισσότερα

ΔΥΣΛΙΠΙΔΑΙΜΙΑ. Νικολούδη Μαρία. Ειδικ. Παθολόγος, Γ.Ν.Θ.Π. «Η Παμμακάριστος»

ΔΥΣΛΙΠΙΔΑΙΜΙΑ. Νικολούδη Μαρία. Ειδικ. Παθολόγος, Γ.Ν.Θ.Π. «Η Παμμακάριστος» ΔΥΣΛΙΠΙΔΑΙΜΙΑ Νικολούδη Μαρία Ειδικ. Παθολόγος, Γ.Ν.Θ.Π. «Η Παμμακάριστος» Ο όρος δυσλιπιδαιμία εκφράζει τις ποσοτικές και ποιοτικές διαταραχές των λιπιδίων του αίματος. Τα λιπίδια όπως η χοληστερόλη και

Διαβάστε περισσότερα

Κλαίρη Μ. Εργασία στη Βιολογία Α'2 Λυκείου

Κλαίρη Μ. Εργασία στη Βιολογία Α'2 Λυκείου Κλαίρη Μ. Εργασία στη Βιολογία Α'2 Λυκείου Διαβήτης. Ακούμε καθημερίνα γύρω μας πως εκατομμύρια άνθρωποι στον κόσμο πάσχουν από διαβήτη ή παχυσαρκία. Όμως, τι πραγματικά είναι αυτό; Τι ειναι ο σακχαρώδης

Διαβάστε περισσότερα

Υποχρεωτικό κατ επιλογήν µάθηµα «Κλινική Βιοχηµεία»

Υποχρεωτικό κατ επιλογήν µάθηµα «Κλινική Βιοχηµεία» ΠΑΝΕΠΙΣΤΗΜΙΟ ΘΕΣΣΑΛΙΑΣ Τµήµα Ιατρικής Υποχρεωτικό κατ επιλογήν µάθηµα «Κλινική Βιοχηµεία» - Συνοπτική παρουσίαση του µαθήµατος - Αναλυτική ύλη του µαθήµατος Λάρισα 2010 Συνοπτική παρουσίαση του υποχρεωτικού

Διαβάστε περισσότερα

ΤΟΥ ΣΑΚΧΑΡΩ Η ΙΑΒΗΤΗ. ρ. Μυλωνάκη Θεοχαρούλα. Υπεύθυνη ιαβητολογικού Ιατρείου

ΤΟΥ ΣΑΚΧΑΡΩ Η ΙΑΒΗΤΗ. ρ. Μυλωνάκη Θεοχαρούλα. Υπεύθυνη ιαβητολογικού Ιατρείου ΕΓΚΑΙΡΗ ΙΑΓΝΩΣΗ & ΑΝΤΙΜΕΤΩΠΙΣΗ ΤΟΥ ΣΑΚΧΑΡΩ Η ΙΑΒΗΤΗ ρ. Μυλωνάκη Θεοχαρούλα ιευθύντρια Β Παθολογικής Κλινικής Γ.Ν. Χανίων Υπεύθυνη ιαβητολογικού Ιατρείου Πινακοθήκη ήµου Χανίων, 17/02/2012 Συχνότητα του

Διαβάστε περισσότερα

ΟΡΟΛΟΣΤΗΣΑΣΚΗΣΗΣΣΤΟ ΜΕΤΑΒΟΛΙΚΟΣΥΝ ΡΟΜΟ, ΣΤΑ ΛΙΠΙ ΙΑ ΚΑΙ ΣΤΙΣ ΛΙΠΟΠΡΩΤΕΪΝΕΣ

ΟΡΟΛΟΣΤΗΣΑΣΚΗΣΗΣΣΤΟ ΜΕΤΑΒΟΛΙΚΟΣΥΝ ΡΟΜΟ, ΣΤΑ ΛΙΠΙ ΙΑ ΚΑΙ ΣΤΙΣ ΛΙΠΟΠΡΩΤΕΪΝΕΣ ΟΡΟΛΟΣΤΗΣΑΣΚΗΣΗΣΣΤΟ ΜΕΤΑΒΟΛΙΚΟΣΥΝ ΡΟΜΟ, ΣΤΑ ΛΙΠΙ ΙΑ ΚΑΙ ΣΤΙΣ ΛΙΠΟΠΡΩΤΕΪΝΕΣ ΒασίληςΜούγιος, PhD ΤΕΦΑΑ ΑΠΘ http://mougios.webpages.auth.gr Μεταβολικό σύνδροµο Παθολογική κατάσταση που χαρακτηρίζεται από:

Διαβάστε περισσότερα

Δρ. Χρήστος Μανές ΘΕΣΣΑΛΟΝΙΚΗ

Δρ. Χρήστος Μανές ΘΕΣΣΑΛΟΝΙΚΗ Δρ. Χρήστος Μανές Παθολόγος µε εξειδίκευση στο Σακχαρώδη Διαβήτη ΠΡΟΕΔΡΟΣ ΕΜΕΔΙΠ Διευθυντής Παθολογικού τµήµατος και Διαβητολογικού Κέντρου Γ.Π.Ν «ΠΑΠΑΓΕΩΡΓΙΟΥ» ΘΕΣΣΑΛΟΝΙΚΗ Σακχαρώδης Διαβήτης 220 εκατοµµύρια

Διαβάστε περισσότερα

Νοσολογία_Νοσ. 1201 Σακχαρώδης ιαβήτης. C.D.A. Εβδ.6 ΣΑΚΧΑΡΩ ΗΣ ΙΑΒΗΤΗΣ 01/28

Νοσολογία_Νοσ. 1201 Σακχαρώδης ιαβήτης. C.D.A. Εβδ.6 ΣΑΚΧΑΡΩ ΗΣ ΙΑΒΗΤΗΣ 01/28 ΣΑΚΧΑΡΩ ΗΣ ΙΑΒΗΤΗΣ 01/28 Ορισµός: Αφορά παθολογικό µεταβολισµό των υδατανθράκων [των λιπών και των πρωτεϊνών (WHO 1998)], και χαρακτηρίζεται από υπεργλυκαιµία. Σχετίζεται µε σχετική ή απόλυτη διαταραχή

Διαβάστε περισσότερα

Ν. Κατσίκη[1], Α. Γκοτζαμάνη-Ψαρράκου[2], Φ. Ηλιάδης[1], Τρ. Διδάγγελος[1], Ι. Γιώβος[3], Δ. Καραμήτσος[1]

Ν. Κατσίκη[1], Α. Γκοτζαμάνη-Ψαρράκου[2], Φ. Ηλιάδης[1], Τρ. Διδάγγελος[1], Ι. Γιώβος[3], Δ. Καραμήτσος[1] Ολόγοςλεπτίνης/αδιπονεκτίνης ως ανεξάρτητος προγνωστικός παράγοντας 10ετούς καρδιαγγειακού κινδύνου σε ινσουλινοθεραπευόμενους ασθενείς με διαβήτη τύπου 2 Ν. Κατσίκη[1], Α. Γκοτζαμάνη-Ψαρράκου[2], Φ. Ηλιάδης[1],

Διαβάστε περισσότερα

ΣΑΚΧΑΡΩΔΗΣ ΔΙΑΒΗΤΗΣ ΚΑΙ ΑΣΚΗΣΗ. Θανάσης Ζ. Τζιαμούρτας, Ph.D.

ΣΑΚΧΑΡΩΔΗΣ ΔΙΑΒΗΤΗΣ ΚΑΙ ΑΣΚΗΣΗ. Θανάσης Ζ. Τζιαμούρτας, Ph.D. ΣΑΚΧΑΡΩΔΗΣ ΔΙΑΒΗΤΗΣ ΚΑΙ ΑΣΚΗΣΗ Θανάσης Ζ. Τζιαμούρτας, Ph.D. Τι είναι σακχαρώδης διαβήτης; Παθοφυσιολογική κατάσταση η οποία χαρακτηρίζεται από αυξημένη συγκέντρωση σακχάρου στο αίμα Καμπύλη σακχάρου (75

Διαβάστε περισσότερα

Συστήματα επικοινωνίας Ανθρωπίνου σώματος. ενδοκρινολογικό νευρικό σύστημα

Συστήματα επικοινωνίας Ανθρωπίνου σώματος. ενδοκρινολογικό νευρικό σύστημα Κύτταρο Το κύτταρο αποτελείται από μέρη τα οποία έχουν συγκεκριμένη δομή και επιτελούν μία συγκεκριμένη λειτουργία στην όλη οργάνωση του κυττάρου. Δομή κυτταροπλασματικής μεμβράνης Συστήματα επικοινωνίας

Διαβάστε περισσότερα

Στέργιος Ι. Τραπότσης Χειρουργός Ορθοπαιδικός Διδάκτωρ Ιατρικής Σχολής ΑΠΘ Διδάσκων ΤΕΦAΑ-ΠΘ

Στέργιος Ι. Τραπότσης Χειρουργός Ορθοπαιδικός Διδάκτωρ Ιατρικής Σχολής ΑΠΘ Διδάσκων ΤΕΦAΑ-ΠΘ Άσκηση, διατροφή & υγεία Στέργιος Ι. Τραπότσης Χειρουργός Ορθοπαιδικός Διδάκτωρ Ιατρικής Σχολής ΑΠΘ Διδάσκων ΤΕΦAΑ-ΠΘ Άσκηση, διατροφή & υγεία Μακροχρόνια επιστημονική έρευνα έχει αποδείξει ότι πολλά από

Διαβάστε περισσότερα

ΑΠΟΙΚΟΔΟΜΗΣΗ ΛΙΠΑΡΩΝ ΟΞΕΩΝ II ΚΕΤΟΝΟΣΩΜΑΤΑ

ΑΠΟΙΚΟΔΟΜΗΣΗ ΛΙΠΑΡΩΝ ΟΞΕΩΝ II ΚΕΤΟΝΟΣΩΜΑΤΑ ΑΠΟΙΚΟΔΟΜΗΣΗ ΛΙΠΑΡΩΝ ΟΞΕΩΝ II ΚΕΤΟΝΟΣΩΜΑΤΑ ΗΠΑΡ VLDL Ανασκόπηση μεταβολισμού λιπιδίων & λιποπρωτεϊνών ΤΡΟΦΗ ΛΙΠΩΔΗΣ ΙΣΤΟΣ ΗΠΑΡ Κυκλοφορία Χυλομικρά Λιπαρά οξέα HDL LDL VLDL ΗΠΑΡ Τριγλυκερίδια Φωσφολίπιδια

Διαβάστε περισσότερα

ιάγνωση και ταξινόµηση του σακχαρώδη διαβήτη και της δυσανεξίας στη γλυκόζη

ιάγνωση και ταξινόµηση του σακχαρώδη διαβήτη και της δυσανεξίας στη γλυκόζη 02 ιάγνωση και ταξινόµηση του σακχαρώδη διαβήτη και της δυσανεξίας στη γλυκόζη Κ. ΦΑΙΝΕΚΟΣ τ. Διευθυντής Τμήματος Ενδοκρινολογίας και Μεταβολισμού, Γ.Ν.Α «Κοργιαλένειο-Μπενάκειο ΕΕΣ» Εισαγωγή διάγνωση

Διαβάστε περισσότερα

ΟΡΘΟΧΡΩΜΕΣΟΡΘΟΚΥΤΤΑΡΙΚΕΣ ΑΝΑΙΜΙΕΣ. ΑΗΔΟΝΟΠΟΥΛΟΣ ΣΤΥΛΙΑΝΟΣ Διευθυντής Αιματολογικού Εργαστηρίου Γ.Ν.Α. «Ο Ευαγγελισμός»

ΟΡΘΟΧΡΩΜΕΣΟΡΘΟΚΥΤΤΑΡΙΚΕΣ ΑΝΑΙΜΙΕΣ. ΑΗΔΟΝΟΠΟΥΛΟΣ ΣΤΥΛΙΑΝΟΣ Διευθυντής Αιματολογικού Εργαστηρίου Γ.Ν.Α. «Ο Ευαγγελισμός» ΟΡΘΟΧΡΩΜΕΣΟΡΘΟΚΥΤΤΑΡΙΚΕΣ ΑΝΑΙΜΙΕΣ ΑΗΔΟΝΟΠΟΥΛΟΣ ΣΤΥΛΙΑΝΟΣ Διευθυντής Αιματολογικού Εργαστηρίου Γ.Ν.Α. «Ο Ευαγγελισμός» ΤΑΞΙΝΟΜΗΣΗ ΑΝΑΙΜΙΩΝ ΣΥΣΤΗΜΑΤΑ ΤΑΞΙΝΟΜΗΣΗΣ ΚΛΙΝΙΚΗ ΤΑΞΙΝΟΜΗΣΗ ΑΙΤΙΟΛΟΓΙΚΗ ΤΑΞΙΝΟΜΗΣΗ

Διαβάστε περισσότερα

ΜΕΤΑΒΟΛΙΣΜΟΣ ΝΗΣΤΙΚΟΥ ΚΑΙ ΤΡΑΦΕΝΤΟΣ ΟΡΓΑΝΙΣΜΟΥ Tον ανθρώπινο µεταβολισµό το χαρακτηρίζουν δύο στάδια. Tοπρώτοείναιηκατάστασητουοργανισµούµετά

ΜΕΤΑΒΟΛΙΣΜΟΣ ΝΗΣΤΙΚΟΥ ΚΑΙ ΤΡΑΦΕΝΤΟΣ ΟΡΓΑΝΙΣΜΟΥ Tον ανθρώπινο µεταβολισµό το χαρακτηρίζουν δύο στάδια. Tοπρώτοείναιηκατάστασητουοργανισµούµετά ΜΕΤΑΒΟΛΙΣΜΟΣ ΝΗΣΤΙΚΟΥ ΚΑΙ ΤΡΑΦΕΝΤΟΣ ΟΡΓΑΝΙΣΜΟΥ Tον ανθρώπινο µεταβολισµό το χαρακτηρίζουν δύο στάδια. Tοπρώτοείναιηκατάστασητουοργανισµούµετά απόκάποιογεύµα, οπότετοαίµαείναιπλούσιοσε θρεπτικές ύλες από

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΙΑΓΩΝΙΣΜΑ Θέµα 1 ο 1. Τα άτοµα που είναι ετερόζυγα για τη β-θαλασσαιµία: α. Εµφανίζουν ήπια αναιµία β. Έχουν ευαισθησία στην ελονοσία γ. Συνθέτουν µεγάλη ποσότητα HbF δ.

Διαβάστε περισσότερα

ΘΕΜΑ Α Α1. β Α2. δ Α3. α Α4. α Α5. γ

ΘΕΜΑ Α Α1. β Α2. δ Α3. α Α4. α Α5. γ ΘΕΜΑ Α Α1. β Α2. δ Α3. α Α4. α Α5. γ ΘΕΜΑ B B1. Η συχνότητα των ετερόζυγων ατόμων με δρεπανοκυτταρική αναιμία ή β- θαλασσαιμία είναι αυξημένη σε περιοχές όπως οι χώρες της Μεσογείου, της Δυτικής και Ανατολικής

Διαβάστε περισσότερα

Β. ΚΑΜΙΝΕΛΛΗΣ ΒΙΟΛΟΓΙΑ. Είναι η επιστήμη που μελετά τους ζωντανούς οργανισμούς. (Αποτελούνται από ένα ή περισσότερα κύτταρα).

Β. ΚΑΜΙΝΕΛΛΗΣ ΒΙΟΛΟΓΙΑ. Είναι η επιστήμη που μελετά τους ζωντανούς οργανισμούς. (Αποτελούνται από ένα ή περισσότερα κύτταρα). ΒΙΟΛΟΓΙΑ Είναι η επιστήμη που μελετά τους ζωντανούς οργανισμούς. (Αποτελούνται από ένα ή περισσότερα κύτταρα). Είδη οργανισμών Υπάρχουν δύο είδη οργανισμών: 1. Οι μονοκύτταροι, που ονομάζονται μικροοργανισμοί

Διαβάστε περισσότερα

Ηλίας Ν. Μυγδάλης. Β Παθολογική Κλινική και Διαβητολογικό Κέντρο, Γενικό Νοσοκομείο ΝΙΜΤΣ, Αθήνα

Ηλίας Ν. Μυγδάλης. Β Παθολογική Κλινική και Διαβητολογικό Κέντρο, Γενικό Νοσοκομείο ΝΙΜΤΣ, Αθήνα ΕΤΟΣ ΙΔΡΥΣΕΩΣ 1942 «Έναρξη ινσουλίνης στα άτομα με σακχαρώδη διαβήτη τύπου 2: πότε και πως ;» Ηλίας Ν. Μυγδάλης Β Παθολογική Κλινική και Διαβητολογικό Κέντρο, Γενικό Νοσοκομείο ΝΙΜΤΣ, Αθήνα Ειδικό φροντιστήριο

Διαβάστε περισσότερα

Πίνακας 7. ΕΚΤΙΜΗΣΗ ΥΠΕΡΓΛΥΚΑΙΜΙΑΣ ΥΠΕΡΓΥΚΑΙΜΙΚΕΣ ΔΙΑΤΑΡΑΧΕΣ

Πίνακας 7. ΕΚΤΙΜΗΣΗ ΥΠΕΡΓΛΥΚΑΙΜΙΑΣ ΥΠΕΡΓΥΚΑΙΜΙΚΕΣ ΔΙΑΤΑΡΑΧΕΣ Η ρύθμιση των επιπέδων σακχάρου του αίματος βρίσκεται κάτω από αυστηρό ορμονολογικό έλεγχο. Η έκκριση της ινσουλίνης διεγείρεται από την υπεργλυκαιμία και αποτέλεσμα της δράσης της είναι η ελάττωση της

Διαβάστε περισσότερα

Μέχρι σήµερα γνωρίζατε ότι η κατανάλωση ψωµιού είναι µία απολαυστική και θρεπτική συνήθεια. Από σήµερα η αγαπηµένη σας αυτή καθηµερινή συνήθεια µπορεί να παρέχει στον οργανισµό ακόµη περισσότερα θρεπτικά

Διαβάστε περισσότερα

ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΕΝΙΑΙΟΥ ΛΥΚΕΙΟΥ ΠΕΜΠΤΗ 1 ΙΟΥΛΙΟΥ 2004 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ

ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΕΝΙΑΙΟΥ ΛΥΚΕΙΟΥ ΠΕΜΠΤΗ 1 ΙΟΥΛΙΟΥ 2004 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 1 ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΕΝΙΑΙΟΥ ΛΥΚΕΙΟΥ ΠΕΜΠΤΗ 1 ΙΟΥΛΙΟΥ 2004 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ 1ο 1. β 2. γ 3. α 4. γ 5. δ ΘΕΜΑ 2ο 1. Σχολικό

Διαβάστε περισσότερα

MANAGING AUTHORITY OF THE OPERATIONAL PROGRAMME EDUCATION AND INITIAL VOCATIONAL TRAINING ΑΛΚΟΟΛΙΣΜΟΣ. ΘΑΝΑΣΗΣ ΤΖΙΑΜΟΥΡΤΑΣ, Ph.D., C.S.C.

MANAGING AUTHORITY OF THE OPERATIONAL PROGRAMME EDUCATION AND INITIAL VOCATIONAL TRAINING ΑΛΚΟΟΛΙΣΜΟΣ. ΘΑΝΑΣΗΣ ΤΖΙΑΜΟΥΡΤΑΣ, Ph.D., C.S.C. MANAGING AUTHORITY OF THE OPERATIONAL PROGRAMME EDUCATION AND INITIAL VOCATIONAL TRAINING ΑΛΚΟΟΛΙΣΜΟΣ ΘΑΝΑΣΗΣ ΤΖΙΑΜΟΥΡΤΑΣ, Ph.D., C.S.C.S Η υπέρμετρη κατανάλωση οινοπνεύματος αποτελεί τη μοναδική κυριότερη

Διαβάστε περισσότερα

ΔΕΙΚΤΕΣ ΗΠΑΤΙΚΗΣ ΛΕΙΤΟΥΡΓΙΑΣ. Λ.Β. Αθανασίου Παθολογική Κλινική, Τμήμα Κτηνιατρικής, Π.Θ.

ΔΕΙΚΤΕΣ ΗΠΑΤΙΚΗΣ ΛΕΙΤΟΥΡΓΙΑΣ. Λ.Β. Αθανασίου Παθολογική Κλινική, Τμήμα Κτηνιατρικής, Π.Θ. ΔΕΙΚΤΕΣ ΗΠΑΤΙΚΗΣ ΛΕΙΤΟΥΡΓΙΑΣ Λ.Β. Αθανασίου Παθολογική Κλινική, Τμήμα Κτηνιατρικής, Π.Θ. ΔΕΙΚΤΕΣ ΗΠΑΤΙΚΗΣ ΛΕΙΤΟΥΡΓΙΑΣ Δείκτες βλάβης ηπατοκυττάρων Δείκτες χολόστασης Δείκτες ηπατικής δυσλειτουργίας ΔΕΙΚΤΕΣ

Διαβάστε περισσότερα

Από τον Κώστα κουραβανα

Από τον Κώστα κουραβανα Από τον Κώστα κουραβανα Περιεχόμενα Γενικός ορισμός παχυσαρκίας Ορμονικοί-Γονιδιακοί-παράγοντες Επιπτώσεις στην υγεία Θεραπεία-Δίαιτα Γενικός ορισμός παχυσαρκίας Παχυσαρκία είναι κλινική κατάσταση στην

Διαβάστε περισσότερα

ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ Ο.Ε.Φ.Ε. 2004 ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ Γ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ

ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ Ο.Ε.Φ.Ε. 2004 ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ Γ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ Ο.Ε.Φ.Ε. 2004 ΘΕΜΑ 1 Ο Α. Να επιλέξετε την ορθή πρόταση: ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ Γ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 1. Το κωδικόνιο του mrna που κωδικοποιεί το αµινοξύ µεθειονίνη είναι α. 5 GUA

Διαβάστε περισσότερα

Προδιαβήτης και µεταβολικό σύνδροµο

Προδιαβήτης και µεταβολικό σύνδροµο Προδιαβήτης και µεταβολικό σύνδροµο ΚΑΤΑΣΤΑΣΕΙΣ ΙΑΦΟΡΕΤΙΚΕΣ Ι. Ιωαννίδης Παθολόγος Υπεύθυνος ιαβητολογικού Ιατρείου και Ιατρείου Παχυσαρκίας Κωνσταντοπούλειο Συγκρότηµα Γ.Ν.Ν.Ιωνίας«Αγία Όλγα» Προδιαβήτης

Διαβάστε περισσότερα

Θέματα Πανελλαδικών 2000-2013

Θέματα Πανελλαδικών 2000-2013 Θέματα Πανελλαδικών 2000-2013 ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΗΜΕΡΗΣΙΩΝ ΛΥΚΕΙΩΝ ΕΣΠΕΡΙΝΩΝ ΛΥΚΕΙΩΝ ΕΠΑΝΑΛΗΠΤΙΚΕΣ Κεφάλαιο 8 ΚΕΦΑΛΑΙΟ 8 ΘΕΜΑ 1 ο Γράψτε τον αριθμό καθεμιάς από τις παρακάτω προτάσεις και δίπλα το γράμμα

Διαβάστε περισσότερα

Ανθρώπινο σώμα: 1200 gr Ca. 99% στα οστά και τα δόντια Το υπόλοιπο βρίσκεται στους ιστούς

Ανθρώπινο σώμα: 1200 gr Ca. 99% στα οστά και τα δόντια Το υπόλοιπο βρίσκεται στους ιστούς ΡΥΘΜΙΣΗ ΑΣΒΕΣΤΙΟΥ Ανθρώπινο σώμα: 1200 gr Ca 99% στα οστά και τα δόντια Το υπόλοιπο βρίσκεται στους ιστούς ΡΟΛΟΣ ΕΞΩΚΥΤΤΑΡΙΟΥ Ca ++ Μυϊκή συστολή Συναπτική διαβίβαση Συσσώρευση αιμοπεταλίων Πήξη του αίματος

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ Γ ΛΥΚΕΙΟΥ ΚΑΤΕΥΘΥΝΣΗΣ 2007 ΕΚΦΩΝΗΣΕΙΣ

ΒΙΟΛΟΓΙΑ Γ ΛΥΚΕΙΟΥ ΚΑΤΕΥΘΥΝΣΗΣ 2007 ΕΚΦΩΝΗΣΕΙΣ ΘΕΜΑ 1ο ΒΙΟΛΟΓΙΑ Γ ΛΥΚΕΙΟΥ ΚΑΤΕΥΘΥΝΣΗΣ 2007 ΕΚΦΩΝΗΣΕΙΣ Να γράψετε στο τετράδιό σας τον αριθµό καθεµιάς από τις παρακάτω ηµιτελείς προτάσεις 1 έως 5 και δίπλα το γράµµα που αντιστοιχεί στη λέξη ή τη φράση,

Διαβάστε περισσότερα

Πού οφείλεται η νόσος και ποιοι παράγοντες την πυροδοτούν:

Πού οφείλεται η νόσος και ποιοι παράγοντες την πυροδοτούν: 1 Τι είναι η Κίρρωση του Ήπατος: Η κίρρωση του ήπατος είναι μία χρόνια πάθηση του ήπατος κατά την οποία παρατηρείται καταστροφή του ιστού του ήπατος και αλλαγή της αρχιτεκτονικής του, γεγονός που οδηγεί

Διαβάστε περισσότερα

ΣΑΚΧΑΡΩΔΗΣ ΔΙΑΒΗΤΗΣ και ΚΑΡΚΙΝΟΣ: συνύπαρξη ή αιτιολογική σχέση;

ΣΑΚΧΑΡΩΔΗΣ ΔΙΑΒΗΤΗΣ και ΚΑΡΚΙΝΟΣ: συνύπαρξη ή αιτιολογική σχέση; ΣΑΚΧΑΡΩΔΗΣ ΔΙΑΒΗΤΗΣ και ΚΑΡΚΙΝΟΣ: συνύπαρξη ή αιτιολογική σχέση; Δ. Καραγιάννη, Β. Κουρκούμπας, Δ. Μπαλτζής, Γ. Κοτρώνης, Ε. Κιντιράκη, Χ.Τρακατέλλη, Α. Παυλίδου, Μ. Σιών Γ Παθολογική Κλινική ΑΠΘ, ΓΠΝΘ

Διαβάστε περισσότερα

Α1. Οι περιοχές του DNA που μεταφράζονται σε αμινοξέα ονομάζονται α. εσώνια β. εξώνια γ. υποκινητές δ. 5 αμετάφραστες περιοχές.

Α1. Οι περιοχές του DNA που μεταφράζονται σε αμινοξέα ονομάζονται α. εσώνια β. εξώνια γ. υποκινητές δ. 5 αμετάφραστες περιοχές. ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΚΑΙ ΕΠΑΛ (ΟΜΑΔΑ Β ) ΠΑΡΑΣΚΕΥΗ 22 ΜΑΪΟΥ 2015 - ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ Α Να γράψετε στο τετράδιό σας τον αριθμό καθεμίας

Διαβάστε περισσότερα

ΛΙΠΙΔΙΑ - ΛΙΠΟΠΡΩΤΕΪΝΕΣ. ΛΙΠΙΔΙΑ Τι είναι; - Λειτουργίες. Η. ΜΥΛΩΝΗΣ Κλινική Χημεια Λιπίδια-Λιποπρωτεϊνες - May 12, 2015 ΛΙΠΙΔΙΑ - ΛΙΠΟΠΡΩΤΕΪΝΕΣ

ΛΙΠΙΔΙΑ - ΛΙΠΟΠΡΩΤΕΪΝΕΣ. ΛΙΠΙΔΙΑ Τι είναι; - Λειτουργίες. Η. ΜΥΛΩΝΗΣ Κλινική Χημεια Λιπίδια-Λιποπρωτεϊνες - May 12, 2015 ΛΙΠΙΔΙΑ - ΛΙΠΟΠΡΩΤΕΪΝΕΣ ΛΙΠΙΔΙΑ - ΛΙΠΟΠΡΩΤΕΪΝΕΣ ΛΙΠΙΔΙΑ - ΛΙΠΟΠΡΩΤΕΪΝΕΣ Είδη ιπιδίων Ιδιότητες Λιποπρωτείνες Ταξινόμηση Σύσταση σε ιπίδια και αποπρωτείνες Μεταβοισμός Επιθυμητές τιμές οριακές τιμές Δυσιπιδαιμίες - Υπεριποπρωτεϊναιμίες

Διαβάστε περισσότερα

Κορίτσι 20 ετών προσήλθε εξαιτίας εκούσιας λήψης 20 tb παρακεταμόλης (10γρ.) και 30 tb βαλεριάνας Aναφέρεται ταυτόχρονη λήψη αλκοόλ Λήψη ουσιών δύο

Κορίτσι 20 ετών προσήλθε εξαιτίας εκούσιας λήψης 20 tb παρακεταμόλης (10γρ.) και 30 tb βαλεριάνας Aναφέρεται ταυτόχρονη λήψη αλκοόλ Λήψη ουσιών δύο ΤΟΥΛΟΥΜΤΖΗ ΜΑΡΙΑ Κορίτσι 20 ετών προσήλθε εξαιτίας εκούσιας λήψης 20 tb παρακεταμόλης (10γρ.) και 30 tb βαλεριάνας Aναφέρεται ταυτόχρονη λήψη αλκοόλ Λήψη ουσιών δύο ώρες πριν την προσέλευση Αίσθημα ζάλης

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ 16-2-2014 ΘΕΜΑ 1 ο Α. Να βάλετε σε κύκλο το γράμμα που αντιστοιχεί στη σωστή απάντηση. (Μονάδες 25)

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ 16-2-2014 ΘΕΜΑ 1 ο Α. Να βάλετε σε κύκλο το γράμμα που αντιστοιχεί στη σωστή απάντηση. (Μονάδες 25) ΤΣΙΜΙΣΚΗ &ΚΑΡΟΛΟΥ ΝΤΗΛ ΓΩΝΙΑ THΛ: 270727 222594 ΑΡΤΑΚΗΣ 12 - Κ. ΤΟΥΜΠΑ THΛ: 919113 949422 ΕΠΩΝΥΜΟ:... ΟΝΟΜΑ:... ΤΜΗΜΑ:... ΗΜΕΡΟΜΗΝΙΑ:... ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ 16-2-2014 ΘΕΜΑ 1 ο Α. Να βάλετε σε

Διαβάστε περισσότερα

Ενδεικτικές απαντήσεις βιολογίας κατεύθυνσης 2014

Ενδεικτικές απαντήσεις βιολογίας κατεύθυνσης 2014 Θέμα Α Α1. δ Α2. γ Α3. β Α4. γ Α5. β Θέμα Β ΑΓ.ΚΩΝΣΤΑΝΤΙΝΟΥ 11 -- ΠΕΙΡΑΙΑΣ -- 18532 -- ΤΗΛ. 210-4224752, 4223687 Ενδεικτικές απαντήσεις βιολογίας κατεύθυνσης 2014 Β1. 4 2 1 6 3 5 Β2. α. DNA πολυμεράση

Διαβάστε περισσότερα

ΑΥΞΗΤΙΚΗ ΟΡΜΟΝΗ, ΙΝΣΟΥΛΙΝΟΜΙΜΗΤΙΚΟΣ ΑΥΞΗΤΙΚΟΣ ΠΑΡΑΓΟΝΤΑΣ-Ι ΚΑΙ ΑΣΚΗΣΗ

ΑΥΞΗΤΙΚΗ ΟΡΜΟΝΗ, ΙΝΣΟΥΛΙΝΟΜΙΜΗΤΙΚΟΣ ΑΥΞΗΤΙΚΟΣ ΠΑΡΑΓΟΝΤΑΣ-Ι ΚΑΙ ΑΣΚΗΣΗ MANAGING AUTHORITY OF THE OPERATIONAL PROGRAMME EDUCATION AND INITIAL VOCATIONAL TRAINING ΑΥΞΗΤΙΚΗ ΟΡΜΟΝΗ, ΙΝΣΟΥΛΙΝΟΜΙΜΗΤΙΚΟΣ ΑΥΞΗΤΙΚΟΣ ΠΑΡΑΓΟΝΤΑΣ-Ι ΚΑΙ ΑΣΚΗΣΗ ΘΑΝΑΣΗΣ ΤΖΙΑΜΟΥΡΤΑΣ, Ph.D., C.S.C.S Η αυξητική

Διαβάστε περισσότερα

ΜΕΤΑΜΟΣΧΕΥΣΗ ΝΕΦΡΟΥ. Λειτουργία των νεφρών. Συμπτώματα της χρόνιας νεφρικής ανεπάρκειας

ΜΕΤΑΜΟΣΧΕΥΣΗ ΝΕΦΡΟΥ. Λειτουργία των νεφρών. Συμπτώματα της χρόνιας νεφρικής ανεπάρκειας ΜΕΤΑΜΟΣΧΕΥΣΗ ΝΕΦΡΟΥ Η χρόνια νεφρική ανεπάρκεια είναι η προοδευτική, μη αναστρέψιμη μείωση της νεφρικής λειτουργίας, η οποία προκαλείται από βλάβη του νεφρού ποικίλης αιτιολογίας. Η χρόνια νεφρική ανεπάρκεια

Διαβάστε περισσότερα

Κληρονοµικά νοσήµατα και καταστάσεις που οφείλονται σε γονιδιακές µεταλλάξεις

Κληρονοµικά νοσήµατα και καταστάσεις που οφείλονται σε γονιδιακές µεταλλάξεις Κληρονοµικά νοσήµατα και καταστάσεις που οφείλονται σε γονιδιακές µεταλλάξεις ΤΡΟΠΟΣ ΚΛΗΡΟΝΟΜΗΣΗΣ ΤΩΝ ΚΥΡΙΟΤΕΡΩΝ ΚΛΗΡΟΝΟΜΙΚΩΝ ΝΟΣΩΝ ΑΥΤΟΣΩΜΙΚΗ ΕΠΙΚΡΑΤΗΣ ΑΥΤΟΣΩΜΙΚΗ ΥΠΟΛΕΙΠΟΜΕΝΗ ΦΥΛΟΣΥΝ ΕΤΗ ΥΠΟΛΕΙΠΟΜΕΝΗ

Διαβάστε περισσότερα

Βιολογία Κατεύθυνσης Γ Λυκείου ΚΥΡΙΑΚΗ 9 ΜΑΡΤΙΟΥ 2014 ΑΠΑΝΤΗΣΕΙΣ

Βιολογία Κατεύθυνσης Γ Λυκείου ΚΥΡΙΑΚΗ 9 ΜΑΡΤΙΟΥ 2014 ΑΠΑΝΤΗΣΕΙΣ Βιολογία Κατεύθυνσης Γ Λυκείου ΚΥΡΙΑΚΗ 9 ΜΑΡΤΙΟΥ 2014 ΑΠΑΝΤΗΣΕΙΣ Επιμέλεια: Δημήτρης Κοτρόπουλος ΘΕΜΑ Α Α1. γ Α2. γ Α3. γ Α4. δ Α5. δ ΘΕΜΑ B B1. Στήλη Ι Στήλη ΙΙ 1. στ 2. ζ 3. ε 4. α 5. δ 6. β 7. γ Β2.

Διαβάστε περισσότερα

ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΚΑΙ ΕΠΑΛ (ΟΜΑΔΑ Β) ΤΕΤΑΡΤΗ 4 ΙΟΥΝΙΟΥ 2014 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ

ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΚΑΙ ΕΠΑΛ (ΟΜΑΔΑ Β) ΤΕΤΑΡΤΗ 4 ΙΟΥΝΙΟΥ 2014 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 1 ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΚΑΙ ΕΠΑΛ (ΟΜΑΔΑ Β) ΤΕΤΑΡΤΗ 4 ΙΟΥΝΙΟΥ 2014 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ Α Α1. δ Α2. γ Α3. β Α4. γ Α5. β ΘΕΜΑ

Διαβάστε περισσότερα

Παράγοντες Καρδιαγγειακού Κινδύνου. Ενημέρωση & Πρόληψη

Παράγοντες Καρδιαγγειακού Κινδύνου. Ενημέρωση & Πρόληψη Παράγοντες Καρδιαγγειακού Κινδύνου Ενημέρωση & Πρόληψη Παράγοντες Καρδιαγγειακού Κινδύνου Μεταβολικό Σύνδρομο Παχυσαρκία Υπερλιπιδιαμία Υπέρταση Σακχαρώδης Διαβήτης Παράγοντες Καρδιαγγειακού Κινδύνου Μεταβολικό

Διαβάστε περισσότερα

ΕΝΔΕΙΚΤΙΚΕΣ ΑΠΑΝΤΗΣΕΙΣ ΒΙΟΛΟΓΙΑΣ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ

ΕΝΔΕΙΚΤΙΚΕΣ ΑΠΑΝΤΗΣΕΙΣ ΒΙΟΛΟΓΙΑΣ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΕΝΔΕΙΚΤΙΚΕΣ ΑΠΑΝΤΗΣΕΙΣ ΒΙΟΛΟΓΙΑΣ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ Α Α1 δ Α2 γ Α3 β Α4 γ Α5 β ΘΕΜΑ Β Β1 Κατά σειρά τα βήματα που οδηγούν στην κατασκευή του καρυότυπου είναι τα ακόλουθα: 4 2 1 6 3 5 Β2 α DNA πολυμεράσες

Διαβάστε περισσότερα

Τελικό κείμενο της Μελέτης. Σύνδρομο Πολυκυστικών Ωοθηκών: Διατροφή και Υγεία

Τελικό κείμενο της Μελέτης. Σύνδρομο Πολυκυστικών Ωοθηκών: Διατροφή και Υγεία Τελικό κείμενο της Μελέτης Σύνδρομο Πολυκυστικών Ωοθηκών: Διατροφή και Υγεία Τα τελικά προϊόντα προχωρημένης γλυκοζυλίωσης (Advanced Glycation End products, ) είναι μόρια υψηλής δραστικότητας, τα οποία

Διαβάστε περισσότερα

Πανελλήνιες Εξετάσεις Ημερήσιων Γενικών Λυκείων. Εξεταζόμενο Μάθημα: Βιολογία Θετικής Κατεύθυνσης, Ημ/νία: 04 Ιουνίου 2014. Απαντήσεις Θεμάτων

Πανελλήνιες Εξετάσεις Ημερήσιων Γενικών Λυκείων. Εξεταζόμενο Μάθημα: Βιολογία Θετικής Κατεύθυνσης, Ημ/νία: 04 Ιουνίου 2014. Απαντήσεις Θεμάτων Πανελλήνιες Εξετάσεις Ημερήσιων Γενικών Λυκείων Εξεταζόμενο Μάθημα: Βιολογία Θετικής Κατεύθυνσης, Ημ/νία: 04 Ιουνίου 2014 Απαντήσεις Θεμάτων ΘΕΜΑ Α A1. Τα πλασμίδια είναι: δ. κυκλικά δίκλωνα μόρια DNA

Διαβάστε περισσότερα

ΑΝΙΧΝΕΥΤΙΚΕΣ ΕΞΕΤΑΣΕΙΣ- ΠΡΟΓΕΝΝΗΤΙΚΟΣ ΕΛΕΓΧΟΣ Δρ. Ε.Τρακάκης

ΑΝΙΧΝΕΥΤΙΚΕΣ ΕΞΕΤΑΣΕΙΣ- ΠΡΟΓΕΝΝΗΤΙΚΟΣ ΕΛΕΓΧΟΣ Δρ. Ε.Τρακάκης ΑΝΙΧΝΕΥΤΙΚΕΣ ΕΞΕΤΑΣΕΙΣ- ΠΡΟΓΕΝΝΗΤΙΚΟΣ ΕΛΕΓΧΟΣ Δρ. Ε.Τρακάκης Οι ανιχνευτικές εξετάσεις (screening test) έχουν ευρεία εφαρμογή και μεγάλη πρακτική χρησιμότητα στον προγεννητικό έλεγχο. Ο προγεννητικός έλεγχος

Διαβάστε περισσότερα

Τα ορμονικά μόρια και η διαχείριση τους μέσα στο φυτό

Τα ορμονικά μόρια και η διαχείριση τους μέσα στο φυτό Φυσιολογία Φυτών Διαχείριση ορμονικών μορίων Τα ορμονικά μόρια και η διαχείριση τους μέσα στο φυτό Φυσιολογία Φυτών 3 ου Εξαμήνου Δ. Μπουράνης, Σ. Χωριανοπούλου 1 Φυσιολογία Φυτών Διαχείριση ορμονικών

Διαβάστε περισσότερα

ΠΡΟΤΕΙΝΟΜΕΝΑ ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ

ΠΡΟΤΕΙΝΟΜΕΝΑ ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΠΡΟΤΕΙΝΟΜΕΝΑ ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΘΕΜΑ 1 Ο Α. Να βάλετε σε κύκλο το γράμμα που αντιστοιχεί στη σωστή απάντηση ή στη φράση που συμπληρώνει σωστά την πρόταση. 1. H β- θαλασσαιμία είναι

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΘΕΜΑ 1ο Να γράψετε στο τετράδιό σας τον αριθμό καθεμιάς από τις παρακάτω ημιτελείς προτάσεις 1 έως 5 και δίπλα το γράμμα που αντιστοιχεί στη λέξη ή τη φράση, η οποία

Διαβάστε περισσότερα

Απαντήσεις Θεμάτων Πανελληνίων Εξετάσεων Ημερησίων Γενικών Λυκείων

Απαντήσεις Θεμάτων Πανελληνίων Εξετάσεων Ημερησίων Γενικών Λυκείων 4 Ιουνίου 2014 ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Απαντήσεις Θεμάτων Πανελληνίων Εξετάσεων Ημερησίων Γενικών Λυκείων ΘΕΜΑ Α Α.1δ Α.2 γ Α.3 β Α.4 γ Α.5 β ΘΕΜΑ Β B.1 4 2 1 6 3 5 B.2 α. DNAπολυμεράση β. πριμόσωμα

Διαβάστε περισσότερα

Η Επιτροπή Παιδείας της ΠΕΒ. Αθήνα, 4/6/2014 ΠΑΝΕΛΛΗΝΙΑ ΕΝΩΣΗ ΒΙΟΕΠΙΣΤΗΜΟΝΩΝ

Η Επιτροπή Παιδείας της ΠΕΒ. Αθήνα, 4/6/2014 ΠΑΝΕΛΛΗΝΙΑ ΕΝΩΣΗ ΒΙΟΕΠΙΣΤΗΜΟΝΩΝ Αθήνα, 4/6/2014 ΠΑΝΕΛΛΗΝΙΑ ΕΝΩΣΗ ΒΙΟΕΠΙΣΤΗΜΟΝΩΝ Σας αποστέλλουμε τις προτεινόμενες απαντήσεις που αφορούν τα θέματα της Βιολογίας Θετικής Κατεύθυνσης των Ημερησίων Γενικών Λυκείων και ΕΠΑΛ (Ομάδα Β ).

Διαβάστε περισσότερα

ΜΕΤΑΒΟΛΙΚΕΣ ΔΙΑΤΑΡΑΧΕΣ ΚΑΙ ΑΠΟΦΡΑΚΤΙΚΗ ΑΠΝΟΙΑ ΣΤΟΝ ΥΠΝΟ. Φώτης Καψιμάλης Αν. Δ/ντής Πνευμονολογικής Κλινικής Νοσοκομείο Ερρίκος Ντυνάν

ΜΕΤΑΒΟΛΙΚΕΣ ΔΙΑΤΑΡΑΧΕΣ ΚΑΙ ΑΠΟΦΡΑΚΤΙΚΗ ΑΠΝΟΙΑ ΣΤΟΝ ΥΠΝΟ. Φώτης Καψιμάλης Αν. Δ/ντής Πνευμονολογικής Κλινικής Νοσοκομείο Ερρίκος Ντυνάν ΜΕΤΑΒΟΛΙΚΕΣ ΔΙΑΤΑΡΑΧΕΣ ΚΑΙ ΑΠΟΦΡΑΚΤΙΚΗ ΑΠΝΟΙΑ ΣΤΟΝ ΥΠΝΟ Φώτης Καψιμάλης Αν. Δ/ντής Πνευμονολογικής Κλινικής Νοσοκομείο Ερρίκος Ντυνάν Σύνδρομο αποφρακτικής άπνοιας στον ύπνο ( ΣΑΥ) Συχνή διαταραχή (5%

Διαβάστε περισσότερα

Δυσλιπιδαιμίες αντιμετώπιση. Κωνσταντίνος Τζιόμαλος Λέκτορας Παθολογίας ΑΠΘ Α Προπαιδευτική Παθολογική Κλινική ΑΠΘ, Νοσοκομείο ΑΧΕΠΑ

Δυσλιπιδαιμίες αντιμετώπιση. Κωνσταντίνος Τζιόμαλος Λέκτορας Παθολογίας ΑΠΘ Α Προπαιδευτική Παθολογική Κλινική ΑΠΘ, Νοσοκομείο ΑΧΕΠΑ Δυσλιπιδαιμίες αντιμετώπιση Κωνσταντίνος Τζιόμαλος Λέκτορας Παθολογίας ΑΠΘ Α Προπαιδευτική Παθολογική Κλινική ΑΠΘ, Νοσοκομείο ΑΧΕΠΑ Δυσλιπιδαιμίες LDL-C HDL-C < 40 mg/dl Τριγλυκερίδια 150-199 mg/dl : οριακά

Διαβάστε περισσότερα

Θρομβοφιλία. (παθολογική. αιμόσταση). Ο όρος θρομβοφιλία σχετίζεται με επαναλαμβανόμενα ή υποτροπιάζοντα επεισόδια θρομβώσεων (αρτηριακών

Θρομβοφιλία. (παθολογική. αιμόσταση). Ο όρος θρομβοφιλία σχετίζεται με επαναλαμβανόμενα ή υποτροπιάζοντα επεισόδια θρομβώσεων (αρτηριακών «ΙΕΡΕΥΝΗΣΗ ΙΑΤΑΡΑΧΩΝ ΤΩΝ ΦΥΣΙΚΩΝ ΑΝΑΣΤΟΛΕΩΝ ΤΗΣ ΠΗΞΗΣ ΣΤΟΥΣ ΑΣΘΕΝΕΙΣ ΜΕ ΣΑΚΧΑΡΩ Η ΙΑΒΗΤΗ ΤΥΠΟΥ ΙΙ» Π.Γ.Ν.Θ. ΑΧΕΠΑ Βιοχημικό Εργαστήριο, Αιματολογικό Τμήμα Μικροβιολογικού Εργαστηρίου Θυσιάδου Κ, Ραπτάκη

Διαβάστε περισσότερα

κλινική και εργαστηριακή προσέγγιση των νοσημάτων του Τ. Ράλλης Καθηγητής Παθολογίας Ζώων Συντροφιάς, Τμήμα Κτηνιατρικής, ΑΠΘ

κλινική και εργαστηριακή προσέγγιση των νοσημάτων του Τ. Ράλλης Καθηγητής Παθολογίας Ζώων Συντροφιάς, Τμήμα Κτηνιατρικής, ΑΠΘ Τι είναι κοινό και τι όχι κατά την κλινική και εργαστηριακή προσέγγιση των νοσημάτων του ήπατος στο σκύλο και στη γάτα Τ. Ράλλης Καθηγητής Παθολογίας Ζώων Συντροφιάς, Τμήμα Κτηνιατρικής, ΑΠΘ Η γάτα δεν

Διαβάστε περισσότερα

ΤΑΞΙΝΟΜΗΣΗ-ΔΙΕΡΕΥΝΗΣΗ ΑΝΑΙΜΙΑΣ

ΤΑΞΙΝΟΜΗΣΗ-ΔΙΕΡΕΥΝΗΣΗ ΑΝΑΙΜΙΑΣ ΤΑΞΙΝΟΜΗΣΗ-ΔΙΕΡΕΥΝΗΣΗ ΑΝΑΙΜΙΑΣ ΑΠΑΡΤΙΩΜΕΝΗ ΔΙΔΑΣΚΑΛΙΑ ΣΤΗΝ ΑΙΜΑΤΟΛΟΓΙΑ ΦΕΒΡΟΥΑΡΙΟΣ-ΜΑΡΤΙΟΣ 2015 Αλ. Κουράκλη-Συμεωνίδου ΕΡΓΑΣΤΗΡΙΑΚΗ ΠΡΟΣΕΓΓΙΣΗ ΑΣΘΕΝΟΥΣ ΜΕ ΑΝΑΙΜΙΑ Βαρύτητα αναιμίας Μικρή (Ηb >10 gr/dl)

Διαβάστε περισσότερα

Παναγιώτα Κουτσογιάννη Αιµατολόγος ΝΥ Αιµοδοσίας Γ.Ν.Α. «Ο Ευαγγελισµός»

Παναγιώτα Κουτσογιάννη Αιµατολόγος ΝΥ Αιµοδοσίας Γ.Ν.Α. «Ο Ευαγγελισµός» ΑΙΜΟΘΕΡΑΠΕΙΑ ΣΕ ΜΑΚ ΜΕ ΜΙΚΤΗ ΑΣΥΜΒΑΤΟΤΗΤΑ ΑΒΟ Παναγιώτα Κουτσογιάννη Αιµατολόγος ΝΥ Αιµοδοσίας Γ.Ν.Α. «Ο Ευαγγελισµός» ΜΕΤΑΜΟΣΧΕΥΣΗ ΑΙΜΟΠΟΙΗΤΙΚΩΝ ΚΥΤΤΑΡΩΝ (ΜΑΚ) Αποδεκτή θεραπεία για ασθενείς µε: συγγενείς

Διαβάστε περισσότερα

ΠΡΟΤΕΙΝΟΜΕΝΕΣ ΑΠΑΝΤΗΣΕΙΣ ΒΙΟΛΟΓΙΑΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΔΙΑΓΩΝΙΣΜΑ 2

ΠΡΟΤΕΙΝΟΜΕΝΕΣ ΑΠΑΝΤΗΣΕΙΣ ΒΙΟΛΟΓΙΑΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΔΙΑΓΩΝΙΣΜΑ 2 ΠΡΟΤΕΙΝΟΜΕΝΕΣ ΑΠΑΝΤΗΣΕΙΣ ΒΙΟΛΟΓΙΑΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΔΙΑΓΩΝΙΣΜΑ 2 ΘΕΜΑ 1 Ο Α. 1 β, 2 α, 3 δ, 4 δ, 5 γ Β. 1 Λ, 2 Σ, 3 Λ, 4 Λ, 5 Λ ΘΕΜΑ 2 Ο Α. 1) α- θαλασσαιμία Σελ 93 σχολικού βιβλίου: ʽʽΤα γονίδια

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ. 1 ο ΔΙΑΓΩΝΙΣΜΑ ΑΠΑΝΤΗΣΕΙΣ. ΘΕΜΑ 1 o

ΒΙΟΛΟΓΙΑ. 1 ο ΔΙΑΓΩΝΙΣΜΑ ΑΠΑΝΤΗΣΕΙΣ. ΘΕΜΑ 1 o ΘΕΜΑ 1 o Γ ΛΥΚΕΙΟΥ-ΘΕΤΙΚΗ ΚΑΤΕΥΘΥΝΣΗ 1 ο ΔΙΑΓΩΝΙΣΜΑ Α. Γιατί τα βακτήρια μπορούν να χρησιμοποιηθούν σαν «εργοστάσια παραγωγής ανθρώπινων πρωτεϊνών»; Β. Σε ένα βακτήριο εισάγεται με τη μέθοδο του ανασυνδυασμένου

Διαβάστε περισσότερα

Παιδιά με διαβήτη. Παρά την καλή θρέψη γινόταν προοδευτικά πιο αδύναμα και καχεκτικά Ήταν ευπαθή στις λοιμώξεις Πέθαιναν από κατακλυσμιαία οξέωση

Παιδιά με διαβήτη. Παρά την καλή θρέψη γινόταν προοδευτικά πιο αδύναμα και καχεκτικά Ήταν ευπαθή στις λοιμώξεις Πέθαιναν από κατακλυσμιαία οξέωση ΙΝΣΟΥΛΙΝΗ Παιδιά με διαβήτη Παρά την καλή θρέψη γινόταν προοδευτικά πιο αδύναμα και καχεκτικά Ήταν ευπαθή στις λοιμώξεις Πέθαιναν από κατακλυσμιαία οξέωση Ιστοί στόχοι της Ινσουλίνης Η Ινσουλίνη ρυθμίζει

Διαβάστε περισσότερα

PROJECT. Ελαιόλαδο το χρυσάφι στο πιάτο μας. Ελαιόλαδο και υγεία

PROJECT. Ελαιόλαδο το χρυσάφι στο πιάτο μας. Ελαιόλαδο και υγεία ΜΕΛΗ ΟΜΑΔΑΣ: Γιώργος Δερμιτζάκης Δημήτρης Δημητρουλόπουλος Έλενα Ξενάκη Μαργαρίτα Χατζοπούλου PROJECT Ελαιόλαδο το χρυσάφι στο πιάτο μας Ελαιόλαδο και υγεία ΥΠΕΥΘΥΝΕΣ ΚΑΘΗΓΗΤΡΙΕΣ: Λαγουτάρη Ελένη Σούσου

Διαβάστε περισσότερα

Αναιμία. Σταυρούλα Τσιάρα Αναπληρώτρια Καθηγήτρια Παθολογίας

Αναιμία. Σταυρούλα Τσιάρα Αναπληρώτρια Καθηγήτρια Παθολογίας Αναιμία Σταυρούλα Τσιάρα Αναπληρώτρια Καθηγήτρια Παθολογίας Αναιμία Μειωμένα ερυθροκύτταρα Μειωμένη αιμοσφαιρίνη Η αναιμία είναι Σύμπτωμα! Προσδιορισμός της υποκείμενης νόσου -αιτιολογίας Προσδιορισμός

Διαβάστε περισσότερα

Αρχικά θα πρέπει να προσδιορίσουμε τι είναι η παχυσαρκία.

Αρχικά θα πρέπει να προσδιορίσουμε τι είναι η παχυσαρκία. Αρχικά θα πρέπει να προσδιορίσουμε τι είναι η παχυσαρκία. Παχυσαρκία είναι η παθολογική αύξηση του βάρους του σώματος, που οφείλεται σε υπερβολική συσσώρευση λίπους στον οργανισμό. Παρατηρείται γενικά

Διαβάστε περισσότερα

ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΠΕΜΠΤΗ 11 ΙΟΥΝΙΟΥ 2015 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ

ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΠΕΜΠΤΗ 11 ΙΟΥΝΙΟΥ 2015 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 1 ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΠΕΜΠΤΗ 11 ΙΟΥΝΙΟΥ 2015 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ Α Α1. β Α2. γ Α3. α Α4. γ Α5. δ ΘΕΜΑ Β Β1.

Διαβάστε περισσότερα

ΠΡΟΤΕΙΝΟΜΕΝΕΣ ΑΠΑΝΤΗΣΕΙΣ ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ 2014

ΠΡΟΤΕΙΝΟΜΕΝΕΣ ΑΠΑΝΤΗΣΕΙΣ ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ 2014 ΦΡΟΝΤΙΣΤΗΡΙΑ ΜΕΣΗΣ ΕΚΠΑΙΔΕΥΣΗΣ : - ΠΡΟΤΕΙΝΟΜΕΝΕΣ ΑΠΑΝΤΗΣΕΙΣ ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ 2014 ΘΕΜΑ A Α1. δ Α2. γ Α3. β Α4. γ Α5. β ΘΕΜΑ B Β1. 4 2 1 6 3 5 Β2. α. DNA πολυμεράση β. Πριμόσωμα γ. DNA δεσμάση δ. DNA

Διαβάστε περισσότερα

ΙΚΤΕΡΟΣ. Γεώργιος Καλαμπόκης Λέκτορας Παθολογίας

ΙΚΤΕΡΟΣ. Γεώργιος Καλαμπόκης Λέκτορας Παθολογίας ΙΚΤΕΡΟΣ Γεώργιος Καλαμπόκης Λέκτορας Παθολογίας Προέλευση ιδιότητες χολερυθρίνης [1] Καθημερινά παράγονται 4 mg/kg (250-350 mg) χολερυθρίνης στο δικτυοενδοθηλιακό σύστημα (ήπαρ, σπλήνας) Αιμοσφαιρίνη γηρασμένων

Διαβάστε περισσότερα

Ποια η χρησιμότητα των πρωτεϊνών;

Ποια η χρησιμότητα των πρωτεϊνών; ΠΡΩΤΕΪΝΕΣ Τι είναι οι πρωτεϊνες; Η ονομασία πρωτεϊνες προέρχεται από το ρήμα πρωτεύω και σημαίνει την εξαιρετική σημασία που έχουν οι πρωτεϊνες για την υγεία του ανθρώπινου σώματος. Από την εποχή των Ολυμπιακών

Διαβάστε περισσότερα

Υπερλιπιδαιµίες Μεταβολισµός λιπιδίων. Μαρίνα Νούτσου Επιµελήτρια Α Παν. Παθολογικής Κλινικής Ιπποκράτειο Νοσοκοµείο Αθήνας

Υπερλιπιδαιµίες Μεταβολισµός λιπιδίων. Μαρίνα Νούτσου Επιµελήτρια Α Παν. Παθολογικής Κλινικής Ιπποκράτειο Νοσοκοµείο Αθήνας Υπερλιπιδαιµίες Μεταβολισµός λιπιδίων Μαρίνα Νούτσου Επιµελήτρια Α Παν. Παθολογικής Κλινικής Ιπποκράτειο Νοσοκοµείο Αθήνας Καρδιαγγειακά Επεισόδια : Πρώτη αιτία θανάτου στις αναπτυγµένες χώρες Πολλοί παράγοντες

Διαβάστε περισσότερα

ΑΡΧΗ 1ΗΣ ΣΕΛΙΔΑΣ Γ ΗΜΕΡΗΣΙΩΝ

ΑΡΧΗ 1ΗΣ ΣΕΛΙΔΑΣ Γ ΗΜΕΡΗΣΙΩΝ ΑΡΧΗ 1ΗΣ ΣΕΛΙΔΑΣ Γ ΗΜΕΡΗΣΙΩΝ ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΠΕΜΠΤΗ 11 ΙΟΥΝΙΟΥ 2015 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΣΥΝΟΛΟ ΣΕΛΙΔΩΝ: ΠΕΝΤΕ (5) ΘΕΜΑ

Διαβάστε περισσότερα

Πανελλήνιες Εξετάσεις Ημερήσιων Γενικών Λυκείων. Εξεταζόμενο Μάθημα: Βιολογία Θετικής Κατεύθυνσης, Ημ/νία: 04 Ιουνίου 2014. Απαντήσεις Θεμάτων

Πανελλήνιες Εξετάσεις Ημερήσιων Γενικών Λυκείων. Εξεταζόμενο Μάθημα: Βιολογία Θετικής Κατεύθυνσης, Ημ/νία: 04 Ιουνίου 2014. Απαντήσεις Θεμάτων Πανελλήνιες Εξετάσεις Ημερήσιων Γενικών Λυκείων Εξεταζόμενο Μάθημα: Βιολογία Θετικής Κατεύθυνσης, Ημ/νία: 04 Ιουνίου 2014 Απαντήσεις Θεμάτων ΘΕΜΑ Α A1. Τα πλασμίδια είναι: δ. κυκλικά δίκλωνα μόρια DNA

Διαβάστε περισσότερα

«Θεραπευτικός αλγόριθµος ADA/EASD 2012»

«Θεραπευτικός αλγόριθµος ADA/EASD 2012» «Θεραπευτικός αλγόριθµος ADA/EASD 2012» ΕΤΟΣ ΙΔΡΥΣΕΩΣ 1942 Ηλίας Ν. Μυγδάλης Συντονιστής Διευθυντής Β Παθολογική Κλινική και Διαβητολογικό Κέντρο, Γενικό Νοσοκοµείο ΝΙΜΤΣ, Αθήνα 9o Πανελλήνιο Συνέδριο

Διαβάστε περισσότερα

Athens 2010 Μαρία Α. Καρδάση

Athens 2010 Μαρία Α. Καρδάση Athens 2010 Γλυκοζυλίωση Τα τελευταία χρόνια όληηπροσπάθειατης αισθητικής αποκατάστασης του γηρασμένου δέρματος αφορούσε κυρίως την αποκατάσταση της εξωγενούς γήρανσης φωτογήρανσης. Τι γίνεται όμως με

Διαβάστε περισσότερα

ΜΕΣΟΘΕΡΑΠΕΙΑ ΕΝΕΣΙΜΗ ΤΟΠΙΚΗ ΘΕΡΑΠΕΙΑ

ΜΕΣΟΘΕΡΑΠΕΙΑ ΕΝΕΣΙΜΗ ΤΟΠΙΚΗ ΘΕΡΑΠΕΙΑ ΜΕΣΟΘΕΡΑΠΕΙΑ ΕΝΕΣΙΜΗ ΤΟΠΙΚΗ ΘΕΡΑΠΕΙΑ ΜΕΣΟΘΕΡΑΠΕΙΑ Αυτό σημαίνει ότι χρησιμοποιούμε μόνο ενέσιμα φάρμακα και μόνο στο σημείο που πάσχει. ΜΕΣΟΘΕΡΑΠΕΙΑ Ξεκίνησε στη λογική του γιατί να μη χορηγήσω ένα αντιφλεγμονώδες

Διαβάστε περισσότερα

ΦΡΟΝΤΙΣΤΗΡΙΟ «ΕΝΑ» ΓΙΟΜΠΛΙΑΚΗΣ ΛΑΖΑΡΟΣ ΠΕΤΡΟΜΕΛΙΔΗΣ ΒΑΣΙΛΗΣ

ΦΡΟΝΤΙΣΤΗΡΙΟ «ΕΝΑ» ΓΙΟΜΠΛΙΑΚΗΣ ΛΑΖΑΡΟΣ ΠΕΤΡΟΜΕΛΙΔΗΣ ΒΑΣΙΛΗΣ ΦΡΟΝΤΙΣΤΗΡΙΟ «ΕΝΑ» ΓΙΟΜΠΛΙΑΚΗΣ ΛΑΖΑΡΟΣ ΠΕΤΡΟΜΕΛΙΔΗΣ ΒΑΣΙΛΗΣ ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΘΕΜΑ 1 ο Α. Να βάλετε σε κύκλο το γράµµα που αντιστοιχεί στη σωστή απάντηση. 1. Ο µέγιστος αριθµός διαφορετικών

Διαβάστε περισσότερα

ÍÅÏ ÄÕÍÁÌÉÊÏ ÓÔÁÕÑÏÕÐÏËÇ

ÍÅÏ ÄÕÍÁÌÉÊÏ ÓÔÁÕÑÏÕÐÏËÇ 1 ΘΕΜΑ 1 o Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΕΚΦΩΝΗΣΕΙΣ ΒΙΟΛΟΓΙΑ Α. Για τις ερωτήσεις 1 5 να γράψετε στο τετράδιό σας τον αριθµό της ερώτησης και δίπλα του το γράµµα, που αντιστοιχεί στη σωστή απάντηση. 1.

Διαβάστε περισσότερα

Παράγοντες κινδύνου για τον καρκίνο του Παγκρέατος. Στέργιος Δελακίδης Γαστρεντερολόγος

Παράγοντες κινδύνου για τον καρκίνο του Παγκρέατος. Στέργιος Δελακίδης Γαστρεντερολόγος Παράγοντες κινδύνου για τον καρκίνο του Παγκρέατος Στέργιος Δελακίδης Γαστρεντερολόγος Καρκίνος Παγκρέατος: πρόγνωση Κακή πρόγνωση Συνολική πενταετής επιβίωση 6%.

Διαβάστε περισσότερα

Αθ. Ζώμας Αιματολόγος

Αθ. Ζώμας Αιματολόγος Αθ. Ζώμας Αιματολόγος Το πιο άφθονο χημικό στοιχείο (κατά μάζα) στη Γη και το τέταρτο πιο άφθονο στοιχείο στον στερεό φλοιό της, μετά το Ο2 το Si και το Al Χρησιμεύει στην - μεταφορά Ο2 - αποθήκευση Ο2

Διαβάστε περισσότερα

Νικολακοπούλου Κωνσταντίνα Κάτσα Ελένη-Μαρία Δάσκου Μαρία. β-θαλασσαιμία

Νικολακοπούλου Κωνσταντίνα Κάτσα Ελένη-Μαρία Δάσκου Μαρία. β-θαλασσαιμία Νικολακοπούλου Κωνσταντίνα Κάτσα Ελένη-Μαρία Δάσκου Μαρία β-θαλασσαιμία Θάλασσα + αίμα = θαλασσαιμία Εισαγωγή Η πιο κοινή γενετική νόσος που κληρονομείται Mενδελικά ~ 1 : 100.000 παγκοσμίως ~ 1 : 10.000

Διαβάστε περισσότερα

Μη αλκοολική λιπώδης νόσος του ήπατος. Κωνσταντίνος Τζιόμαλος Λέκτορας Παθολογίας ΑΠΘ

Μη αλκοολική λιπώδης νόσος του ήπατος. Κωνσταντίνος Τζιόμαλος Λέκτορας Παθολογίας ΑΠΘ Μη αλκοολική λιπώδης νόσος του ήπατος Κωνσταντίνος Τζιόμαλος Λέκτορας Παθολογίας ΑΠΘ SGOT 60 IU/l, SGPT 72 IU/l, γgt 92 IU/l, ALP κ.φ., CPK κ.φ., θυρεοειδική λειτουργία κ.φ. Παρουσίαση περιστατικού Άνδρας

Διαβάστε περισσότερα

συκώτι (ήπαρ) στομάχι χοληδόχος κύστη πάγκρεας δωδεκαδάκτυλο έντερο

συκώτι (ήπαρ) στομάχι χοληδόχος κύστη πάγκρεας δωδεκαδάκτυλο έντερο Αλκοόλ και ασθένειες του Συκωτιού (Πηγή: http://www.patient.co.uk/health/alcohol-and-liver-disease) Απόδοση στα ελληνικά: Αθανάσιος Μπάκας (υπεύθυνος του προγράμματος) Η κατανάλωση μεγάλων ποσοτήτων αλκοόλ

Διαβάστε περισσότερα

ΣΥΓΧΡΟΝΗ ΓΕΝΕΤΙΚΗ ΚΑΙ ΔΗΜΟΣΙΑ ΥΓΕΙΑ ΤΟΥ ΠΑΙΔΙΟΥ. Δρ.Δ.Λάγγας Αθήνα 2008

ΣΥΓΧΡΟΝΗ ΓΕΝΕΤΙΚΗ ΚΑΙ ΔΗΜΟΣΙΑ ΥΓΕΙΑ ΤΟΥ ΠΑΙΔΙΟΥ. Δρ.Δ.Λάγγας Αθήνα 2008 ΣΥΓΧΡΟΝΗ ΓΕΝΕΤΙΚΗ ΚΑΙ ΔΗΜΟΣΙΑ ΥΓΕΙΑ ΤΟΥ ΠΑΙΔΙΟΥ Δρ.Δ.Λάγγας Αθήνα 2008 Ορισμοί Γενετική: μελέτη της κληρονομικότητας και των παραλλαγών της Ιατρική γενετική: η γενετική του ανθρώπινου είδους Κλινική γενετική:

Διαβάστε περισσότερα

ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΚΑΙ ΕΠΑΛ (ΟΜΑΔΑ Β ) TETAPTH 4 IOYNIOY 2014 - ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ:

ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΚΑΙ ΕΠΑΛ (ΟΜΑΔΑ Β ) TETAPTH 4 IOYNIOY 2014 - ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Θέμα Α. Α.1. δ Α.2. γ Α.3. β Α.4. γ Α.5. β Θέμα Β. Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΚΑΙ ΕΠΑΛ (ΟΜΑΔΑ Β ) TETAPTH 4 IOYNIOY 2014 - ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: Β.1. 4 2 1-6 3-5 B.2. α.) DNA

Διαβάστε περισσότερα

ΥΠΟΥΡΓΕΙΟ ΠΑΙ ΕΙΑΣ ΚΑΙ ΠΟΛΙΤΙΣΜΟΥ ΙΕΥΘΥΝΣΗ ΑΝΩΤΕΡΗΣ ΚΑΙ ΑΝΩΤΑΤΗΣ ΕΚΠΑΙ ΕΥΣΗΣ ΥΠΗΡΕΣΙΑ ΕΞΕΤΑΣΕΩΝ ΠΑΓΚΥΠΡΙΕΣ ΕΞΕΤΑΣΕΙΣ 2006

ΥΠΟΥΡΓΕΙΟ ΠΑΙ ΕΙΑΣ ΚΑΙ ΠΟΛΙΤΙΣΜΟΥ ΙΕΥΘΥΝΣΗ ΑΝΩΤΕΡΗΣ ΚΑΙ ΑΝΩΤΑΤΗΣ ΕΚΠΑΙ ΕΥΣΗΣ ΥΠΗΡΕΣΙΑ ΕΞΕΤΑΣΕΩΝ ΠΑΓΚΥΠΡΙΕΣ ΕΞΕΤΑΣΕΙΣ 2006 ΥΠΟΥΡΓΕΙΟ ΠΑΙ ΕΙΑΣ ΚΑΙ ΠΟΛΙΤΙΣΜΟΥ ΙΕΥΘΥΝΣΗ ΑΝΩΤΕΡΗΣ ΚΑΙ ΑΝΩΤΑΤΗΣ ΕΚΠΑΙ ΕΥΣΗΣ ΥΠΗΡΕΣΙΑ ΕΞΕΤΑΣΕΩΝ ΠΑΓΚΥΠΡΙΕΣ ΕΞΕΤΑΣΕΙΣ 2006 Μάθηµα: ΒΙΟΛΟΓΙΑ Ηµεροµηνία και ώρα εξέτασης: ευτέρα, 5 Ιουνίου 2006 7.30 π.µ.

Διαβάστε περισσότερα

Μεταβολικό Σύνδρομο και Άσκηση στην παιδική ηλικία: Ο Ρόλος των Αδικοπινών. Θανάσης Τζιαμούρτας ΤΕΦΑΑ Παν. Θεσσαλίας

Μεταβολικό Σύνδρομο και Άσκηση στην παιδική ηλικία: Ο Ρόλος των Αδικοπινών. Θανάσης Τζιαμούρτας ΤΕΦΑΑ Παν. Θεσσαλίας Μεταβολικό Σύνδρομο και Άσκηση στην παιδική ηλικία: Ο Ρόλος των Αδικοπινών Θανάσης Τζιαμούρτας ΤΕΦΑΑ Παν. Θεσσαλίας Μεταβολικό Σύνδρομο Δεν είναι ασθένεια αλλά ένα σύμπλεγμα από ιατρικές διαταραχές που

Διαβάστε περισσότερα

ΓΕΝΙΚΑ ΓΙΑ ΤΗ ΝΕΦΡΟΛΙΘΙΑΣΗ

ΓΕΝΙΚΑ ΓΙΑ ΤΗ ΝΕΦΡΟΛΙΘΙΑΣΗ 1 ΓΕΝΙΚΑ ΓΙΑ ΤΗ ΝΕΦΡΟΛΙΘΙΑΣΗ Κυριακή Σταματέλου Ειδικός Νεφρολόγος, MBA Τι είναι η νεφρολιθίαση; Η νεφρολιθίαση λέγεται κοινά «πέτρες στα νεφρά» και είναι γνωστή στην ανθρωπότητα από τα αρχαία χρόνια.

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΚΕΦ. 6 ο ΜΕΤΑΛΛΑΞΕΙΣ

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΚΕΦ. 6 ο ΜΕΤΑΛΛΑΞΕΙΣ ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΚΕΦ. 6 ο ΜΕΤΑΛΛΑΞΕΙΣ Μεταλλάξεις είναι οι αλλαγές στην αλληλουχία των νουκλεοτιδίων που συμβαίνουν στο γενετικό υλικό ενός οργανισμού τόσο σε γονιδιακό επίπεδο (γονιδιακές μεταλλάξεις)

Διαβάστε περισσότερα

Μαρία Μουκταρούδη Παθολογος Επιμελήτρια Β

Μαρία Μουκταρούδη Παθολογος Επιμελήτρια Β Μαρία Μουκταρούδη Παθολογος Επιμελήτρια Β Παράγοντες κινδύνου για καρδιαγγειακή νόσο Δίαιτα Κάπνισμα Οινόπνευμα Ελαττωμένη σωματική δραστηριότητα Υπέρταση Δυσλιπιδαιμία Παχυσαρκία Σακχαρώδης διαβήτης Υπερτροφία

Διαβάστε περισσότερα

Λίγα λόγια για τους καρκίνους, τη γενετική τους βάση και διερεύνηση

Λίγα λόγια για τους καρκίνους, τη γενετική τους βάση και διερεύνηση Λίγα λόγια για τους καρκίνους, τη γενετική τους βάση και διερεύνηση Ο καρκίνος είναι μια ιδιαίτερα ετερογενής νόσος, που προκύπτει από συσσώρευση μεταλλάξεων του DNA. Η αιτιολογία του καρκίνου είναι πολυπαραγοντική,

Διαβάστε περισσότερα

MANAGING AUTHORITY OF THE OPERATIONAL PROGRAMME EDUCATION AND INITIAL VOCATIONAL TRAINING ΛΙΠΗ. ΘΑΝΑΣΗΣ ΤΖΙΑΜΟΥΡΤΑΣ, Ph.D., C.S.C.

MANAGING AUTHORITY OF THE OPERATIONAL PROGRAMME EDUCATION AND INITIAL VOCATIONAL TRAINING ΛΙΠΗ. ΘΑΝΑΣΗΣ ΤΖΙΑΜΟΥΡΤΑΣ, Ph.D., C.S.C. MANAGING AUTHORITY OF THE OPERATIONAL PROGRAMME EDUCATION AND INITIAL VOCATIONAL TRAINING ΛΙΠΗ ΘΑΝΑΣΗΣ ΤΖΙΑΜΟΥΡΤΑΣ, Ph.D., C.S.C.S Τα λίπη αποτελούν μια συμπυκνωμένη πηγή ενέργειας Ενεργούν σαν διαλύτες

Διαβάστε περισσότερα

ΥΠΟΥΡΓΕΙΟ ΠΑΙΔΕΙΑΣ ΚΑΙ ΠΟΛΙΤΙΣΜΟΥ ΔΙΕΥΘΥΝΣΗ ΑΝΩΤΕΡΗΣ ΚΑΙ ΑΝΩΤΑΤΗΣ ΕΚΠΑΙΔΕΥΣΗΣ ΥΠΗΡΕΣΙΑ ΕΞΕΤΑΣΕΩΝ ΠΑΓΚΥΠΡΙΕΣ ΕΞΕΤΑΣΕΙΣ 2013

ΥΠΟΥΡΓΕΙΟ ΠΑΙΔΕΙΑΣ ΚΑΙ ΠΟΛΙΤΙΣΜΟΥ ΔΙΕΥΘΥΝΣΗ ΑΝΩΤΕΡΗΣ ΚΑΙ ΑΝΩΤΑΤΗΣ ΕΚΠΑΙΔΕΥΣΗΣ ΥΠΗΡΕΣΙΑ ΕΞΕΤΑΣΕΩΝ ΠΑΓΚΥΠΡΙΕΣ ΕΞΕΤΑΣΕΙΣ 2013 ΥΠΟΥΡΓΕΙΟ ΠΑΙΔΕΙΑΣ ΚΑΙ ΠΟΛΙΤΙΣΜΟΥ ΔΙΕΥΘΥΝΣΗ ΑΝΩΤΕΡΗΣ ΚΑΙ ΑΝΩΤΑΤΗΣ ΕΚΠΑΙΔΕΥΣΗΣ ΥΠΗΡΕΣΙΑ ΕΞΕΤΑΣΕΩΝ ΠΑΓΚΥΠΡΙΕΣ ΕΞΕΤΑΣΕΙΣ 2013 ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ Ημερομηνία και Ώρα εξέτασης: Δευτέρα, 20 Μαΐου 2013 07:30-10:30

Διαβάστε περισσότερα

ΑΠΕΙΚΟΝΙΣΗΣ ΤΩΝ ΟΓΚΩΝ

ΑΠΕΙΚΟΝΙΣΗΣ ΤΩΝ ΟΓΚΩΝ 2. ΜΕΤΑΒΟΛΙΚΟ ΜΟΝΤΕΛΟ ΑΠΕΙΚΟΝΙΣΗΣ ΤΩΝ ΟΓΚΩΝ Οι όγκοι χαρακτηρίζονται από πολλαπλές αλλαγές του μεταβολισμού. Η χαρακτηριστική μεταβολική λειτουργία μπορεί να μετρηθεί in vivo με τη βοήθεια ενός ραδιοσημασμένου

Διαβάστε περισσότερα

Άνδρας77 ετώνμεδύσπνοια, οιδήματακαιυποκαλιαιμία. Διαφορική Διάγνωση

Άνδρας77 ετώνμεδύσπνοια, οιδήματακαιυποκαλιαιμία. Διαφορική Διάγνωση Άνδρας77 ετώνμεδύσπνοια, οιδήματακαιυποκαλιαιμία Διαφορική Διάγνωση Γεροβασίλη Βίκυ Ειδικευόµενη Ε Παθολογικής Κλινικής ιευθ: Αθανάσιος Σκουτέλης ΣτοιχείαΑπόΚλινικήΕικόνα Πρόσφατη έναρξη Απορρύθμιση Αρτηριακής

Διαβάστε περισσότερα

Η οδός των φωσφορικών πεντοζών

Η οδός των φωσφορικών πεντοζών Η οδός των φωσφορικών πεντοζών Η οδός των φωσφορικών πεντοζών Ανασκόπηση μεταβολισμού υδατανθρακών ΗΠΑΡ Γλυκόζη ΤΡΟΦΗ Κυκλοφορία ΓΛΥΚΟΓΟΝΟ Γλυκόζη ΗΠΑΡ Κυτταρόπλασμα ΗΠΑΡ (Οξέωση) NADH CO 2 ΟΞΕΙΔ. ΦΩΣΦ.

Διαβάστε περισσότερα

Ελεύθερες ρίζες και αντιοξειδωτικά

Ελεύθερες ρίζες και αντιοξειδωτικά Ελεύθερες ρίζες και αντιοξειδωτικά Κατά τη διάρκεια των φυσιολογικών ανθρώπινων διεργασιών παραγωγή ενέργειας, αποτοξίνωση από τοξικές ουσίες και ανοσολογική απόκριση, παράγονται από τον οργανισµό ελεύθερες

Διαβάστε περισσότερα

Αύξηση & Ανάπτυξη. Υπερπλασία: αύξηση του αριθµού των κυττάρων & Υπερτροφία : αύξηση του µεγέθους των κυττάρων

Αύξηση & Ανάπτυξη. Υπερπλασία: αύξηση του αριθµού των κυττάρων & Υπερτροφία : αύξηση του µεγέθους των κυττάρων Αύξηση & Ανάπτυξη Αύξηση Κυτταρική διαίρεση και καθαρή πρωτεϊνική σύνθεση & Ανάπτυξη Αύξηση διαστάσεων (ανάστηµα) Αύξηση οστών (σπονδυλική στήλη και κάτω άκρα) Αύξηση σκελετικού µυ Αύξηση σπλάχνων Υπερπλασία:

Διαβάστε περισσότερα