Gyvųjų organizmų architektūra: baltymai

Save this PDF as:
 WORD  PNG  TXT  JPG

Μέγεθος: px
Εμφάνιση ξεκινά από τη σελίδα:

Download "Gyvųjų organizmų architektūra: baltymai"

Transcript

1 Gyvųjų organizmų architektūra: baltymai Dr. Zita Naučienė Baltymai yra gausiausia biologinių makromolekulių klasė randama visose ląstelėse. Baltymų įvairovė yra labai didelė, nei viena makromolekulių klasė negali lygintis su baltymais pagal atliekamų funkcijų gausumą. Baltymai (proteinai) didelės molekulinės masės organinės medžiagos, sudarytos iš aminorūgščių, sujungtų peptidiniu ryšiu. Baltymo pavadinimas yra kilęs iš vokiečių kalbos žodžio eiweiss, kuris reiškia kiaušinio baltymas. Kitas naudojamas baltymo vardas proteinas yra kilęs iš graikų kalbos žodžio protos, reiškiančio - pirminis, svarbiausias. Baltymai ląstelėse atlieka labai daug įvairių funkcijų. Pagrindinės yra šios: 1. katalizinė - tai yra viena svarbiausių baltymų funkcijų. Baltymai fermentai katalizuoja ląstelėje vykstančias chemines reakcijas, todėl jos vyksta labai dideliais greičiais ir švelniose sąlygose. 2. pernašos - baltymai organizme perneša įvairias medžiagas, nuo elektronų iki makromolekulių. Hemoglobinas transportuoja deguonį iš plaučių į audinius, žmogaus serumo albuminas perneša riebalų rūgštis kraujuje. Labai svarbi pernašos baltymų klasė yra membranose lokalizuoti baltymai - nešikliai ir kanalai. 3. struktūrinė - baltymai susijungę su lipidais sudaro biologines membranas. Pagrindinis jungiamojo audinio baltymas yra kolagenas, plaukai, nagai taip pat yra baltymai. 4. hormoninė- jie reguliuoja medžiagų apykaitą. Pvz. insulinas mažina cukraus koncentraciją kraujyje, somatotropinis hormonas reguliuoja augimą. 5. apsauginė - organizme sintetinami antikūnai apsaugo jį nuo bakterijų, pašalinių baltymų. Virusinė infekcija žmogaus organizme iššaukia baltymo interferono sintezę, kuris stabdo tolesnį virusų dauginimąsi. 6. energetinė - oksiduojantis baltymuose esančioms aminorūgštims, išsiskyrusi energija panaudojama organizmo energetiniams poreikiams tenkinti. 7. motorinė - raumenys yra sudaryti iš aktino ir miozino, jų pagalba cheminė energija yra paverčiama mechanine. Bakterijų baltymas flagelinas reikalingas jų judėjimui. 8. toksinai - choleros, botulizmo, difterijos, gangrenos toksinai yra baltymai. 1

2 9. infekcinė medžiaga baltymas prionas atsakingas už neurodegeneratyvinių ligų išsivystymą tiek žmogaus, tiek gyvulių organizmuose. 10. receptorinė - baltymai receptoriai, išsidėstę ant membranų paviršiaus, sąveikauja su hormonais, neuromediatoriais, šviesa ir kitomis medžiagomis ir perduoda signalą per membraną. 11. reguliatorinė - baltymai gali prisijungti prie nukleorūgščių, kitų baltymų ir keisti jų biologinį aktyvumą. 12. atsarginė maisto medžiaga - pieno kazeinas, kiaušinio baltymai yra medžiagos, kuriose sukauptos organizmo vystymuisi reikalingos energetinės ir statybinės medžiagos. 13. egzotiniai baltymai - antifrizinis baltymas pažemina šiaurėje plaukiojančių žuvų kraujo užšalimo temperatūrą, baltymas monelinas yra kelis tūkstančius kartų saldesnis už cukrų, jūrų kriauklės išskiria baltymus, kurie priklijuoja jas prie įvairių paviršių. Baltymų sudėtis Baltymai, kurie sudaryti tiktai iš aminorūgščių, vadinami paprastaisiais baltymais arba proteinais. Tačiau dažnai į baltymų sudėtį įeina įvairios organinės ar neorganinės medžiagos. Tokie baltymai vadinami sudėtiniais baltymais arba proteidais. Sudėtiniai baltymai gali sudaryti makromolekulines struktūras, dalyvauti įvairiose reakcijose. Sudėtinių baltymų pavyzdžiai pateikti 1 lentelėje. Baltymai labai skiriasi pagal molekulės dydį ir molekulinę masę. Citochrome c yra 104 aminorūgštys, kurios sudaro vieną polipeptidinę grandinę. Fermentas glutamino sintetazė sudaryta iš dvylikos atskirų baltyminių subvienetų ir jo molekulinė masė siekia Žinduolių raumenų baltymas titinas vienoje polipeptidinėje grandinėje turi beveik aminorūgščių. Baltymų struktūra Baltymų bendrus bruožus lemia cheminė struktūra - tai makromolekulės, sudarytos iš aminorūgščių, sujungtų peptidiniu -CO-NH- ryšiu. Nepriklausomai nuo organizmo rūšies ar ląstelės tipo, visi baltymai sudaryti iš tų pačių 20-ties aminorūgščių, kurios (panašiai kaip 25 abecėlės raidės gali sudaryti daugybę skirtingų žodžių, sakinių ar knygų) besijungdamos tarpusavyje skirtinga tvarka ir kiekiu sudaro begalinę įvairovę baltyminių molekulių. 2

3 Skiriami keturi baltymų struktūrinės sandaros lygiai, kurių kiekvienas turi savo ypatybes. Visi baltymai yra linijiniai aminorūgščių polimerai, kurių seka nereguliari, tačiau savita (specifinė). Aminorūgščių išsidėstymas polipeptidinėje grandinėje vadinamas baltymo pirmine seka arba pirmine struktūra (1 pav, a). Unikali kiekvieno baltymo pirminė seka koduojama genų DNR. Teoriškai iš 20 skirtingų monomerų galima sudaryti 20 n skirtingų polipeptidų, kur n yra aminorūgščių skaičius grandinėje. Daugelis polipeptidų sudaryti iš daugiau nei 100 aminorūgščių, o kai kurių molekulėse jų yra virš Akivaizdu, kad baltymų sudaromų pirminių sekų įvairovė yra astronominė. Tuo paaiškinama didžiulė baltymų ir jų atliekamų biologinių funkcijų įvairovė. Aukštesni baltymų struktūros lygmenys, kuriuos lemia pirminė seka, pavaizduoti 1 pav. Pav.1. Baltymų struktūros lygiai. Pirminė (a), antrinė (b), tretinė (c) ir ketvirtinė (d) baltymo struktūra Sekantis baltymo struktūros lygis - antrinė struktūra (Pav. 1, b), yra polipeptidinės grandinės išsidėstymas erdvėje. Tretinė struktūra yra antrinės struktūros elementų išsidėstymas erdvėje vienas kito atžvilgiu (Pav. 1, c). Tretinė struktūra (sąlygota antrinės ir pirminės) labai svarbi biologiniam baltymų aktyvumui pasireikšti. Kadangi šia struktūra užtikrina didelis skaičius silpnų sąveikų, ji labai jautri įvairiems aplinkos poveikiams. Susidarant tretinei struktūrai, kai kurių baltymų molekulėse tarp Cys gali susidaryti kovalentiniai 4 disulfidiniai tilteliai. Jie gali būti suardomi redukuojant, tuomet polipeptidinės grandinės fragmentų išsidėstymas vienas kito atžvilgiu keisis. Disulfidinių tiltelių padėtys priklauso nuo Cys užimamos padėties grandinėje. Ketvirtinė struktūra būdinga baltymams, sudarytiems iš daugiau nei vienos polipeptidinės grandinės (Pav. 1, d). Tokie baltymai vadinami oligomeriniais. 3

4 Antrinė baltymų struktūra Tam tikros polipeptidinio ryšio savybės lemia polipeptidinės grandinės išsidėstymą erdvėje (konformaciją). Žinomi dvi pagrindinės antrinės baltymų struktūros atmainos - α- spiralė ir β-klostės m. Amerikos mokslininkai Polingas ir Kori, įvertindami peptidinio ryšio savybes (cheminių ryšių ilgiai, valentinių kampų dydžiai,vandenilinių ryšių ilgiai) bei rentgeno struktūrinės analizės duomenis, pasiūlė antrinės baltymų struktūros modelį. Šie mokslininkai baltymų struktūrą pradėjo tirti, analizuodami rentgeno spindulių difrakciją paprastų peptidų (di- ir tripeptidų) kristaluose. Taip jie nustatė, kad peptidinė grupė baltyminiuose dariniuose yra dalinai konjunguota, ryšys C-N gali būti viengubas ir dvigubas, peptidinė grupė gali egzistuoti dviejose formose - neutralioje ir polinėje (Pav. 2,a). Jie pastebėjo, kad peptidinė grupė yra plokščia ir nelanksti. Kadangi peptidinėje grupėje ryšys tarp C ir N yra dalinai dvigubas, laisvas sukimasis apie ryšį tarp karbonilo grupės anglies imino grupės N atomų negalimas (šie ryšiai Pav. 2. pavaizduoti plokštumoje). Peptidinėje grupėje (žr. Pav. 2, c) ryšio C-N ilgis 1,32 Å (t.y. tarpinė reikšmė tarp C-N viengubo ryšio (1,49 Å) ir C=N dvigubo ryšio (1,27 Å). Tai rodo, kad ryšys C-N peptidinėje grupėje dalinai (40%) dvigubas. Dėl konjugavimo C=O ryšis tampa dalinai viengubas, ir todėl pailgėja: normaliai karbonilinė grupėje grupėje ryšio ilgis 1,21 Å, o peptidinėje grupėje - 1,24 Å. Pav. 2. Konjuguoti ryšiai tarp atomų, sudarančių peptidinę grupę (a); C α atomo ryšiai (b); peptidinė grandinė kaip plokštumų, kurias jungia lankstus fragmentas su išsikišusia šonine grupe, seka (c). Taigi, visa peptidinė grupė yra dalinai konjuguota, jos sudaryme dalyvauja π elektronai, todėl ją sudarantys atomai išsidėsto vienoje plokštumoje (tai vadinama koplanarumo 4

5 principu). Jų sudaromos plokštumos atžvilgiu imino grupės H atomas ir karbonilinės grupės O užima trans padėtį. Todėl peptidinė grandinė gali būti vaizduojama, kaip seka nelanksčių plokštumų, kurias skiria metileninė grupė su pakaitu R: CHR. Grandinėje sukimasis galimas tik apie C α atomo sudaromus ryšius, todėl kampai tarp šio atomo ryšių sutartinai žymimi φ (fi) N-C α ryšiui ir ψ (psai) C α C ryšiui (Pav. 2, b). Teoriškai jie gali įgauti bet kokią reikšmę nuo 180 o iki +180 o, tačiau realiai tai neįmanoma, nes greta esantys atomai gali užimti tik tam tikrą padėtį erdvėje, netrukdydami joje išsidėstyti kitiems atomams pvz., peptidinių grupių sudaromos plokštumos negali persidengti). Kiekviena peptidinė grupė sudaro du vandenilinius ryšius, kurių ilgis lygus 2,8 Å (Kiekvienos peptidinės grupės deguonis ir vandenilis gali sudaryti du vandenilinius ryšius su kitų grupių vandenilio ir deguonies atomais). Pav. 3. Dešinio sukimo α-spiralės susidaro, peptidinių grupių plokštumoms išsidėstant lygiagrečiai spiralės ašiai (a); reguliarūs vandeniliniai ryšiai tarp vijų sutvirtina spiralės struktūrą (b); α-spiralės vaizdas iš viršaus (c). Pagal šiuos principus L.Polingas (L.Pauling) ir R. Kori (R.Corey) pasiūlė taip vadinamąjį α-spiralės modelį (Pav. 3). Pagal jį, baltymo išsidėstymui palankiausia struktūra, kurioje polipeptidinė grandinė erdvėje susisuka į spiralę, sukimasis vyksta pagal laikrodžio rodyklę, iš kairės į dešinę. Vienas α-spiralės žingsnis, t.y. atstumas tarp vijų lygus 5,4 Å. Viename žingsnyje telpa 3,6 aminorūgštys - reiškia struktūra atsikartoja (identiškumo periodas) kas 5 žingsnius arba fragmentą iš 18 aminorūgščių. Cilindro, kuriame išsidėsto visi C atomai 5

6 diametras lygus 10,1 Å. Spiralę stabilizuoja vandeniliniai ryšiai, kuriuos kiekviena peptidinė grupė sudaro su kita, nuo jos grandinėje ketvirta iš eilės peptidine grupe. Iš viršaus α-spiralė atrodo lyg cilindro karkasas iš polipeptidinės grandinės, vidus tuščias, o į išorę nukreiptos aminorūgščių šoninės grupės. Polingas pasiūlė ir taip vadinamąją β klostytą struktūrą. Šiuo atveju polipeptidinė grandinė nėra susisukusi į spiralę, bet yra ištempta, o vandeniliniai ryšiai susidaro ne tarp grupių esančių toje pačioje polipeptidinėje grandinėje, tačiau tarp skirtingose polipeptidinėse grandinėse esančių peptidinės grupės karbonilo ir imino atomų. Tokios polipeptidinės grandinės gali išsidėstyti lygiagrečiai arba antilygiagrečiai (Pav.4). α- spiralė ir β- klostė yra plačiausiai paplitusios antrinės struktūros įvairių tipų baltymuose. Be jų, dar sutinkami β linkiai ar β kilpos. Jos būna tose polipeptidinės grandinės vietose, kur ji staigiai keičia savo kryptį, dažnai net į priešingą. Linkiai, esant β-konformacijai, yra polipeptidinės grandinės, kuri 180 o kampu keičia kryptį, galuose. Tokį linkį dažnai sudaro 4 aminorūgštys, Pirmosios aminorūgšties linkyje peptidinė grupė sudaro vandenilinį ryšį su ketvirtosios aminorūgšties peptidine grupe. Šiuose linkiuse labai dažnai sutinkamos glicino ir prolino aminorūgštys. (a) (b) Pav. 4. β-klostyta struktūra gali susidaryti tarp antilygiagrečiai (a) ir lygiagrečiai (b) išsidėsčiųsių polipeptidinių grandinių pirmu atveju šalia yra gretimų grandinių C ir N-galai, antru C-galas yra greta kitos grandinės C-galo. 6

7 Kai kurie svarbūs struktūriniu požiūriu fibriliniai baltymai sudaro spiralinę antrinę struktūrą, tačiau tai kitoks spiralės tipas, nei α- spiralė. Kolagenas yra fibrilinis baltymas, sudarantis per 25% visų baltymų žinduolių organizmuose. Tris susipynusios kolageno grandinės sudaro molekulę, vadinamą tropokolagenu, kurio molekulinė masė yra apie 285 kd. Tiriant kolageno aminorūgščių sudėtį, pasirodė, kad baltymo molekulėje yra apie 1000 aminorūgščių, ir jų tarpe labai daug glicino bei prolino. Kolageno molekulėje randamos dvi kituose baltymuose labai retai sutinkamos aminorūgštys 4-hidroksiprolinas Hyp (I) ir 5- hidroksilizinas(ii). Kolagene yra 35% Gly, 11% Ala, 21% Pro ir Hyp. HO OH NH 2 COOH N H 2 N-CH 2 -CH-CH 2 -CH 2 -C-COOH (I) (II) Vykstant kolageno sintezei, į polipeptidinę grandinę įjungiamos aminorūgštys prolinas ir lizinas. Prolino hidroksilinimą baltymo molekulėje katalizuoja fermentas prolilo hidroksilazė, į kurio aktyvų centrą įeina Fe 2+ jonas. Fermento aktyvumui reikalinga askorbo rūgštis, kuri palaiko aktyviame centre geležį redukuotame būvyje. Todėl sergant skorbutu, sutrinka kolageno sintezė, tuo pačiu jungiamojo audinio funkcijos. Elektroninės mikroskopijos ir rentgeno struktūrinės analizės duomenimis parodyta, kad tropokolageno molekulė yra pailgo stulpelio (kurio ilgis 3000 Å ir skersmuo 15 Å) formos. Ši molekulė yra vienas iš ilgiausių žinomų baltymų. Kiekviena iš trijų polipeptidinių grandinių sudaro spiralę kuri skiriasi nuo klasikinės α-spiralės. Polipeptidinės grandinės sukasi viena apie kitą (dešinio sukimo spiralė), taip susidaro trigubos superspiralės struktūra. Grandinės tarpusavyje sudaro vandenilinius ryšius ir išsidėsto viena kitos atžvilgiu taip, kad tarpuose atsiduria Gly (turintis mažiausią R), tai leidžia spiralėms susipakuoti glaudžiausiu būdu. Kolageno skaidulos stabilizuojamos ir kovalentinių ryšių, kurie susidaro tarp skirtingų tropologeno molekulių lizino ir hidroksilizino grupių. Taip sutvirtinta triguba superspiralė suteikia kolagenui ypatingą mechaninį tvirtumą. Tropokolageno molekulės tvarkingai išsidėstydamos sudaro kolageno skaidulas. Viena 1 mm skersmens kolageno skaidula gali išlaikyti 10 kg svorį. Keratinai yra baltymų, kuriems būdinga panaši sudėtis ir biologinė funkcija, grupė. Šią grupę sudaro α-keratinai irβ-keratinai. α-keratinai yra pagrindiniai plaukų, nagų bei gyvūnų odos baltymai. Jie įeina į citoskeleto elementų (tarpinių filamentų) sudėtį. Plaukų α-keratino molekulės yra ilgos (apie 300 aminorūgščių ilgio) α-spiralės, kurios po dvi susisuka į kairiojo sukimo superspiralę. Tkią 7

8 savybę šioms spiralėms suteikia tai, kad jų sudėtyje kas ketvirta (t.y., esanti kiekviename spiralės žingsnyje) aminorūgštis hidrofobinė, jų šoninės grupės sulimpa tarpusavyje ir tvirtai sulipina dvi grandines. Tokią struktūrą sutvirtina įvairus kiekis disulfidinių tiltelių (jų daug nagų keratine, mažiau plaukų keratine). Plaukų cheminis garbanavimas pagrįstas disulfidinių tiltelių suardymu (redukuojant) ir jų susidarymu kitose padėtyse (vėl oksiduojant). β-keratinai įeina į paukščių plunksnas ir roplių odą, jie sudaryti pagrinde iš β-klostytos struktūros. Tretinė baltymų struktūra (globuliniai baltymai) Ilga polipeptidinė grandinė, kuriai būdinga tam tikra antrinė struktūra, erdvėje susisuka į kompaktišką globulę. Šis baltymo molekulės antrinės struktūros elementų išsidėstymas erdvėje vadinamas tretine baltymo struktūra. Polipeptidinė grandinė erdvėje sudaro struktūrą, kurios vidinė energija yra minimali, aminorūgščių šoninės grupės tarpusavyje ar su vandeniu sudaro daugiausiai galimų ryšių. Baltymai, turintys tą pačią aminorūgščių seką, įgauna tą pačią erdvinę struktūrą, t.y., baltymo konformaciją nulemia aminorūgščių pirminė seka. Tretinė struktūra dažniausiai lemia baltymo funkcijas. Pavz., aktyviame fermento centre aminorūgščių šoniniai radikalai, esantys skirtingose polipeptidinės grandinės vietose, suartėja erdvėje ir kartu dalyvauja katalizėje. Tretinę struktūrą palaiko įvairūs cheminiai ryšiai tarp aminorūgščių šoninių radikalų. Dažniausiai tai silpni nekovalentiniai ryšiai, kurie lengvai suyra, pakitus temperatūrai, terpės ph, joninei jėgai. Šis antrinės ir tretinės struktūros suardymas vadinamas denatūracija. Tretinę struktūrą stabilizuoja ir kovalentiniai disulfidiniai ryšai, susidarantys tarp dviejų cisteino molekulių, esančių toje pačioje polipeptidinėje grandinėje. Tretinę struktūrą stabilizuoja šie nekovalentiniai ryšiai: 1) hidrofobinė sąveika tarp nepoliarinių aminorūgščių (Leu, Ile, Phe, Ala) šoninių radikalų, 2) elektrostatinė sąveika tarp aminorūgščių turinčių priešingą krūvį, pvz. tarp Lys ir Glu, Arg ir Asp, 3) vandeniliniai ryšiai tarp aminorūgščių šoninių radikalų, pvz. Ser ar Thr -OH ir Asp ar Glu CO, 4) vandeniliniai ryšiai tarp aminorūgščių šoninių grupių ir polipeptidinės grandinės peptidinės grupės CO ir NH, 5) vandeniliniai ryšiai tarp peptidinės grupės CO ir NH, susidarant β-klostytai struktūrai, 8

9 6) sąveika tarp aminorūgščių šoninių grupių ir kofaktorių. Tiriant daugelio baltymo globulėje esančių aminorūgščių išsidėstymą, buvo pastebėta, kad nepolinių aminorūgščių Met, Val, Leu, Ile, Phe šoninės grupės paprastai nukreiptos į baltymo molekulės vidų ir nekontaktuoja su vandeniu. Hidrofobinė sąveika tarp šių grupių didele dalimi lemia baltymo tretinės struktūros stabilumą. aminorūgščių Lys, Arg, His, Asp, Glu įkrautos grupės išsidėsto baltymo paviršiuje ir su vandeniu sudaro vandenilinius ryšius. Būdamos baltymo molekulės viduje, jos dažniausiai atlieka specifines chemines funkcijas - įeina į fermento aktyvų centrą, suriša metalo jonus, kofermentus. polinės aminorūgštys Tyr, Ser, Thr, Asn, Gln paprastai būna baltymo molekulės išorėje, tačiau gali būti sutinkamos ir molekulės viduje. Jos tarpusavyje sudaro vandenilinius ryšius. Tretinės struktūros sudėtyje sutinkami pagrindiniai antrinės struktūros elementai - α spiralė, β-klostytos struktūros, kilpos, linkiai, superantrinės struktūros elementai. Baltymų domenai Taigi, tretinę struktūra lemia kovalentiniai disulfidiniai ryšiai, vandeniliniai ryšiai, elektrostatinė sąveika tarp šoninių radikalų įkrautų funkcinių grupių, van der Vaalso sąveika, taip pat labai svarbi hidrofobinė sąveika. Skirtumas tarp antrinės ir tretinės struktūrų yra gana santykinis, skiriamos tarpinės formos, taip vadinamos viršantrinės struktūros: motyvai ir domenai. Motyvas - struktūra, sudaryta iš keleto antrinės struktūros elementų ir turinti būdingą erdvinį išsidėstymą. Domenai - sudaryti iš motyvų - kai kuriems baltymams būdingos tam tikros stabilios struktūros (kurios gali daug kartų pasikartoti molekulėje). Tai dažnai būna kompaktinė sritis (sudaryta iš amino rūgščių), kuri išsiskiria bendroje grandinėje, kaip atskiras elementas, turintis stabilią tretinę struktūrą. Tai diskretiški, nepriklausomai susisukantys baltymų tretinės struktūros funkciniai ir struktūriniai elementai. Baltymų judrumas Baltymo molekulėje yra organizuotos ir neorganizuotos struktūros. Labai svarbu pažymėti, kad šios organizuotos ir tvarkingos struktūros juda ir dažnai labai greitai. Vyksta momentinės osciliacijos apie vieną, labai stabilią konformaciją. Baltymai yra dinaminės struktūros. Judėti gali atskiri atomai, aminorūgščių šoniniai radikalai, net atskiri domenai. Atomų vibracijos vyksta labai greitai ( s) ir nedideliais atstumas (~0,05nm). 9

10 Atomų grupės ar domenai juda žymiai lėčiau ir didesniais atstumais. Dideli konformaciniai pakitimai vyksta reaguojant antigenui su antikūnu, fermentui su substratu, receptoriui su ligandu. Judėjimo greitis gali būti s ir grupės gali judėti per kelis nm. Ketvirtinė baltymų struktūra Gamtoje sutinkama daug oligomerinių baltymų sudarytų iš kelių polipeptidinių grandinių, vadinamų subvienetais, sujungtų nekovalentiniais ryšiais. Šių subvienetų erdvinis išsidėstymas vadinamas baltymo ketvirtine struktūra. Dauguma baltymų, kurių molekulinė masė >100kDa sudaryti iš vieno ar skirtingų tipų subvienetų. Ketvirtinę struktųrą palaiko vandeniliniai, elektrostatiniai, hidrofobiniai ryšiai. Subvienetus lengva atskirti vienus nuo kitų pakeitus tirpalo ph ar joninę jėgą. Fermentų sąveika ir metabolinis tuneliavimas Vienas iš baltymų tarpusavio sąveikos pavyzdžių yra fermentų tarpusavio sąveika. Medžiagų tiesioginis perdavimas ferment-fermentiniu kanalu nuo vieno aktyvaus centro į kitą vadinamas tuneliavimas. Jos neišeina į supančią erdvę ir nepasiskisto pusiausvyroje su analogiškom molekulėm bendrame erdvės skyriaus tūryje. Angliškų terminų gausa (channeling, coupling, processivity, direct transfer, vectorial transfer) tam pačiam reiškiniui aprašyti būdinga pradiniam tyrimo etapui, kuomet dar nesusiformavusi vieninga terminologija. Tuneliavimas ląstelei naudingas ląstelės t\ tirpiklio kiekį. Juk daugybė metaboliniuose keliuose vaizduojamų metabolitų turi būti ištirpę tame pačiame tirpiklyje, vandenyje, kurio kiekis yra ribotas. Tuneliavimas gali vykti keliais būdais: kovalentiškai jungiant tarpinius metabolitus aktyviuose fermentų centruose (1); nejungiant jų kovalentiškai (2). Atitinkamai, tuneliavimas gali būti įvairiaus laipsnio - kietas (angl. k. - tight) arba pilnas, kuomet tarpiniai metabolitai visai nepasirodo tunelio išorėje, būdingas mechanizmui (1) ir laidus (angsl. k. - leaky) arba nepilnas, kai metabolitai tam tikru laipsniu išeina iš tunelio, būdingas mech. (2). Kietas tuneliavimas naudingas, kai tarpiniai tam tikros fermentų sekos produktai nėra reikalingi (naudojami) kitose sekose. Pvz., tarpiniai baltymo sintezės produktai yra nebaigti beprasmiai baltymai. Jie jungiami kovalentiškai, nes svarbu, kad į ląstelę patektų tik galutinis produktas. Tačiau glikolizės tarpiniai produktai G6P ir DHAP reikalingi ir kituose keliuose, todėl labiau pagrįstas laidus tuneliavimas. Riebalų rūgščių β-oksidacijos tarpiniai produktai ilgos grandinės acil-koa stipriai inhibuoja daugelį mitochondrijų fermentų. Juos svarbu tuneliuoti kietai, kad nepasireikštų žalingas poveikis. 10

11 Viename ląstelės erdvės skyriuje esantys nuoseklios fermentų sekos nariai tarpusavyje sudaro kompleksus ar bent išsidėsto erdvėje neatsitiktine tvarka. Kai kuriose sekose nustatyti stabilūs multifermentiniai kompleksai: du labai panašūs α-ketorūgščių oksidacijos kompleksai (piruvato dehidrogenazė ir 2-oksiglutarato dehidrogenazė), riebalų rūgščių sintezės kompleksas. Baltymų ar fermentų kompleksai angliškai vadinami įvairiai - protein machines, clusters, supramolecular complexes, aggregates, metabolons. Multifunkciniai baltymai yra ribinis fermentų aktyvumo suliejimo atvejis, kuomet vienoje polipeptidinėje grandineje yra keli domenai, pasižymintis skirtingų fermentų aktyvumu. Toks pavyzdys yra Neurospora Crassa kompleksas AROM (shikimo rūgšties kelias), kurio vienoje polipeptidineje grandineje yra penki fermentiniai aktyvumai. Kituose mikroorganizmuose, pvz., E.coli Lys, Met, Thr ir Ile sintezės iš L-Asp kelias reakcijas atlieka vienas polipeptidas - tetrameras α 4, kurio kiekvieno subvieneto N-gale yra domenas su asparto kinazės aktyvumu, o C-gale - homoserino dehidrogenazės domenas. Aukštesniųjų organizmų ląstelėse tris pirmąsias pirimidinų biosintezės stadijas katalizuoja fermentų kompleksas karbamoilfosfato sintazė, aspartat-karbamoilo transferazė ir dihidroorotazė, kurie greičiausiai yra vienoje polipeptidinėje grandinėje. Be tokių lengvai nustatomų tvirtų sąveikų, galima savita sąveika tarp fermentų, kurie tradiciškai laikomi tirpiais. Pvz., žiuželinių pirmuonių Tripanosoma brucei, tripanosoma cruzi ir Critidia fasciculata citoplazmoje glikolizės fermentai sukaupti specifinėje peroksisomoje, vadinamoje glikosoma. Šie kraujuje parazituojantys organizmai visą energiją gauna glikolizės būdu, ir glikosoma užtikrina pakankamai didelį jos greitį. Fermentų tarpusavio sąveika glikosomoje tokia stipri, kad kompleksas išlieka, net pašalinus membraną. Kitais atvejais tirpūs fermentai nėra jungiami membraninių struktūrų, tačiau tarp jų egzistuoja įvairaus stiprumo dinaminė sąveika Apibendrinant, galima abejoti, ar apskritai ląstelėje įmanoma laisva fermento būsena. Sąveika su polimerinėmis molekulėmis gali keisti fermentų kinetines savybes - pvz., susirišimas su DNR aktyvina nukleorūgščių metabolizmo fermentus. Kai kurie fermentai yra dinaminėje pusiausvyroje tarp surištos ir laisvos būsenų, toks reiškinys vadinamas jų būsenos dviprasmiškumu (angl. k. - ambiquity). Pusiausvyra tarp tokių formų reguliuojama. Savo ruožtu, tokia dinaminė asociacija arba dinaminis tuneliavimas svarbus reguliaciniu požiūriu. Pvz., heksokinazės susirišimas su mitochondrijų membrana keičia jos kinetines savybes (didina Km), o padidėjus gliukozės koncentracijai citozolyje heksokinazės sąveika su mitochondrijomis suyra. 11

12 Tuneliavimo privalumai Viduląstelinės difuzijos greičiai nėra pakankami gyvybinių procesų užtikrinimui, todėl tuneliavimas yra labai svarbus. Kokie yra multifermentinių kompleksų egzistavimo, arba tuneliavimo teikiami privalumai? 1) Suartinimo efektas. Tuneliavimo dėka bendras sistemos veikimo greitis žymiai padidėja, nes: a) substratai tiesiogiai perduodami nuo vieno fermento aktyvaus centro į kitą. b) substrato koncentracija antrojo aktyvaus centro aplinkoje yra žymiai didesnė, nei tuo atveju, jei jie pasiskirstytų po visą citozolio tūrį (bulk phase), taigi, aukšta substrato koncentracija pasiekiama nedidelio kiekio substrato molekulių sąskaita (5 pav.). (a) (b) 5 pav. Tarpiniam metabolitui išeinant į aplinką, jis tolygiai pasiskirsto, joje ištirpdamas (a) todėl aplinkoje susidaro mažesnė substrato sekančiam fermentui koncentracija, nei tuo atveju (b), kai metabolites aplinkoje nepasirodo ir visas jo kiekis yra tarpfermentiniame tunelyje. c) sumažėja tarpinių metabolitų difuzijos laikas. Kai praskiestame tirpale matuojamas sistemos iš kelių atskirai veikiančių fermentų bendras greitis paprastai būtinas tam tikras laikas stacionariai būsenai pasiekti. Šis laikas mažėja ir net visai išnyksta, jeigu, didinant fermentų koncentracija tirpale, fermentai sudaro kompleksus. Tada tarpiniai metabolitai perduodami tiesiogiai iš vieno aktyvaus centro į kitą. d) taupomas ląstelės tirpiklis (H 2 O); e) tarpiniai metabolitai apsaugomi nuo terpės poveikio ar joje esančių degraduojančių fermentų (fosfatazių, hidrolazių) poveikio; f) ląstelė apsaugoma nuo žalingo kai kurių metabolitų poveikio (aldehidų, ilgos grandinės acil-koa). Dėl heksokinazės sąveikos su mitochondrijomis sintezuotas ATP greičiau patenka heksokinazei, nei pridėtas iš išorės, o ADP greičiau grąžinamas mitochondrijoms. Mažėja 12

13 galimybė, kad oksidacinis fosforilinimas bus inhibuotas ATP. ATP panaudojamas nesusimaišęs su citozoline ATP sankaupa. 2. Papildomos reguliacinės galimybės, kurias suteikia sąveika tarp nuoseklios fermentų sekos narių. Tai gali būti alosterinio pobūdžio reguliacija, kai efektoriaus susirišimas su vienu iš sekos fermentų veikia kitus fermentus (koordinuota reguliacija). Fermentų sąveikos metu gali būti palankiai keičiama kitų fermentų konformacija ir kinetines savybes. Įdomus fermentų tarpusavio sąveikos pavyzdys yra laisvai triptofano sintazei būdingas triptofano hidrolazinis aktyvumas, kuris inhibuojamas, jai susirišus su kitais fermentais. Kadangi baltymų koncentracija ląstelėje ir jos erdvės skyriuose tokia didelė, sąveikaudami tarpusavyje, jie suteikia ląstelei supramolekulinės struktūros bruožų, matomų elektroniniu mikroskopu.. Šiuos ląstelės struktūros bruožus lemia baltymų sąveika. Galima sakyti, kad fermentų ir kitų baltymų tarpusavio sąveika lemia aukštesnį ląstelės struktūrinės organizacijos lygį. Matematinis baltymų struktūros modeliavimas Kritinė baltymų savybė yra gebėjimas įgauti teisingą erdvinę struktūrą, kuri nulemia baltymo funkcijas. Dauguma ligų, kaip pavyzdžiui Alzheimer io liga, yra susijusių su neteisingą erdvinę struktūrą turinčiais baltymais [1]. Baltymo struktūros identifikavimas yra svarbus žingsnis bandant paaiškinti jo biologinę funkciją ir įtaką sveikatai. Struktūros nustatymas yra sunki užduotis, reikalaujanti daug laiko ir lėšų. Todėl mokslininkai ėmėsi nuspėti baltymo struktūrą remiantis jo seka, pasitelkdami kompiuterių pagalbą. Tradiciškai baltymų erdvinė struktūra nustatoma naudojantis Rentgeno-struktūrine analize arba branduolio magnetinio rezonanso metodu (BMR). Pirmasis metodas paprastai nesuteikia informacijos apie vandenilio atomų padėtį, juo naudojantis negalima patikimai atskirti azotą nuo deguonies ar nuo anglies. Tai reiškia, kad naudojantis Rentgeno struktūrine analize asparto rūgšties, glutamino ir treonino šoninių grandinių atomų cheminė sudėtis nustatoma nepatikimai ir yra nuspėjama pagal baltyminę aplinką, supančią šias amino rūgštis. BMR metodo trūkumą sudaro tai, kad šiuo metodu galima tirti baltymus nedidesnius nei 30 kd. Nustatant baltymo struktūrą svarbus matas yra skiriamoji geba (angl. resolution), kuris nusako nustatytos struktūros detalumą, kokybę. Skiriamoji geba išreiškiama angstremais (Å), kuriais matuojamas atstumas. Kuo mažesnė jo reikšmė, tuo aukštesnė skiriamoji geba. Baltymo struktūra yra nustatoma pagrindinai skiriamosios gebos intervale tarp 1.7 Å ir 3.5 Å. Reikšmės žemesnės nei 2.0 Å nurodo aukštą skiriamąją gebą. 13

14 Pavyzdžiui, kai skiriamoji geba yra 5.0 Å, bendras baltymo susilankstymas yra aiškus, tačiau nesuteikta jokios informacijos apie tikslesnį amino rūgščių išsidėstymą. Esant 2.5 Å skiriamajai gebai nustatomas tikslesnis atomų išsidėstymas, įskaitant amino rūgščių šoninių grandinių išsidėstymą. 1.2 Å skiriamoji geba nurodo aukštos kokybės struktūros nustatymą, kuris suteikia informacijos ne tik apie tikslų amino rūgščių išsidėstymą, bet ir nusako kai kurių vandenilio atomų buvimo vietą. Baltymo pirminė amino rūgščių seka yra pagrindinis veiksnys, nulemiantis jo galutinę struktūrą. Šiuo metu dėka genų sekvenavimo kartu sparčiai gausėja informacijos apie baltymų, kuriuos koduoja tie genai, amino rūgščių sekas. Nors eksperimentinis tretinės baltymų struktūros nustatymas tampa vis efektyvesnis, žinomų sekų skaičius vis dar žymiai didesnis nei žinomų struktūrų. Matematinis baltymų struktūros modeliavimas turėtų šį skaičių sulyginti. Taikomi keturi būdai antrinės baltymų struktūros spėjimui: 1. Empiriniai statistiniai metodai, naudojantys žinomų erdvinių struktūrų parametrus. 2. Metodai, paremti fizikocheminėmis amino rūgščių savybėmis, tokiomis kaip dydis, grupių išsidėstymas, hidrofobiškumas, krūvis, vandenilinių ryšių sudarymo galimybė ir panašiai. 3. Metodai paremti spėjimo algoritmais, kurie naudoja žinomas homologiškų baltymų struktūras nustatant antrinę norimo baltymo struktūrą. 4. Molekulinės mechanikos metodai, naudojantys jėgų lauko parametrus modeliuojant ir nustatant antrinę struktūrą. Teigiama, kad baltymai, kurių amino rūgščių sekos atitinka bent 30 %, turės tą patį erdvinį susilankstymą ir greičiausiai atliks panašias funkcijas [2]. Todėl baltymų homologija yra svarbi savybė identifikuojant giminingus baltymus su vienodu erdviniu susilankstymu. Taigi, tiriamo baltymo seka gali būti palyginama su žinoma homologiško baltymo erdvine struktūra taikant vieną iš dviejų pagrindinių strategijų. Pirmu metodu, tiriamo baltymo seka yra palyginama su žinomos erdvinės struktūros baltymais modeliais. Kiekvienas iš šių palyginimų turi jam priskirtą reikšmių rinkinį. Reikšmių rinkiniai yra klasifikuojami ir išrenkama geriausia reikšmė. Pagal šią geriausią reikšmę tiriamai sekai ir priskiriama erdvinė struktūra. Antru metodu tiriamo baltymo seka sutapatinama su žinoma baltymo struktūra ir skaičiuojama tiriamo baltymo sekos energija. Šis metodas naudojamas kai nerandama esminių panašumų tarp tiriamo baltymo sekos ir žinomos struktūros baltymų sekos. Žinomas baltymų struktūras galima rasti internetinėse duomenų bazėse. Egzistuoja dviejų tipų duomenų bazės: pirminės (archyvinės) ir antrinės. Pirminėse duomenų bazėse galima rasti eksperimentinius rezultatus ir šiek tiek interpretacijos, pavyzdžiui DNR, RNR ar baltymų sekas. 14

15 Antrinėse duomenų bazėse surenkama išanalizuota informacija. Išskiriamos trys jungtinės duomenų bazių paieškos sistemos Entrez, EBI ir DBGet. Svarbus baltymų struktūros ir funkcijų suvokimui yra kompiuterinės grafikos taikymas biomolekulių vaizdavimui ir manipuliavimui. Kompiuterio pagalba gaunamas baltymų struktūros vaizdas atskleidžia santykinį daugumos ar net visų atomų makromolekulėje išsidėstymą. Sukurtas vaizdas taip pat atskleidžia baltymo fizikines, chemines ir elektrines savybes ir suteikia įsivaizdavimą apie jo funkcijas organizme. Egzistuoja trys molekulių grafinio vaizdavimo lygiai: 1D formulė arba struktūrinė formulė (1 paveikslas); 2D cheminė struktūra (2 paveikslas); 3D molekulinė struktūra (3 paveikslas). Tipiškai duomenys makromolekulių erdvinės struktūros failų įrašuose yra atomų koordinatės (x, y, z), taip pat duomenys apie ryšių ilgius bei ryšių tipus kiekvienai įmanomai sujungtų atomų porai. Šiuo aprašo būdu paremtas Baltymų duomenų banko (PDB Protein Data Bank) failo formatas, aprašantis biomolekulių erdvines struktūras. Baltymų duomenų banke (PDB) ( galima rasti įvairiausių laisvai prieinamų baltymų, nukleorūgščių ir kitų biologinių makromolekulių struktūrų. Kitas būdas, paremtas standartiniu amino rūgščių likučių žodynu, apimančiu visus biomakromolekulių atomus ir ryšius, taikomas tokių duomenų bazių įrašuose kaip Molekulinio modeliavimo duomenų bazė (MMDB Molecular Modeling Database). Jau dabar yra nemažai sukurtų kompiuterinių programų, leidžiančių turimus duomenis analizuoti ir taikyti juos tolimesniem tyrimams. Tokių programų panaudojimas turi nemažai privalumų, svarbiausios iš jų yra laiko ir pinigų taupymas. Dalis šių programų ne tik palengvina tyrimus, tačiau gali būti panaudotos mokymo tikslais. Pavyzdžiui, naudojantis įvairiomis programomis galima vaizdžiai pademonstruoti baltymų struktūrą, sukonstruoti baltymą, sumodeliuoti sąveika tarp baltymo ir ligando. Tokiu būdu, matematinis baltymų struktūros modeliavimas padėtų geriau įsivaizduoti ir suvokti baltymų savybes, jų funkcijas, veikimo mechanizmus. Baltymų raiška Baltymų raiška, dar vadinama genų raiška, tai procesas, kurio metu genuose esanti informacija paverčiama į baltymų struktūras ir funkcijas. Baltymų raiška yra daugiapakopis procesas, kuris prasideda tanskripcija, transliacija, toliau seka pagaminto baltymo erdvinės struktūros įgavimas, po-transliacinė modifikacija ir nukreipimas į paskirties vietą. Baltymo kiekis, kurį gamina ląstelė priklauso nuo audinio tipo, organizmo išsivystymo stadijos ir ląstelės metabolinės bei fiziologinės būsenos. 15

16 Netiesiogiai tam tikro baltymo raiška gali būti įvertinama taikant DNR mikrokomplekto technologiją, kuri leidžia grubiai nustatyti skirtingų mrnr koncentraciją ląstelėje. DNR mikrokomplektas mikroskopinių DNR taškelių, prisitvirtinusių prie kieto paviršiaus, rinkinys. Tačiau daugumos baltymų ekspresija yra reguliuojama po transkripcijos, todėl mrnr koncentracijos padidėjimas ne visuomet reiškia padidėjusią baltymų raišką. Polimerazinė grandininė reakcija (PGR) yra tikslesnis metodas baltymų raiškos nustatymui. Polimerazinė grandininė reakcija (PGR) tai greitas specifinio DNR segmento padauginimas (amplifikavimas) in vitro. Šis metodas leidžia iš turimos DNR paprastos fermentinės reakcijos metu susintetinti didelius kiekius DNR fragmentų. Po PGR seka padaugintų DNR fragmentų analizė gelyje, kuriame lyginami tiriami DNR fragmentai su žinomo dydžio fragmentais. Baltymų raiška gali būti kontroliuojama įvairiuose lygiuose: 1. Chromosomų aktyvaciją ar deaktyvacija. 2. Transkripcijos iniciacijos kontrolė. 3. RNR transporto kontrolė. 4. MRNR degradacijos kontrolė. 5. Transliacijos iniciacijos kontrolė. 6. Po-transliacinė modifikacija. Baltymų paskirties vieta ir funkcijos dažnai būna užkoduotos amino rūgščių sekoje. Baltymo paskirties vietą taip pat apsprendžia ir po-transliacinės modifikacijos, o tiksliam funkcijos atlikimui reikalingas teisingos erdvinės struktūros įgavimas. Biomakromolekulių struktūros-funkcijos sąryšio supratimui svarbūs makromolekulių ir jų ligandų ar substratų sąveikos tyrimai. Šie tyrimai suteikia nemažai informacijos apie makromolekulių atliekama funkciją. Dauguma fiziologinių procesų yra efektoriaus sąveikos su biomakromolekule pasekmė. Tiriant fermentų funkcijas, jų sąveikos su substratais mechanizmus, remiamasi fermentinės kinetikos teorija. Matuojant klasikinių fermentinių reakcijų greičius, galima rankiniu būdu apskaičiuoti reakcijos greitį žinant pradines fermento ir substrato koncentracijas, bei atitinkamų konstantų reikšmes. Tačiau skaičiuojant sudėtingesnių sistemų procesus reikalinga kompiuterio pagalba. DynaFit yra kompiuterinė programa skirta statistinei analizei ir pusiausvyrinių ligando surišimo duomenų modeliavimui. Programa atlieka ligando-receptoriaus surišimo ir fermentinės kinetikos duomenų analizę taikant netiesinę mažųjų kvadratų regresiją. Tokios programos kaip AutoDock, DOCK, Gold ir kitos yra naudojamos makromolekulių ir ligandų, fermentų ir substratų sąveikos modeliavimui. AutoDock programa skirta nuspėjimui kaip maža molekulė efektorius rišasi su žinomos struktūros receptoriumi. Modeliavimo metu yra randamas sąveikos tarp substrato ir makromolekulės energijos minimumas. 16

17 AutoDock programa naudoja Baltymų duomenų banko failo formatą, aprašantį makromolekulių struktūras. Ligando struktūras galima taip pat surasti įvairiose duomenų bazėse arba sumodeliuoti reikiamos molekulės-ligando struktūrą, pasinaudojant tam skirtomis programomis. Sąveikos skaičiavimų rezultatas yra įvairūs ligando išsidėstymo variantai, kurių kiekvienam yra priskirta atitinkama energetinė reikšmė. Žemiausia energija pasižymintis išsidėstymo variantas yra priimamas kaip labiausiai tikėtinas. Specialių molekulinių grafinių programų pagalba įmanomas sumodeliuotos sąveikos vizualizavimas, kas palengvina gautų modeliavimo rezultatų analizę. Naujausi proteomikos metodai Proteomika apima ne tik baltymų identifikaciją ir įvertinimą, bet ir jų lokalizacijos, modifikacijos, sąveikos, funkcijos nustatymą. Proteomika nagrinėja baltymus, kurie yra koduojami organizmo ar ląstelės genų. Pilnas rinkinys baltymų, kuriuos gali sintetinti organizmas, yra vadinamas proteomu. Proteomas yra žymiai didesnis už genomą, kadangi vienas genas gali būti atsakingas už kelių baltymų sintezę. Baltymų įvairovę nulemia po-transliacinės modifikacijos ir daugybė kitų faktorių. Vienas naujausių proteomikos technologijų taikymas yra susijęs su vaistų kūrimo ir tobulinimo procesais. Proteomika leidžia įvertinti naujų cheminių preparatų terapeutinį arba toksinį poveikį tikrinant baltymų atsaką žmogaus audinių kultūroje, naujai paimtuose žmogaus audinių mėginiuose ar fiziologiniuose skysčiuose. Tokiu būdu sudaroma galimybė sėkmingai atrinkti farmacinius preparatus ankstyvoje jų kūrimo etape, identifikuoti terapeutiškai naudingus junginius baltymų lygyje ir pašalinti toksinius. Baltymų tyrimo procesas apima baltymų išgavimą iš audinių ir jų saugų laikymą. Išskirtų baltymų identifikavimui taikomas jų atskyrimas naudojantis dvikrypte elektroforeze. Šis metodas leidžia atskirti baltymus pagal jų izoelektrinį tašką ir kartu pagal jų masę. Taip pat baltymų atskyrimui yra naudojamas HPLC metodas. Šio metodo trūkumas yra baltymo dydis, kuris gali būti tiriamas (< Da), ir labai hidrofobinių peptidų netirpumas. Toliau atskirtų peptidų frakcijos tiriamos mass-spektroskopijos metodu ir yra sudaromi taip vadinami peptidų žemėlapiai. Lyginant ligos atveju pažeistų peptidų žemėlapį su kontrolinio mėginio peptidų žemėlapiu galima sėkmingai nustatyti su liga susijusius baltymų markerius. Vienas naujausių baltymų atskyrimo metodų yra baltymų čipų (ProteinChip) panaudojimas. Tai metalinės plokštelės, ant kurių išdėstytos įvairaus giminingumo terpės. Baltymo amino rūgščių sekos nustatymas apima keletą žingsnių: 1. Atskiros polipeptidinės grandinės atskyrimas ir išgryninimas iš baltymo turinčio subvienetus. 2. Vidumolekulinių disulfidinių ryšių skėlimas. 17

18 3. Išgrynintos polipeptidinės grandinės amino rūgščių sudėties nustatymas. 4. N- ir C-galinių amino rūgščių analizė. 5. Specifinis polipeptidinės grandinės skėlimas į mažesnius fragmentus, šių fragmentų gryninimas. 6. Peptidinių fragmentų sekos analizė ir 6 žingsnių kartojimas naudojantis skirtingais skėlimo metodais. Sudaromas skirtingų ir persidengiančių peptidinių fragmentų rinkinys, analizuojama jų seka. 8. Visos baltymo amino rūgščių sekos atkūrimas iš sekų persidengiančiuose fragmentuose. 9. Disulfidinių ryšių vietos nustatymas. Praktinis darbas Lina Rimkutė Pažintis su bioinformatikos taikymu baltymų struktūrai ir sąveikoms tirti, vyks kompiuterių klasėje. 1. Pažintis su jungtinėmis duomenų bazių paieškos sistemomis. (Trukmė 20 min.) Entrez ( EBI (Europos Bioinformatikos Institutas) ( bei DBGet ( suteikia priėjimą prie DNR, baltymų sekų, genomo ir chromosomų kartografinių duomenų, erdvinių molekulinių struktūrų. Reikiamų duomenų paiešką galima vykdyti pagal autoriaus vardą, žurnalo pavadinimą, identifikacinį numerį (pvz., baltymo, geno ar cheminės medžiagos pavadinimas) ir kita, suvedant reikiamą raktinį žodį į paieškos laukelį. taip pat suteikia priėjimą prie įvairiausių duomenų. Užduotis: surasti baltymo (žmogaus albumino) seką iš kiekvienos duomenų bazių paieškos sistemos Entrez, EBI, DBGet ir palyginti jų įrašus. 2. Pažintis su baltymų amino rūgščių sekos palyginimo programa (Trukmė 10 min.) BLAST (The Basic Local Alignment Search) yra programa skirta baltymų homologijų, sekų panašumų nustatymui. BLAST veikimas paremtas tiriamosios sekos palyginimu su žinomomis sekomis įvairiose duomenų bazėse. Užduotis: atlikti sekų panašumo tyrimą baltymo, kurio seka: MSQDENIVKAVEESAEPAQVILGEDGKPLSKKALKKLQKEQEKQRKKEERALQLEAEREAREKKAA AEDT AKDNYGKLPLIQSRDSDRTGQKRVKFVDLDEAKDSDKEVLFRARVHNTRQQGATLAFLTLRQQASL IQGL 18

19 VKANKEGTISKNMVKWAGSLNLESIVLVRGIVKKVDEPIKSATVQNLEIHITKIYTISETPEALPI LLED ASRSEAEAEAAGLPVVNLDTRLDYRVIDLRTVTNQAIFRIQAGVCELFREYLATKKFTEVHTPKLL GAPS EGGSSVFEVTYFKGKAYLAQSPQFNKQQLIVADFERVYEIGPVFRAENSNTHRHMTEFTGLDMEMA FEEH YHEVLDTLSELFVFIFSELPKRFAHEIELVRKQYPVEEFKLPKDGKMVRLTYKEGIEMLRAAGKEI GDFE DLSTENEKFLGKLVRDKYDTDFYILDKFPLEIRPFYTMPDPANPKYSNSYDFFMRGEEILSGAQRI HDHA LLQERMKAHGLSPEDPGLKDYCDGFSYGCPPHAGGGIGLERVVMFYLDLKNIRRASLFPRDPKRLR PCGV PSFPPNLSARVVGGEDARPHSWPWQISLQYLKDDTWRHTCGGTLIASNFVLTAAHCISNTWTYRVA VGKN NLEVEDEEGSLFVGVDTIHVHKRWNALLLRNDIALIKLAEHVELSDTIQVACLPEKDSLLPKDYPC YVTG WGRLWTNGPIADKLQQGLQPVVDHATCSRIDWWGFRVKKTMVCAGGDGVISACNGDSGGPLNCQLE NGSW EVFGIVSFGSRRGCNTRKKPVVYTRVSAYIDWINEKMQL Interneto adreso laukelyje įvesti Skyrelyje Similarity searches surasti programą BLAST Network service on ExPASy ir paspausti ant užrašo BLAST. Atsidariusiame dokumente, į programos lauką nukopijuoti užduotyje pateiktą baltymo seką. Paspausti Run BLAST. Išnagrinėti gautus rezultatus. 3. Pažintis su cheminių struktūrų piešimo programa ISIS/Draw. (Trukmė 15 min.) Užduotis: nupiešti cheminę struktūrą (gliciną) naudojantis ISIS/Draw programa. Peržiūrėti nupieštą struktūrą trimatėj erdvėje naudojantis WebLabViewerPro4 grafine programa. 1. Atidaryti ISIS/Draw programą. Atsidariusiame lange kairėje ir viršuje yra mygtukų juostos. Kairėje esantys mygtukai skirti molekulių paišymui ir peržiūrėjimui. Viršuje esantys 19

20 mygtukai atidaro kai kurių molekulių pavyzdžius. Dažniausiai naudojami mygtukai: 2. Paspausti Single Bond mygtuką ir nupiešti keturių anglies atomų grandinę, sujungtų viengubu ryšiu. Paspauskit ant trečio anglies atomo, kad pridėti dar vieną anglies atomą. 3. Dabar kelis anglies atomus keisime į kitus atomus. Paspauskite Atom mygtuką. Dabar spustelkite ant galinio dešinio anglies atomo. Atsiras langelis, į kurį reikia įrašyti NH2 ir paspausti Enter. Pridėtą anglies atomą pakeiskit į deguonį O, galinį kairį anglies atomą į OH. 4. Pasirinkus mygtuką Single Bond paspausti ant viengubo ryšio, jungiančio anglies atomą su deguonimi: viengubas ryšys tampa dvigubu. 5. Išsaugoti nupieštą molekulę. 6. Atidaryti WebLabViewerPro4 programą. Per File Open susirasti ir atidaryti išsaugotą failą. 4. Pažintis su internetine baltymų duomenų baze ir molekuline grafine programa (Trukmė 15 min.) PDB paieškos laukelyje galima suvesti visą reikiamos molekulės pavadinimą arba indeksą, pvz., 1LYZ, kuris žymi vištos kiaušinio baltymą lizocimą. Pirmasis simbolis nurodo versijos numerį. Jeigu indeksas prasideda simboliu 0, tai reiškia, kad įrašas yra grynai bibliografinis. pdb failas yra tekstinis failas su paaiškinamąja antrašte ir atomų koordinačių rinkiniu. PDB formatas apima informaciją apie struktūros nustatymą, bibliografijos nuorodas, atomų koordinates. Dauguma molekulinių grafinių programinių įrangų ar kitos kompiuterinės analizės programos nuskaito PDB formato failus, turinčius išplėtimus.pdb arba.ent. Užduotis: surasti PDB 3D baltymo struktūrą ir naudojantis WebLabViewerPro4 grafine programa išmokti vizualizuoti ir manipuliuoti. 1. Interneto adreso laukelyje įvesti 2. Paieškos laukelyje įvesti indeksą 1LYZ. Atsidariusio dokumento lange paspausti Download/Display File. Lentelėje Download the Structure File pasirinkti PDB none formatą. Atsidariusiame dialogo lange spausti Save. 3. Atidaryti WebLabViewerPro4 programą. Per File Open susirasti ir atidaryti išsaugotą failą. 20

21 Paveikslai H 2 N C N H (CH 2 ) CH 2 2 CH NH NH 2 Pav. 1. Arginino struktūrinė formulė N N N O COOH N Pav. 2. Arginino 2D cheminė struktūra Pav. 3. Arginino 3D struktūros vaizdavimas Literatūros sąrašas C.S. Tsai An Introduction to Compiutational Biochemistry, 2002, A John Wiley & Sons, Inc A. Fiser, A. Sali Comparitive protein structure modeling, Pels Family Center for Biochemistry and Structural Biology The Rockefeller University 5. S.Vajda, I.A.Vakser, M.J.E. Sternberg, J. Janin Modeling of Protein Interactions in Genomes, 2002, PROTEINS: Structure, Function and Genetics 47: H. Garret C. M. Grisham. Biochemistry. Saunders College Publishing. NY Ovadi J, Srere PA.Macromolecular compartmentation and channeling. Int Rev Cytol. 2000;192. p V. Mildažienė, J. Kadziauskas, R. Jaugelavičius, V. Laurinavičius, Z. Naučienė, D. Bironaitė. Struktūrinė Biochemija. VDU

Riebalų rūgščių biosintezė

Riebalų rūgščių biosintezė Riebalų rūgščių biosintezė Riebalų rūgščių (RR) biosintezė Kepenys, pieno liaukos, riebalinis audinys pagrindiniai organai, kuriuose vyksta RR sintezė RR grandinė ilginama jungiant 2C atomus turinčius

Διαβάστε περισσότερα

X galioja nelygyb f ( x1) f ( x2)

X galioja nelygyb f ( x1) f ( x2) Monotonin s funkcijos Tegul turime funkciją f : A R, A R. Apibr žimas. Funkcija y = f ( x) vadinama monotoniškai did jančia (maž jančia) aib je X A, jei x1< x2 iš X galioja nelygyb f ( x1) f ( x2) ( f

Διαβάστε περισσότερα

Elektronų ir skylučių statistika puslaidininkiuose

Elektronų ir skylučių statistika puslaidininkiuose lktroų ir skylučių statistika puslaidiikiuos Laisvų laidumo lktroų gracija, t.y. lktroų prėjimas į laidumo juostą, gali vykti kaip iš dooriių lygmų, taip ir iš valtiės juostos. Gracijos procsas visuomt

Διαβάστε περισσότερα

Matematika 1 3 dalis

Matematika 1 3 dalis Matematika 1 3 dalis Vektorių algebros elementai. Vektorių veiksmai. Vektorių skaliarinės, vektorinės ir mišriosios sandaugos ir jų savybės. Vektoriai Vektoriumi vadinama kryptinė atkarpa. Jei taškas A

Διαβάστε περισσότερα

Oksidacija ir redukcija vyksta kartu ir vienu metu!!!

Oksidacija ir redukcija vyksta kartu ir vienu metu!!! Valentingumas Atomo krūviui molekulėje apibūdinti buvo pasirinkta sąvoka atomo oksidacijos laipsnis. Oksidacijos laipsnis Oksidacijos laipsnio vertė gali būti teigiama, neigiama arba lygi nuliui. Teigiama

Διαβάστε περισσότερα

Matematinės analizės konspektai

Matematinės analizės konspektai Matematinės analizės konspektai (be įrodymų) Marius Gedminas pagal V. Mackevičiaus paskaitas 998 m. rudens semestras (I kursas) Realieji skaičiai Apibrėžimas. Uždarųjų intervalų seka [a n, b n ], n =,

Διαβάστε περισσότερα

Cheminių ryšių sudaryme dalyvauja valentiniai elektronai. Atomo sandara. O ir N išorinio sluoksnio elektronų išsid stymas kvantų d žut se

Cheminių ryšių sudaryme dalyvauja valentiniai elektronai. Atomo sandara. O ir N išorinio sluoksnio elektronų išsid stymas kvantų d žut se Neutronas Elektronas nº e Atomo sandara Chemijos mokslas nagrin ja atomo sandarą tiek, kad būtų galima paaiškinti elementų chemines savybes, atomų ryšius molekul se ir naujų elementų susidarymą, vykdant

Διαβάστε περισσότερα

= γ. v = 2Fe(k) O(g) k[h. Cheminė kinetika ir pusiausvyra. Reakcijos greičio priklausomybė nuo temperatūros. t2 t

= γ. v = 2Fe(k) O(g) k[h. Cheminė kinetika ir pusiausvyra. Reakcijos greičio priklausomybė nuo temperatūros. t2 t Cheminė kineika ir pusiausyra Nagrinėja cheminių reakcijų greiį ir mechanizmą. Cheminių reakcijų meu kina reaguojančių iagų koncenracijos: c ų koncenracija, mol/l laikas, s c = Reakcijos greičio io ()

Διαβάστε περισσότερα

MATEMATINĖ LOGIKA. Įžanginių paskaitų medžiaga iš knygos

MATEMATINĖ LOGIKA. Įžanginių paskaitų medžiaga iš knygos MATEMATINĖ LOGIKA Įžanginių paskaitų medžiaga iš knygos Aleksandras Krylovas. Diskrečioji matematika: vadovėlis aukštųjų mokyklų studentams. Vilnius: Technika, 2009. 320 p. ISBN 978-9955-28-450-5 Teiginio

Διαβάστε περισσότερα

Projektas. Europos Socialinis Fondas

Projektas. Europos Socialinis Fondas EUROPOS SĄJUNGA Europos socialinis fondas KURKIME ATEITĮ DRAUGE! Projektas BPD2004-ESF-2.4.0-01-04/0157 Naujausių gamtos mokslo žinių sklaidos mokytojams tinklas http://gamta.vdu.lt Projektą finansuoja

Διαβάστε περισσότερα

Integriniai diodai. Tokio integrinio diodo tiesiogin įtampa mažai priklauso nuo per jį tekančios srov s. ELEKTRONIKOS ĮTAISAI 2009

Integriniai diodai. Tokio integrinio diodo tiesiogin įtampa mažai priklauso nuo per jį tekančios srov s. ELEKTRONIKOS ĮTAISAI 2009 1 Integriniai diodai Integrinių diodų pn sandūros sudaromos formuojant dvipolių integrinių grandynų tranzistorius. Dažniausiai integriniuose grandynuose kaip diodai naudojami tranzistoriniai dariniai.

Διαβάστε περισσότερα

VILNIAUS UNIVERSITETAS VALSTYBINIS MOKSLINIŲ TYRIMŲ INSTITUTAS FIZINIŲ IR TECHNOLOGIJOS MOKSLŲ CENTRAS TATJANA CHARKOVA

VILNIAUS UNIVERSITETAS VALSTYBINIS MOKSLINIŲ TYRIMŲ INSTITUTAS FIZINIŲ IR TECHNOLOGIJOS MOKSLŲ CENTRAS TATJANA CHARKOVA VILNIAUS UNIVERSITETAS VALSTYBINIS MOKSLINIŲ TYRIMŲ INSTITUTAS FIZINIŲ IR TECHNOLOGIJOS MOKSLŲ CENTRAS TATJANA CHARKOVA FUNKCIONALIZUOTŲ ALKILOLIGOETILENOKSIDŲ SINTEZĖ IR TYRIMAS Daktaro disertacija Fiziniai

Διαβάστε περισσότερα

I PRIEDAS m. gruodžio 8 d. 1

I PRIEDAS m. gruodžio 8 d. 1 I PRIEDAS VAISTŲ PAVADINIMŲ, VAISTŲ FORMŲ, STIPRUMO, NAUDOJIMO BŪDŲ, PASKIRTIES GYVŪNŲ RŪŠIŲ IR REGISTRUOTOJŲ ATITINKAMOSE VALSTYBĖSE NARĖSE, ISLANDIJOJE IR NORVEGIJOJE, SĄRAŠAS 2004 m. gruodžio 8 d. 1

Διαβάστε περισσότερα

EUROPOS CENTRINIS BANKAS

EUROPOS CENTRINIS BANKAS 2005 12 13 C 316/25 EUROPOS CENTRINIS BANKAS EUROPOS CENTRINIO BANKO NUOMONĖ 2005 m. gruodžio 1 d. dėl pasiūlymo dėl Tarybos reglamento, iš dalies keičiančio Reglamentą (EB) Nr. 974/98 dėl euro įvedimo

Διαβάστε περισσότερα

Molekulių energijos lygmenys Atomų Spektrai

Molekulių energijos lygmenys Atomų Spektrai Kas ta spektroskopija? Biomolekulių spektroskopija: Įvadas Spektroskopija tai mokslas, kuris tiria medžiagą, panaudodamas EM spinduliuotės sąveiką su ja. Pavyzdys matomos (VIS) srities spektroskopija tai

Διαβάστε περισσότερα

INFEKCIJŲ DIAGNOSTIKOS IR GYDYMO IŠŠŪKIAI SUSIJĘ SU DAUGINIU ATSPARUMU: ESBL GAMINANČIOS BAKTERIJOS

INFEKCIJŲ DIAGNOSTIKOS IR GYDYMO IŠŠŪKIAI SUSIJĘ SU DAUGINIU ATSPARUMU: ESBL GAMINANČIOS BAKTERIJOS INFEKCIJŲ DIAGNOSTIKOS IR GYDYMO IŠŠŪKIAI SUSIJĘ SU DAUGINIU ATSPARUMU: ESBL GAMINANČIOS BAKTERIJOS Dr. Jolanta Miciulevičienė Vilniaus miesto universitetinė ligoninė Higienos institutas ALYTUS, 2011 PLATAUS

Διαβάστε περισσότερα

Papildomo ugdymo mokykla Fizikos olimpas. Mechanika Dinamika 1. (Paskaitų konspektas) 2009 m. sausio d. Prof.

Papildomo ugdymo mokykla Fizikos olimpas. Mechanika Dinamika 1. (Paskaitų konspektas) 2009 m. sausio d. Prof. Papildoo ugdyo okykla izikos olipas Mechanika Dinaika (Paskaitų konspektas) 9. sausio -8 d. Prof. Edundas Kuokštis Vilnius Paskaita # Dinaika Jei kineatika nagrinėja tik kūnų judėjią, nesiaiškindaa tą

Διαβάστε περισσότερα

Skalbimo mašina Vartotojo vadovas Πλυντήριο Ρούχων Εγχειρίδιο Χρήστη Mosógép Használati útmutató Automatická pračka Používateľská príručka

Skalbimo mašina Vartotojo vadovas Πλυντήριο Ρούχων Εγχειρίδιο Χρήστη Mosógép Használati útmutató Automatická pračka Používateľská príručka WMB 71032 PTM Skalbimo mašina Vartotojo vadovas Πλυντήριο Ρούχων Εγχειρίδιο Χρήστη Mosógép Használati útmutató utomatická pračka Používateľská príručka Dokumentu Nr 2820522945_LT / 06-07-12.(16:34) 1 Svarbūs

Διαβάστε περισσότερα

Termochemija. Darbas ir šiluma.

Termochemija. Darbas ir šiluma. Termochemija. Darbas ir šiluma. Energija gyvojoje gamtoje. saulės šviesa CO 2 H 2 O O 2 gliukozė C 6 H 12 O 6 saulės šviesa Pavyzdys: Fotosintezė chloroplastas saulės 6CO 2 + 6H 2 O + šviesa C 6 H 12 O

Διαβάστε περισσότερα

BchI BIOCHEMIJOS INSTITUTAS

BchI BIOCHEMIJOS INSTITUTAS EUROPOS SĄJUNGA BchI BIOCHEMIJOS INSTITUTAS Kurkime ateitį drauge! Praktiniai mokymai "Peptidų skirstymas dviejų dimensijų chromatografine "offline" sistema: jonų mainų ir atvirkščių fazių chromatografija"

Διαβάστε περισσότερα

LIETUVOS JAUNŲ J Ų MATEMATIKŲ MOKYKLA

LIETUVOS JAUNŲ J Ų MATEMATIKŲ MOKYKLA LIETUVOS JAUNŲ J Ų MATEMATIKŲ MOKYKLA tema. APSKRITIMŲ GEOMETRIJA (00 0) Teorinę medžiagą parengė bei antrąją užduotį sudarė Vilniaus pedagoginio universiteto docentas Edmundas Mazėtis. Apskritimas tai

Διαβάστε περισσότερα

1648 J.B. van Helmont pademonstravo, kad augalai auga asimiliuodami kažkokią medžiagą iš oro

1648 J.B. van Helmont pademonstravo, kad augalai auga asimiliuodami kažkokią medžiagą iš oro 5 paskaita Fotosintez : šviesos reakcijos. Bendros sąvokos ir trumpa istorija. Fotosintez s aparato struktūra. Šviesą sugeriančios sistemos. Elektronų ir protonų transporto mechanizmai. http://www.johnkyrk.com/photosynthesis.html

Διαβάστε περισσότερα

Su pertrūkiais dirbančių elektrinių skverbtis ir integracijos į Lietuvos elektros energetikos sistemą problemos

Su pertrūkiais dirbančių elektrinių skverbtis ir integracijos į Lietuvos elektros energetikos sistemą problemos Su pertrūkiais dirbančių elektrinių skverbtis ir integracijos į Lietuvos elektros energetikos sistemą problemos Rimantas DEKSNYS, Robertas STANIULIS Elektros sistemų katedra Kauno technologijos universitetas

Διαβάστε περισσότερα

APLINKOS RADIACINIO FONO MATAVIMAS DOZIMETRAIS

APLINKOS RADIACINIO FONO MATAVIMAS DOZIMETRAIS VILNIAUS UNIVERSITETAS Kietojo kūno elektronikos katedra Taikomosios branduolio fizikos laboratorija Laboratorinis darbas Nr. 6 APLINKOS RADIACINIO FONO MATAVIMAS DOZIMETRAIS Parengė A. Poškus 2014-02-03

Διαβάστε περισσότερα

Baltymų ų skirstymas

Baltymų ų skirstymas Baltymų ų skirstymas Chromatografija Baltymų elektroforezinis skirstymas Kapiliarinė elektroforezė SDS/PAGE Izoelektrofokusavimas Dvimatė elektroforezė 2-DIGE sistema Kodėl analizuojamas proteomas? DNR

Διαβάστε περισσότερα

Maisto medžiagų virškinimo biocheminiai mechanizmai ir reguliacija

Maisto medžiagų virškinimo biocheminiai mechanizmai ir reguliacija Maisto medžiagų virškinimo biocheminiai mechanizmai ir reguliacija 1. Pagrindinės maisto medžiagų klasės 2. Maisto medžiagų skaidymas burnoje. 3. Maisto medžiagų virškinimas skrandyje. 4. Maisto medžiagų

Διαβάστε περισσότερα

1 iš 8 RIBOTO NAUDOJIMO M. CHEMIJOS VALSTYBINIO BRANDOS EGZAMINO UŽDUOTIES VERTINIMO INSTRUKCIJA Pagrindinė sesija. I dalis

1 iš 8 RIBOTO NAUDOJIMO M. CHEMIJOS VALSTYBINIO BRANDOS EGZAMINO UŽDUOTIES VERTINIMO INSTRUKCIJA Pagrindinė sesija. I dalis iš 8 RIBT NAUDJIM PATVIRTINTA Nacionalinio egzaminų centro direktoriaus 00 m. birželio 0 d. įsakymu 6.-S- 00 M. EMIJS VALSTYBINI BRANDS EGZAMIN UŽDUTIES VERTINIM INSTRUKIJA Pagrindinė sesija I dalis Kiekvienas

Διαβάστε περισσότερα

JONAS DUMČIUS TRUMPA ISTORINĖ GRAIKŲ KALBOS GRAMATIKA

JONAS DUMČIUS TRUMPA ISTORINĖ GRAIKŲ KALBOS GRAMATIKA JONAS DUMČIUS (1905 1986) TRUMPA ISTORINĖ GRAIKŲ KALBOS GRAMATIKA 1975 metais rotaprintu spausdintą vadovėlį surinko klasikinės filologijos III kurso studentai Lina Girdvainytė Aistė Šuliokaitė Kristina

Διαβάστε περισσότερα

ATSITIKTINIAI PROCESAI. Alfredas Račkauskas. (paskaitų konspektas 2014[1] )

ATSITIKTINIAI PROCESAI. Alfredas Račkauskas. (paskaitų konspektas 2014[1] ) ATSITIKTINIAI PROCESAI (paskaitų konspektas 2014[1] ) Alfredas Račkauskas Vilniaus universitetas Matematikos ir Informatikos fakultetas Ekonometrinės analizės katedra Vilnius, 2014 Iš dalies rėmė Projektas

Διαβάστε περισσότερα

Kurį bazinį insuliną pasirinkti

Kurį bazinį insuliną pasirinkti Kurį bazinį insuliną pasirinkti g y d y t o j u i p r a k t i k u i L. Zabulienė, Vilniaus universitetas, Vilniaus Karoliniškių poliklinika Cukrinis diabetas (CD) yra viena sparčiausiai plintančių ligų

Διαβάστε περισσότερα

IV. FUNKCIJOS RIBA. atvira. intervala. Apibrėžimas Sakysime, kad skaičius b yra funkcijos y = f(x) riba taške x 0, jei bet kokiam,

IV. FUNKCIJOS RIBA. atvira. intervala. Apibrėžimas Sakysime, kad skaičius b yra funkcijos y = f(x) riba taške x 0, jei bet kokiam, 41 Funkcijos riba IV FUNKCIJOS RIBA Taško x X aplinka vadiname bet koki atvira intervala, kuriam priklauso taškas x Taško x 0, 2t ilgio aplinka žymėsime tokiu būdu: V t (x 0 ) = ([x 0 t, x 0 + t) Sakykime,

Διαβάστε περισσότερα

1 Įvadas Neišspręstos problemos Dalumas Dalyba su liekana Dalumo požymiai... 3

1 Įvadas Neišspręstos problemos Dalumas Dalyba su liekana Dalumo požymiai... 3 Skaičių teorija paskaitų konspektas Paulius Šarka, Jonas Šiurys 1 Įvadas 1 1.1 Neišspręstos problemos.............................. 1 2 Dalumas 2 2.1 Dalyba su liekana.................................

Διαβάστε περισσότερα

Specialieji analizės skyriai

Specialieji analizės skyriai Specialieji analizės skyriai. Specialieji analizės skyriai Kompleksinio kinamojo funkcijų teorija Furje eilutės ir Furje integralai Operacinis skaičiavimas Lauko teorijos elementai. 2 Kompleksinio kintamojo

Διαβάστε περισσότερα

ANALIZINĖ GEOMETRIJA III skyrius (Medžiaga virtualiajam kursui)

ANALIZINĖ GEOMETRIJA III skyrius (Medžiaga virtualiajam kursui) ngelė aškienė NLIZINĖ GEMETRIJ III skrius (Medžiaga virtualiajam kursui) III skrius. TIESĖS IR PLKŠTUMS... 5. Tiesės lgts... 5.. Tiesės [M, a r ] vektorinė lgtis... 5.. Tiesės [M, a r ] parametrinės lgts...

Διαβάστε περισσότερα

MOKYKLINIO AMŽIAUS VAIKŲ SVEIKOS MITYBOS SKATINIMAS

MOKYKLINIO AMŽIAUS VAIKŲ SVEIKOS MITYBOS SKATINIMAS SVEIKATOS MOKYMO IR LIGŲ PREVENCIJOS CENTRAS MOKYKLINIO AMŽIAUS VAIKŲ SVEIKOS MITYBOS SKATINIMAS Metodinė-informacinė medžiaga, skirta visuomenės sveikatos priežiūros specialistams Vilnius, 2014 2 Parengė:

Διαβάστε περισσότερα

Palmira Pečiuliauskienė. Fizika. Vadovėlis XI XII klasei. Elektra ir magnetizmas KAUNAS

Palmira Pečiuliauskienė. Fizika. Vadovėlis XI XII klasei. Elektra ir magnetizmas KAUNAS Palmira Pečiuliauskienė Fizika Vadovėlis XI XII klasei lektra ir magnetizmas KAUNAS UDK 53(075.3) Pe3 Turinys Leidinio vadovas RGIMANTAS BALTRUŠAITIS Recenzavo mokytoja ekspertė ALVIDA LOZDINĖ, mokytojas

Διαβάστε περισσότερα

RAPSŲ VEISLIŲ, ĮRAŠYTŲ Į NACIONALINĮ AUGALŲ VEISLIŲ SĄRAŠĄ, APRAŠAI psl. ŽIEMINIAI RAPSAI Abakus... 3 Alaska... 4 Baldur... 4 Banjo (SW 0761)...

RAPSŲ VEISLIŲ, ĮRAŠYTŲ Į NACIONALINĮ AUGALŲ VEISLIŲ SĄRAŠĄ, APRAŠAI psl. ŽIEMINIAI RAPSAI Abakus... 3 Alaska... 4 Baldur... 4 Banjo (SW 0761)... RAPSŲ VEISLIŲ, ĮRAŠYTŲ Į NACIONALINĮ AUGALŲ VEISLIŲ SĄRAŠĄ, APRAŠAI psl. ŽIEMINIAI RAPSAI Abakus.... 3 Alaska.... 4 Baldur.... 4 Banjo (SW 0761).... 4 Belana... 5 Bellevue... 5 Californium.... 6 Caracas...

Διαβάστε περισσότερα

FUNKCIJOS. veiksmu šioje erdvėje apibrėžkime dar viena. a = {a 1,..., a n } ir b = {b 1,... b n } skaliarine sandauga

FUNKCIJOS. veiksmu šioje erdvėje apibrėžkime dar viena. a = {a 1,..., a n } ir b = {b 1,... b n } skaliarine sandauga VII DAUGELIO KINTAMU JU FUNKCIJOS 71 Bendrosios sa vokos Iki šiol mes nagrinėjome funkcijas, apibrėžtas realiu skaičiu aibėje Nagrinėsime funkcijas, kurios apibrėžtos vektorinėse erdvėse Tarkime, kad R

Διαβάστε περισσότερα

Vandens kokybės rekomendacijos variu lituotiems plokšteliniams šilumokaičiams

Vandens kokybės rekomendacijos variu lituotiems plokšteliniams šilumokaičiams Suvestinė Vandens kokybės rekomendacijos variu lituotiems plokšteliniams šilumokaičiams Danfoss centralizuoto šildymo padalinys parengė šias rekomendacijas, vadovaujantis p. Marie Louise Petersen, Danfoss

Διαβάστε περισσότερα

PREPARATO CHARAKTERISTIKŲ SANTRAUKA

PREPARATO CHARAKTERISTIKŲ SANTRAUKA PREPARATO CHARAKTERISTIKŲ SANTRAUKA 1. VAISTINIO PREPARATO PAVADINIMAS DIAPREL MR 60 mg modifikuoto atpalaidavimo tabletės 2. KOKYBINĖ IR KIEKYBINĖ SUDĖTIS Vienoje modifikuoto atpalaidavimo tabletėje yra

Διαβάστε περισσότερα

LeanShake. Pagrindinė nauda: ZINZINO

LeanShake. Pagrindinė nauda: ZINZINO ZINZINO LeanShake Zinzino LeanShake yra skanus ir maistingas valgio pakaitalas, norint numesti svorio 1. Vartokite jį, jei norite sudeginti riebalų ir padidinti raumenų masę 3. O kartu subalansuokite organizmo

Διαβάστε περισσότερα

LIETUVOS RESPUBLIKOS ÐVIETIMO IR MOKSLO MINISTERIJA NACIONALINIS EGZAMINØ CENTRAS 2014 METŲ MATEMATIKOS VALSTYBINIO BRANDOS EGZAMINO REZULTATŲ

LIETUVOS RESPUBLIKOS ÐVIETIMO IR MOKSLO MINISTERIJA NACIONALINIS EGZAMINØ CENTRAS 2014 METŲ MATEMATIKOS VALSTYBINIO BRANDOS EGZAMINO REZULTATŲ LIETUVOS RESPUBLIKOS ÐVIETIMO IR MOKSLO MINISTERIJA NACIONALINIS EGZAMINØ CENTRAS 014 METŲ MATEMATIKOS VALSTYBINIO BRANDOS EGZAMINO REZULTATŲ STATISTINĖ ANALIZĖ 014 m. birželio 5 d. matematikos valstybinį

Διαβάστε περισσότερα

RAPSŲ VEISLIŲ, ĮRAŠYTŲ Į NACIONALINĮ AUGALŲ VEISLIŲ SĄRAŠĄ, APRAŠAI

RAPSŲ VEISLIŲ, ĮRAŠYTŲ Į NACIONALINĮ AUGALŲ VEISLIŲ SĄRAŠĄ, APRAŠAI RAPSŲ VEISLIŲ, ĮRAŠYTŲ Į NACIONALINĮ AUGALŲ VEISLIŲ SĄRAŠĄ, APRAŠAI TURINYS psl. ŽIEMINIAI RAPSAI... 4 Abakus.... 4 Admiral.... 4 Avatar.... 5 Belana.... 5 Bellevue.... 6 Cult.... 6 Digger.... 6 DK Except....

Διαβάστε περισσότερα

Regina Jasiūnienė Virgina Valentinavičienė. Vadovėlis X klasei

Regina Jasiūnienė Virgina Valentinavičienė. Vadovėlis X klasei Regina Jasiūnienė Virgina Valentinavičienė Vadovėlis X klasei UDK 54(075.3) Ja61 Recenzavo mokytoja ekspertė JANĖ LIUTKIENĖ, mokytoja metodininkė REGINA KAUŠIENĖ Leidinio vadovas REGIMANTAS BALTRUŠAITIS

Διαβάστε περισσότερα

APRAŠOMOJI STATISTIKA

APRAŠOMOJI STATISTIKA STATISTIKA FILOLOGAMS 4 paskaita APRAŠOMOJI STATISTIKA Pagrindinės sąvokos Statistika keliareikšmė sąvoka. Skirtinos bent jau šios ryškios bei kartu skirtingos reikšmės: a) tokia duomenų apie valstybę,

Διαβάστε περισσότερα

VILNIAUS UNIVERSITETAS FIZINIŲ IR TECHNOLOGIJOS MOKSLŲ CENTRO CHEMIJOS INSTITUTAS. Andžejus Voitechovičius

VILNIAUS UNIVERSITETAS FIZINIŲ IR TECHNOLOGIJOS MOKSLŲ CENTRO CHEMIJOS INSTITUTAS. Andžejus Voitechovičius VILNIAUS UNIVERSITETAS FIZINIŲ IR TECHNOLOGIJOS MOKSLŲ CENTRO CHEMIJOS INSTITUTAS Andžejus Voitechovičius NELINIJINĖS STRUKTŪROS ARILPIRIMIDINŲ SINTEZĖ IR FOTOFIZIKINĖS SAVYBĖS Daktaro disertacija Fiziniai

Διαβάστε περισσότερα

Ląstelės biologija. Laboratorinis darbas. Mikroskopavimas

Ląstelės biologija. Laboratorinis darbas. Mikroskopavimas Ląstelės biologija Laboratorinis darbas Mikroskopavimas Visi gyvieji organizmai sudaryti iš ląstelių. Ląstelės yra organų, o kartu ir viso organizmo pagrindinis struktūrinis bei funkcinis vienetas. Dauguma

Διαβάστε περισσότερα

1 Tada teigini Ne visi šie vaikinai yra studentai galima išreikšti formule. 2 Ta pati teigini galima užrašyti ir taip. 3 Formulė U&B C reiškia, kad

1 Tada teigini Ne visi šie vaikinai yra studentai galima išreikšti formule. 2 Ta pati teigini galima užrašyti ir taip. 3 Formulė U&B C reiškia, kad 45 DISKREČIOJI MATEMATIKA. LOGIKA. PAVYZDŽIAI Raidėmis U, B ir C pažymėti teiginiai: U = Vitas yra studentas ; B = Skirmantas yra studentas ; C = Jonas yra studentas. 1 Tada teigini Ne visi šie vaikinai

Διαβάστε περισσότερα

4.18. AKUSTINIO DOPLERIO EFEKTO TYRIMAS

4.18. AKUSTINIO DOPLERIO EFEKTO TYRIMAS 4.18. AKUSTINIO DOPLERIO EFEKTO TYRIMAS Darbo tikslas Ištirti akustinį Doplerio efektą. Darbo užduotys Nustatyti garso greitį ore. Nustatyti nejudančio garso šaltinio skleidžiamų garso bangų dažnį. Nustatyti

Διαβάστε περισσότερα

STUDIJŲ DALYKO PROGRAMOS ATNAUJINIMAS

STUDIJŲ DALYKO PROGRAMOS ATNAUJINIMAS 1 2007-201 m. Žmogiškųjų išteklių pl tros veiksmų programos 2 prioriteto Mokymasis visą gyvenimą VP1-2.2-ŠMM-09-V priemon Studijų programų pl tra Nacionalin se kompleksin se programose Projekto SFMIS arba

Διαβάστε περισσότερα

6 laboratorinis darbas DIODAS IR KINTAMOSIOS ĮTAMPOS LYGINTUVAI

6 laboratorinis darbas DIODAS IR KINTAMOSIOS ĮTAMPOS LYGINTUVAI Kauno technologijos universitetas...gr. stud... Elektros energetikos sistemų katedra p =..., n =... 6 laboratorinis darbas DIODAS IR KINTAMOSIOS ĮTAMPOS LYGINTUVAI Darbo tikslas Susipažinti su diodo veikimo

Διαβάστε περισσότερα

Summary of Product. Lithuania

Summary of Product. Lithuania Summary of Product Characteristics Lithuania I PRIEDAS PREPARATO CHARAKTERISTIKŲ SANTRAUKA 1 1. VAISTINIO PREPARATO PAVADINIMAS Diacomit 250 mg kietos kapsulės 2. KOKYBINĖ IR KIEKYBINĖ SUDĖTIS Kiekvienoje

Διαβάστε περισσότερα

KLASIKIN E MECHANIKA

KLASIKIN E MECHANIKA KLASIKIN E MECHANIKA Algirdas MATULIS Puslaidininkiu zikos institutas Vadoveliu serijos papildymas auk²tuju mokyklu tiksliuju mokslu specialybiu studentams Email: amatulis@takas.lt Mob.: +370 654 543 06

Διαβάστε περισσότερα

Balniniai vožtuvai (PN 16) VRG 2 dviejų eigų vožtuvas, išorinis sriegis VRG 3 trijų eigų vožtuvas, išorinis sriegis

Balniniai vožtuvai (PN 16) VRG 2 dviejų eigų vožtuvas, išorinis sriegis VRG 3 trijų eigų vožtuvas, išorinis sriegis Techninis aprašymas Balniniai vožtuvai (PN 16) VRG 2 dviejų eigų vožtuvas, išorinis sriegis VRG 3 trijų eigų vožtuvas, išorinis sriegis Aprašymas Šie vožtuvai skirti naudoti su AMV(E) 335, AMV(E) 435 arba

Διαβάστε περισσότερα

2 TEMOS SKAITINIAI. Z.Lydeka. Rinkos ekonomikos tapsmas: teoriniai svarstymai. Kaunas: VDU leidykla, 2001, p.27-33; 45-60; ;

2 TEMOS SKAITINIAI. Z.Lydeka. Rinkos ekonomikos tapsmas: teoriniai svarstymai. Kaunas: VDU leidykla, 2001, p.27-33; 45-60; ; 2 TEMOS SKAITINIAI Z.Lydeka. Rinkos ekonomikos tapsmas: teoriniai svarstymai. Kaunas: VDU leidykla, 2001, p.27-33; 45-60; 112-117; 126-135. Mokslinėje literatūroje sutinkamus požiūrius į ekonominę sistemą,

Διαβάστε περισσότερα

Aviacinės elektronikos pagrindai

Aviacinės elektronikos pagrindai Antanas Savickas Aviacinės elektronikos pagrindai Projekto kodas VP1-2.2-ŠMM 07-K-01-023 Studijų programų atnaujinimas pagal ES reikalavimus, gerinant studijų kokybę ir taikant inovatyvius studijų metodus

Διαβάστε περισσότερα

ÂÓÈÎ ÁÈ ÙÔ K ÙÙ ÚÔ 1 Ô KÂÊ Ï ÈÔ 1.1 E Ë Î ÙÙ ÚˆÓ 1.1.1 ÚÔÎ Ú ˆÙÈÎ Î ÙÙ Ú

ÂÓÈÎ ÁÈ ÙÔ K ÙÙ ÚÔ 1 Ô KÂÊ Ï ÈÔ 1.1 E Ë Î ÙÙ ÚˆÓ 1.1.1 ÚÔÎ Ú ˆÙÈÎ Î ÙÙ Ú 11 1 Ô KÂÊ Ï ÈÔ ÂÓÈÎ ÁÈ ÙÔ K ÙÙ ÚÔ 1.1 E Ë Î ÙÙ ÚˆÓ Στο κεφάλαιο αυτό θα αναφερθούμε σύντομα στο κύτταρο, τα είδη (ευκαρυωτικά και προκαρυωτικά) και γενικά στα διάφορα στοιχεία του, όπως πυρήνα, κυτταρόπλασμα

Διαβάστε περισσότερα

PAPILDOMA INFORMACIJA

PAPILDOMA INFORMACIJA PAPILDOMA INFORMACIJA REKOMENDACIJOS, KAIP REIKIA ĮRENGTI, PERTVARKYTI DAUGIABUČIŲ PASTATŲ ANTENŲ ŪKIUS, KAD BŪTŲ UŽTIKRINTAS GEROS KOKYBĖS SKAITMENINĖS ANTŽEMINĖS TELEVIZIJOS SIGNALŲ PRIĖMIMAS I. BENDROSIOS

Διαβάστε περισσότερα

MIKROSCHEMŲ TECHNOLOGIJŲ ANALIZĖ

MIKROSCHEMŲ TECHNOLOGIJŲ ANALIZĖ Romualdas NAVICKAS Vaidotas BARZDĖNAS MIKROSCHEMŲ TECHNOLOGIJŲ ANALIZĖ Projekto kodas VP1-2.2-ŠMM-07-K-01-047 VGTU Elektronikos fakulteto I pakopos studijų programų esminis atnaujinimas Vilnius Technika

Διαβάστε περισσότερα

VALSTYBINĖ AKREDITAVIMO SVEIKATOS PRIEŽIŪROS VEIKLAI TARNYBA PRIE SVEIKATOS APSAUGOS MINISTERIJOS ĮSTAIGOS ASMENS SVEIKATOS PRIEŽIŪROS LICENCIJA

VALSTYBINĖ AKREDITAVIMO SVEIKATOS PRIEŽIŪROS VEIKLAI TARNYBA PRIE SVEIKATOS APSAUGOS MINISTERIJOS ĮSTAIGOS ASMENS SVEIKATOS PRIEŽIŪROS LICENCIJA VALSTYBINĖ AKREDITAVIMO SVEIKATOS PRIEŽIŪROS VEIKLAI TARNYBA PRIE SVEIKATOS APSAUGOS MINISTERIJOS ĮSTAIGOS ASMENS SVEIKATOS PRIEŽIŪROS LICENCIJA 2011-01-20 Nr. 3355 Vilnius Valstybinė akreditavimo sveikatos

Διαβάστε περισσότερα

1 teorinė eksperimento užduotis

1 teorinė eksperimento užduotis 1 teorinė eksperimento užduotis 2015 IPhO stovykla DIFERENCINIS TERMOMETRINIS METODAS Šiame darbe naudojame diferencinį termometrinį metodą šiems dviems tikslams pasiekti: 1. Surasti kristalinės kietosios

Διαβάστε περισσότερα

Išorinės duomenų saugyklos

Išorinės duomenų saugyklos Išorinės duomenų saugyklos HDD, SSD, sąsajos 5 paskaita Išorinė atmintis Ilgalaikiam informacijos (programų ir duomenų) saugojimui kompiuteriuose naudojami: standieji diskai; lankstieji diskeliai (FDD);

Διαβάστε περισσότερα

TRUMAN. Vartotojo vadovas

TRUMAN. Vartotojo vadovas TRUMAN Vartotojo vadovas Jūsų PRESIDENT TRUMAN ASC iš pirmo žvilgsnio DĖMESIO! Prieš pradedant naudotis stotele, pirmiausia būtina prie jos prijungti anteną (jungtis, esanti prietaiso galinėje dalyje)

Διαβάστε περισσότερα

AKREDITAVIMO SRITIS. Bandymo/tyrimo arba tikrinamų parametrų (charakteristikų) pavadinimas Vilnius, Žolyno g. 36, Antakalnio g. 10

AKREDITAVIMO SRITIS. Bandymo/tyrimo arba tikrinamų parametrų (charakteristikų) pavadinimas Vilnius, Žolyno g. 36, Antakalnio g. 10 1 (23) puslapis NACIONALINĖS VISUOMENĖS SVEIKATOS PRIEŽIŪROS LABORATORIJOS Žolyno g. 36, Antakalnio g. 10, Vilnius Aušros g. 44, Kaunas Bijūnų g. 6, Klaipėda Dubijos g. 40, Šiauliai AKREDITAVIMO SRITIS

Διαβάστε περισσότερα

2014 M. FIZIKOS VALSTYBINIO BRANDOS EGZAMINO UŽDUOTIES VERTINIMO INSTRUKCIJA Pagrindinė sesija

2014 M. FIZIKOS VALSTYBINIO BRANDOS EGZAMINO UŽDUOTIES VERTINIMO INSTRUKCIJA Pagrindinė sesija PATVIRTINTA Nacionalinio egzaminų centro direktoriaus 04 m. birželio 6 d. Nr. (.)-V-69birželio 4 04 M. FIZIKOS VALSTYBINIO BRANDOS EGZAMINO UŽDUOTIES VERTINIMO INSTRUKCIJA I dalis Kiekvieno I dalies klausimo

Διαβάστε περισσότερα

Elektrotechnikos pagrindai

Elektrotechnikos pagrindai Valentinas Zaveckas Elektrotechnikos pagrindai Projekto kodas VP1-2.2-ŠMM 07-K-01-023 Vilnius Technika 2012 Studijų programų atnaujinimas pagal ES reikalavimus, gerinant studijų kokybę ir taikant inovatyvius

Διαβάστε περισσότερα

Vitalijus Rudzinskas, Olegas Černašėjus. Aviacinės medžiagos

Vitalijus Rudzinskas, Olegas Černašėjus. Aviacinės medžiagos Vitalijus Rudzinskas, Olegas Černašėjus Aviacinės medžiagos Vilnius Technika 2012 VILNIAUS GEDIMINO TECHNIKOS UNIVERSITETAS Vitalijus Rudzinskas, Olegas Černašėjus Aviacinės medžiagos Mokomoji knyga Vilnius

Διαβάστε περισσότερα

Moksliniai tyrimai. apie Lactobacillus GG (LGG )

Moksliniai tyrimai. apie Lactobacillus GG (LGG ) Moksliniai tyrimai apie Lactobacillus GG (LGG ) Sudarytoja Maija Saxelin Valio Ltd R&D P.O. Box 30 FIN-00039 Valio, Finland Tel. +358 10 381 3030 Faks. +358 10 381 3019 www.valio.com Valio Ltd 2009 Atstovybė

Διαβάστε περισσότερα

NEKILNOJAMOJO TURTO VERTINIMAS

NEKILNOJAMOJO TURTO VERTINIMAS LIETUVOS ŽEMĖS ŪKIO UNIVERSITETAS Žemėtvarkos katedra Audrius ALEKNAVIČIUS NEKILNOJAMOJO TURTO VERTINIMAS Metodiniai patarimai Akademija, 2007 UDK 332.6(076) Spausdino UAB Judex, Europos pr. 122, LT-46351

Διαβάστε περισσότερα

AUTOMOBILIŲ KELIŲ METALINIŲ IR PLASTIKINIŲ VANDENS PRALAIDŲ KARTOTINIAI KONSTRUKCINIAI SPRENDINIAI

AUTOMOBILIŲ KELIŲ METALINIŲ IR PLASTIKINIŲ VANDENS PRALAIDŲ KARTOTINIAI KONSTRUKCINIAI SPRENDINIAI STATYBOS TAISYKLĖS AUTOMOBILIŲ KELIŲ METALINIŲ IR PLASTIKINIŲ VANDENS PRALAIDŲ KARTOTINIAI KONSTRUKCINIAI SPRENDINIAI ST 188710638.07:2004 LIETUVOS AUTOMOBILIŲ KELIŲ DIREKCIJA PRIE SUSISIEKIMO MINISTERIJOS

Διαβάστε περισσότερα

1. Klasifikavimo su mokytoju metodai

1. Klasifikavimo su mokytoju metodai 1. Klasifikavimo su mokytoju metodai Klasifikacijos uždavinys yra atpažinimo uždavinys, kurio esmė pagal pateiktus objekto (vaizdo, garso, asmens, proceso) skaitinius duomenis priskirti ji kokiai nors

Διαβάστε περισσότερα

Ketvirtos eilės Rungės ir Kutos metodo būsenos parametro vektoriaus {X} reikšmės užrašomos taip:

Ketvirtos eilės Rungės ir Kutos metodo būsenos parametro vektoriaus {X} reikšmės užrašomos taip: PRIEDAI 113 A priedas. Rungės ir Kuto metodas Rungės-Kutos metodu sprendiamos diferencialinės lygtys. Norint skaitiniu būdu išspręsti diferencialinę lygtį, reikia žinoti ieškomos funkcijos ir jos išvestinės

Διαβάστε περισσότερα

Οδηγίες Χρήσης naudojimo instrukcija Упутство за употребу navodila za uporabo

Οδηγίες Χρήσης naudojimo instrukcija Упутство за употребу navodila za uporabo Οδηγίες Χρήσης naudojimo instrukcija Упутство за употребу navodila za uporabo Πλυντήριο πιάτων Indaplovė Машинa за прање посуђа Pomivalni stroj ESL 46010 2 electrolux Περιεχόμενα Electrolux. Thinking of

Διαβάστε περισσότερα

I PRIEDAS PREPARATO CHARAKTERISTIKŲ SANTRAUKA

I PRIEDAS PREPARATO CHARAKTERISTIKŲ SANTRAUKA I PRIEDAS PREPARATO CHARAKTERISTIKŲ SANTRAUKA 1 1. VAISTINIO PREPARATO PAVADINIMAS Humalog 100 vienetų/ml injekcinis tirpalas flakone 2. KOKYBINĖ IR KIEKYBINĖ SUDĖTIS 2.1 Bendras aprašymas Humalog tai

Διαβάστε περισσότερα

ΑΝΤΙΓΡΑΦΗ ΚΑΙ ΕΚΦΡΑΣΗ ΤΗΣ ΓΕΝΕΤΙΚΗΣ ΠΛΗΡΟΦΟΡΙΑΣ

ΑΝΤΙΓΡΑΦΗ ΚΑΙ ΕΚΦΡΑΣΗ ΤΗΣ ΓΕΝΕΤΙΚΗΣ ΠΛΗΡΟΦΟΡΙΑΣ ΜΙΝΟΠΕΤΡΟΣ ΚΩΝΣΤΑΝΤΙΝΟΣ ΦΥΣΙΚΟΣ - Ρ/Η ΚΑΘΗΓΗΤΗΣ ΕΝΙΑΙΟΥ ΛΥΚΕΙΟΥ ΥΠΕΥΘΥΝΟΣ ΣΕΦΕ 2 ου ΕΝΙΑΙΟΥ ΛΥΚΕΙΟΥ ΠΕΡΑΜΑΤΟΣ ΕΡΓΑΣΤΗΡΙΑΚΗ ΑΣΚΗΣΗ ΒΙΟΛΟΓΙΑΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΑΝΤΙΓΡΑΦΗ ΚΑΙ ΕΚΦΡΑΣΗ ΤΗΣ ΓΕΝΕΤΙΚΗΣ ΠΛΗΡΟΦΟΡΙΑΣ

Διαβάστε περισσότερα

04 Elektromagnetinės bangos

04 Elektromagnetinės bangos 04 Elektromagnetinės bangos 1 0.1. BANGINĖ ŠVIESOS PRIGIMTIS 3 Šiame skyriuje išvesime banginę lygtį iš elektromagnetinio lauko Maksvelo lygčių. Šviesa yra elektromagnetinė banga, kurios dažnis yra optiniame

Διαβάστε περισσότερα

FDMGEO4: Antros eilės kreivės I

FDMGEO4: Antros eilės kreivės I FDMGEO4: Antros eilės kreivės I Kęstutis Karčiauskas Matematikos ir Informatikos fakultetas 1 Koordinačių sistemos transformacija Antrosios eilės kreivių lgtis prastinsime keisdami (transformuodami) koordinačių

Διαβάστε περισσότερα

2.5. KLASIKINĖS TOLYDŽIŲ FUNKCIJŲ TEOREMOS

2.5. KLASIKINĖS TOLYDŽIŲ FUNKCIJŲ TEOREMOS .5. KLASIKINĖS TOLYDŽIŲ FUNKCIJŲ TEOREMOS 5.. Pirmoji Bolcao Koši teorema. Jei fucija f tolydi itervale [a;b], itervalo galuose įgyja priešigų želų reišmes, tai egzistuoja tos tašas cc, ( ab ; ), uriame

Διαβάστε περισσότερα

V skyrius ĮVAIRŪS PALŪKANŲ APSKAIČIAVIMO KLAUSIMAI

V skyrius ĮVAIRŪS PALŪKANŲ APSKAIČIAVIMO KLAUSIMAI V skyrius ĮVAIRŪS PALŪKANŲ APSKAIČIAVIMO KLAUSIMAI Uždirbtų palūkanų suma priklauso ne tik nuo palūkanų normos dydžio, bet ir nuo palūkanų kapitalizavimo dažnio Metinė palūkanų norma nevisada atspindi

Διαβάστε περισσότερα

Elektrotechnika ir elektronika modulio konspektas

Elektrotechnika ir elektronika modulio konspektas KAUNO TECHNIKOS KOLEGIJA ELEKTROMECHANIKOS FAKULTETAS MECHATRONIKOS KATEDRA Elektrotechnika ir elektronika modulio konspektas Parengė: doc. dr. Marius Saunoris KAUNAS, 0 TURINYS ĮŽANGINIS ŽODIS...6 3.

Διαβάστε περισσότερα

Paprastosios DIFERENCIALINĖS LYGTYS

Paprastosios DIFERENCIALINĖS LYGTYS Paprastosios DIFERENCIALINĖS LYGTYS prof. Artūras Štikonas Paskaitų kursas Matematikos ir informatikos fakultetas Diferencialinių lygčių ir skaičiavimo matematikos katedra Naugarduko g. 24, LT-3225 Vilnius,

Διαβάστε περισσότερα

Veterinarinės paskirties pašarų papildai, aminorūgštys, vitaminai, mineralai. Produktai, kuriais Jūs galite pasitikėti!

Veterinarinės paskirties pašarų papildai, aminorūgštys, vitaminai, mineralai. Produktai, kuriais Jūs galite pasitikėti! Veterinarinės paskirties pašarų papildai, aminorūgštys, vitaminai, mineralai Produktai, kuriais Jūs galite pasitikėti! Turinys: I. Geriamieji tirpalai Aminogrow Oral... 3 Betasol-C Oral... 4 Carnitonic

Διαβάστε περισσότερα

MEDŽIAGŲ MAGNETINĖS SAVYBĖS

MEDŽIAGŲ MAGNETINĖS SAVYBĖS uolatinė sovė Magnetinis laukas X skyius MEDŽIAGŲ MAGETIĖ AVYĖ Magnetikai Magnetikų poliaizacija aa-, dia- i feoagnetikai andyai odo,kad visos edžiagos tui įtakos agnetinias eiškinias, kaip i elektinias

Διαβάστε περισσότερα

9. KEVALŲ ELEMENTAI. Pavyzdžiai:

9. KEVALŲ ELEMENTAI. Pavyzdžiai: 9. KEVALŲ ELEMENTAI Kealai Tai ploni storio krptii kūnai, sudarti iš kreių plokštuų. Geoetrija nusakoa iduriniu pairšiui ir storiu t. Kiekiena pairšiaus taške galia rasti di kreies, atitinkančias inialius

Διαβάστε περισσότερα

Turininga informatikos mokymosi medžiaga pradinukams ir vyresniems

Turininga informatikos mokymosi medžiaga pradinukams ir vyresniems Turininga informatikos mokymosi medžiaga pradinukams ir vyresniems Parašė Tim Bell, Ian H. Witten ir Mike Fellows Darbui klasėje pritaikė Robyn Adams ir Jane McKenzie Iliustravo Matt Powell 2015 m. atnaujino

Διαβάστε περισσότερα

Taikomieji optimizavimo metodai

Taikomieji optimizavimo metodai Taikomieji optimizavimo metodai 1 LITERATŪRA A. Apynis. Optimizavimo metodai. V., 2005 G. Dzemyda, V. Šaltenis, V. Tiešis. Optimizavimo metodai, V., 2007 V. Būda, M. Sapagovas. Skaitiniai metodai : algoritmai,

Διαβάστε περισσότερα

PROKALCITONINO TYRIMO REIKŠMĖ DIAGNOZUOJANT SEPSĮ. Dr. Judita Andrejaitienė Kauno medicinos universitetas Kardiochirurgijos klinika

PROKALCITONINO TYRIMO REIKŠMĖ DIAGNOZUOJANT SEPSĮ. Dr. Judita Andrejaitienė Kauno medicinos universitetas Kardiochirurgijos klinika PROKALCITONINO TYRIMO REIKŠMĖ DIAGNOZUOJANT SEPSĮ Dr. Judita Andrejaitienė Kauno medicinos universitetas Kardiochirurgijos klinika Sepsio apibrėžimas ACCP/SCCM Consensus Conference 1992 Sisteminio uždegiminio

Διαβάστε περισσότερα

TEDDY Vartotojo vadovas

TEDDY Vartotojo vadovas TEDDY Vartotojo vadovas Jūsų PRESIDENT TEDDY ASC iš pirmo žvilgsnio DĖMESIO! Prieš pradedant naudotis stotele, pirmiausia būtina prie jos prijungti anteną (jungtis, esanti prietaiso galinėje dalyje) ir

Διαβάστε περισσότερα

Βιοπληροφορική. Ενότητα 20: Υπολογιστικός Προσδιορισμός Δομής (2/3), 1 ΔΩ. Τμήμα: Βιοτεχνολογίας Όνομα καθηγητή: Τ. Θηραίου

Βιοπληροφορική. Ενότητα 20: Υπολογιστικός Προσδιορισμός Δομής (2/3), 1 ΔΩ. Τμήμα: Βιοτεχνολογίας Όνομα καθηγητή: Τ. Θηραίου Βιοπληροφορική Ενότητα 20: Υπολογιστικός Προσδιορισμός Δομής (2/3), 1 ΔΩ Τμήμα: Βιοτεχνολογίας Όνομα καθηγητή: Τ. Θηραίου Μαθησιακοί Στόχοι κατανόηση της μεθόδου προτυποποίησης πρωτεϊνών με ομολογία. παρουσίαση

Διαβάστε περισσότερα

Techninis katalogas Plokščių radiatoriai LIETUVA 2012

Techninis katalogas Plokščių radiatoriai LIETUVA 2012 Techninis katalogas Plokščių radiatoriai LIETUVA 2012 2 turinys plokščių radiatoriai charakteristika...4 plokščių radiatoriai charakteristika... 88 Compact... 10 Ventil Compact 200 mm... 91 Ventil Compact...

Διαβάστε περισσότερα

Pagrindiniai pasiekimai kokybin je molekulių elektronin s sandaros ir cheminių reakcijų teorijoje. V.Gineityt

Pagrindiniai pasiekimai kokybin je molekulių elektronin s sandaros ir cheminių reakcijų teorijoje. V.Gineityt Pagrindiniai pasiekimai kokybin je molekulių elektronin s sandaros ir cheminių reakcijų teorijoje V.Gineityt Gamtos moksluose teorijoms keliami du pagrindiniai uždaviniai: paaiškinti stebimų objektų savybes

Διαβάστε περισσότερα

I PRIEDAS PREPARATO CHARAKTERISTIKŲ SANTRAUKA

I PRIEDAS PREPARATO CHARAKTERISTIKŲ SANTRAUKA I PRIEDAS PREPARATO CHARAKTERISTIKŲ SANTRAUKA 1 1. VAISTINIO PREPARATO PAVADINIMAS AVONEX 30 mikrogramų milteliai ir tirpiklis injekciniam tirpalui 2. KOKYBINĖ IR KIEKYBINĖ SUDĖTIS Viename BIO-SET flakone

Διαβάστε περισσότερα

06 Geometrin e optika 1

06 Geometrin e optika 1 06 Geometrinė optika 1 0.1. EIKONALO LYGTIS 3 Geometrinėje optikoje įvedama šviesos spindulio sąvoka. Tai leidžia Eikonalo lygtis, kuri išvedama iš banginės lygties monochromatinei bangai - Helmholtco

Διαβάστε περισσότερα

Vandentiekio ir nuotekų tinklų medžiagos Tinklų klojimas Tinklų renovacija. VGTU Vandentvarkos katedra Paruošė doc. dr.

Vandentiekio ir nuotekų tinklų medžiagos Tinklų klojimas Tinklų renovacija. VGTU Vandentvarkos katedra Paruošė doc. dr. Vandentiekio ir nuotekų tinklų medžiagos Tinklų klojimas Tinklų renovacija VGTU Vandentvarkos katedra Paruošė doc. dr. Mindaugas Rimeika 1 Pagrindinis reikalavimas vandentiekio vamzdžiams, fasoninėms detalėms,

Διαβάστε περισσότερα

VETERINARINIO VAISTO APRAŠAS

VETERINARINIO VAISTO APRAŠAS VETERINARINIO VAISTO APRAŠAS 1. VETERINARINIO VAISTO PAVADINIMAS Antisedan Vet 5 mg/ml injekcinis tirpalas 2. KOKYBINĖ IR KIEKYBINĖ SUDĖTIS Veikliosios medžiagos: atipamezolo hidrochlorido Pagalbinės medžiagos:

Διαβάστε περισσότερα

Kodėl mikroskopija? Optinė mikroskopija: įvadas. Žmogaus akis. Žmogaus akis. Žmogaus akis. Vaizdo formavimasis žmogaus akyje

Kodėl mikroskopija? Optinė mikroskopija: įvadas. Žmogaus akis. Žmogaus akis. Žmogaus akis. Vaizdo formavimasis žmogaus akyje Kodėl mikroskopija? Todėl, kad pamatyti reiškia patikėti... Optinė mikroskopija: įvadas Žmogaus akis Žmogaus akis Mato šviesą, kurios bangų ilgis nuo 400 nm (violetinė) iki 750 nm (mėlyna) Stiebelių ir

Διαβάστε περισσότερα

Disbopox 442 GaragenSiegel

Disbopox 442 GaragenSiegel Sustiprinta anglies (karbono) pluoštu, vandeninė, 2-jų komponentų epoksidinės dervos danga garažų, sandėlių, rūsių grindims. Produkto aprašymas Paskirtis Savybės Mineralinės grindų ir kietojo asfalto išlyginamosios

Διαβάστε περισσότερα

Patekimo į darbo vietas aukštyje priemonės

Patekimo į darbo vietas aukštyje priemonės Patekimo į darbo vietas aukštyje priemonės Patekimo į darbo vietas aukštyje priemonės Turinys Pratarmė... 5 I. Fiksuotų priėjimo priemonių tarp dviejų lygių darbo vietų parinkimas... 6 1. Pagrindinės

Διαβάστε περισσότερα

46 serija. 46 serijos - miniatiūrinės pramoninės relės. Greitas, patikimas ir saugus jungimas. tvirtos sujungimo kojelės paauksuoti kontaktai

46 serija. 46 serijos - miniatiūrinės pramoninės relės. Greitas, patikimas ir saugus jungimas. tvirtos sujungimo kojelės paauksuoti kontaktai 46 serija Greitas, patikimas ir saugus jungimas 46 serijos - miniatiūrinės pramoninės relės didelis amperažas, maks. 16 A LED indikatorius 12,4 mm pločio tvirtos sujungimo kojelės paauksuoti kontaktai

Διαβάστε περισσότερα