Φυσική Στερεών στις Πρωτεΐνες

Μέγεθος: px
Εμφάνιση ξεκινά από τη σελίδα:

Download "Φυσική Στερεών στις Πρωτεΐνες"

Transcript

1 Φυσική Στερεών στις Πρωτεΐνες Νίκος Απ. Παπανδρέου Τ.Ε.Ι. Πειραιά Φεβρουάριος 2010

2 Ένα ελικοϊδές μονοπάτι

3 Χημική δομή μίας πρωτεΐνης Μήκος αλυσίδας ~30 έως ~1000 αµινοξέα Συνολικός αριθµός ατόµων έως ~ 10 5 Πολυπεπτιδική αλυσίδα R: πλευρική αλυσίδα Χαρακτηρίζει τον τύπο του αµινοξέος 20 είδη πλευρικών Αλυσίδων 20 τύποι αµινοξέων

4 Τα 20 αμινοξέα Υδρόφοβα Πολικά (Υδρόφιλα) Φορτισµένα

5 Αμινοξική ακολουθία AFWGYTRKLMNQSEVHPKLLIPKCGFTEVNPHCYRLIL Εδώ βρίσκεται κωδικοποιηµένη η Βιοχηµική δράση της πρωτεΐνης

6 Στερεοδομή μίας πρωτεΐνης Σε φυσιολογικές συνθήκες (υδατικό διάλυμα) η πρωτεΐνη αναδιπλώνεται σε μία μοναδική και σταθερή 3D δομή, που είναι βιοχημικά ενεργή. Αυτόνομη δομική περιοχή: ~30 έως ~200 αμινοξέα: αυτόνομη λειτουργία Οι δυνάμεις που σταθεροποιούν τη δομή είναι οι μη ομοιοπολικές δυνάμεις μεταξύ ατόμων (Van der Waals, ηλεκτροστατικές, δεσμοί υδρογόνου)

7 H 3D δοµή καθορίζεται απο την αµινοξική ακολουθία H 3D δοµή καθορίζει τη βιοχηµική λειτουργία Παράδειγμα Αναγνώριση αντιγόνου (κόκκινο) από πρωτεΐνη του ανοσοποιητικού συστήματος (μπλέ-πράσινο)

8 Η διπλωµένη, βιολογικά ενεργή πρωτεΐνη είναι ένα Στερεό Σώµα Η µελέτη της σε µικροσκοπικό επίπεδο εµπλέκει τις µεθόδους της Φυσικής των Στερεών Πειραματικός προσδιορισμός δομής πρωτεϊνών Περίθλαση ακτίνων Χ (απαιτεί παρασκευή κρυστάλλων πρωτεϊνών) NMR (γίνεται σε διάλυμα, αλλά έχει περισσότερο θόρυβο και μικρότερη ακρίβεια)

9 Το πρόβλημα της αναδίπλωσης των πρωτεΐνών Η πρόβλεψη της 3D δομής χρησιμοποιώντας ως πληροφορία μόνο την αμινοξική ακολουθία (ab initio) Άλυτο πρόβλημα σήμερα???????????????? Αριθμός γνωστών δομών << Αριθμός γνωστών ακολουθιών Σημαντικός ρόλος θεωρητικής μελέτης και προσομοίωσης

10 Αναδίπλωση: ο ρόλος της εντροπίας =Μόριο νερού

11 Αναδίπλωση: ενεργειακά μονοπάτια Ενεργειακό φάσμα παρόμοιο με τα Στερεά με Δομική Αταξία (Ημιαγωγοί Κεραμικά) Μετάβαση μεταξύ εντοπισμένων καταστάσεων με θερμική διέγερση

12 Voronoi tesselation Οι πρωτεΐνες σαν συμπαγή στερεά Κυψελίδες Voronoi: Πολύεδρα με κέντρα τα αμινοξέα Δύο αμινοξέα είναι γειτονικά στο χώρο αν έχουν κοινή έδρα

13

14 Μήκος συσχετισμού στις πρωτεΐνες TEF = Tightened-End-Fragments ΑΒ στο χώρο < 10 Å AB κατά μήκος της αλυσίδας ~ αμινοξέα Α, Β υδρόφοβα αμινοξέα του πυρήνα της πρωτεΐνης Α Β Δρουν σαν άγκυρες για τη δομή TEF = τμήμα του πρωτεϊνικού σκελετού ανάμεσα σε δύο σημεία επαφής

15 Ανάλυση 3D δομής σε TEF Η πρόβλεψη των TEF από την αμινοξική ακολουθία είναι πολύ σημαντική για την πρόβλεψη της δομής

16 Αναδίπλωση: παράδοξα και κλίμακες Αναδιπλωμένη κατάσταση = ελάχιστη ενέργεια Πρωτείνη 150 αμινοξέων Αριθμός στερεοδιατάξεων ~ 1070 Χρόνος αναδίπλωσης με τυχαία έρευνα ~ yrs Ξεπερνά την ηλικία του σύμπαντος (~ sec ~ 1010 yrs) Μία πρωτεΐνη διπλώνει σε ~ 1 sec (Παράδοξο του Levinthal) Ύπαρξη χαρακτηριστικής κλίμακας για την αναδίπλωση Για αμινοξέα ο χρόνος αναδίπλωσης με τυχαία έρευνα είναι ~ 1 sec.? Ύπαρξη στοιχειωδών τμημάτων αμινοξέων που είναι σημαντικά για την αναδίπλωση Είναι τα TEF?

17 Κρίσιμες θέσεις στην πρωτεϊνική δομή Είναι τα άκρα των TEF, που καθορίζουν τον σχηματισμό τους Ο σχηματισμός των TEF είναι το κρίσιμο σημείο στην αναδίπλωση μίας πρωτεΐνης Αντιστοιχεί στην δυσκολότερη μετάβαση του ενεργειακού μονοπατιού. Ηλεκτρικό ανάλογο στα στερεά µε δοµική αταξία Διέλευση συνεχούς ρεύµατος: υπερπήδηση του υψηλότερου ενεργειακού φράγµατος R1 R2 R3 R4 R5 R6... Rολ ~ ΜΑΧ(Ri)

18 Υπολογισµός της πιθανότητας βύθισης στο εσωτερικό της δοµής: τα µέγιστα είναι οι κρίσιµες θέσεις

19 Εφαρμογές Οι κρίσιμες θέσεις είναι οι πιο ευαίσθητες σε μεταλλάξεις Ιατρικές Βιοτεχνολογικές εφαρμογές Πρόβλεψη δομής μικρών βιομορίων Νανο-βιοτεχνολογία

20 Ευχαριστίες Dr Jacques Chomilier Institut de Minéralogie et de Physique de la Matière Condensée (IMPMC) Παρίσι Καθ. Ηλίας Ηλιόπουλος Γεωπονικό Παν/μιο Αθήνας

Ενεργειακή ανάλυση βιομορίων

Ενεργειακή ανάλυση βιομορίων Ενεργειακή ανάλυση βιομορίων Τα βιομόρια ως φυσικά συστήματα πρωτεΐνες, DNA, πεπτίδια, μικρά μόρια (ligands, φάρμακα) Αλληλεπιδράσεις μεταξύ των ατόμων + επίδραση του περιβάλλοντος νερού σταθεροποίηση

Διαβάστε περισσότερα

Άσκηση 7. Προσομοίωση 3D Δομών Βιομορίων μέσω. Ομολογίας & Threading

Άσκηση 7. Προσομοίωση 3D Δομών Βιομορίων μέσω. Ομολογίας & Threading Άσκηση 7 Προσομοίωση 3D Δομών Βιομορίων μέσω Ομολογίας & Threading Προσομοίωση 2ταγούς δομής πρωτεϊνών Δευτεροταγής Δομή: Η 2ταγής δομή των πρωτεϊνών είναι σταθερή τοπική διαμόρφωση της πολυπεπτιδικής

Διαβάστε περισσότερα

ΓΩΝΙΕΣ φ, ψ ΚΑΙ ΕΠΙΤΡΕΠΤΕΣ ΔΙΑΜΟΡΦΩΣΕΙΣ ΤΗΣ ΠΟΛΥΠΕΠΤΙΔΙΚΗΣ ΑΛΥΣΙΔΑΣ

ΓΩΝΙΕΣ φ, ψ ΚΑΙ ΕΠΙΤΡΕΠΤΕΣ ΔΙΑΜΟΡΦΩΣΕΙΣ ΤΗΣ ΠΟΛΥΠΕΠΤΙΔΙΚΗΣ ΑΛΥΣΙΔΑΣ ΓΩΝΙΕΣ φ, ψ ΚΑΙ ΕΠΙΤΡΕΠΤΕΣ ΔΙΑΜΟΡΦΩΣΕΙΣ ΤΗΣ ΠΟΛΥΠΕΠΤΙΔΙΚΗΣ ΑΛΥΣΙΔΑΣ ΜΕΤΡΗΣΗ ΤΗΣ ΓΩΝΙΑΣ φ φ Ccarbonyl n Ccarbonyl n N Cα n Ccarbonyl n-1 Cα n N φ Ccarbonyl n-1 ΜΕΤΡΗΣΗ ΤΗΣ ΓΩΝΙΑΣ ψ φ ψ Ccarbonyl n N (Ca

Διαβάστε περισσότερα

Εισαγωγή στη Μοριακή Προσοµοίωση

Εισαγωγή στη Μοριακή Προσοµοίωση Κεφάλαιο 6 Εισαγωγή στη Μοριακή Προσοµοίωση 6.1. Μοριακή Μηχανική 6.1.1. Εισαγωγή στη µεθοδολογία του «απ αρχής» διπλώµατος της πρωτείνης. Η ενέργεια κάθε µορίου µπορεί θεωρητικά να υπολογιστεί µε την

Διαβάστε περισσότερα

Αρχιτεκτονική της τρισδιάστατης δομής πρωτεϊνών

Αρχιτεκτονική της τρισδιάστατης δομής πρωτεϊνών Αρχιτεκτονική της τρισδιάστατης δομής πρωτεϊνών Βασίλης Προμπονάς, PhD Ερευνητικό Εργαστήριο Βιοπληροφορικής Τμήμα Βιολογικών Επιστημών Νέα Παν/πολη, Γραφείο B161 Πανεπιστήμιο Κύπρου Ταχ.Κιβ. 20537 1678,

Διαβάστε περισσότερα

Πρωτεινική αναδίπλωση

Πρωτεινική αναδίπλωση Πρωτεινική αναδίπλωση Η αμινοξική αλληλουχία καθορίζει την τριτοταγή δομή - Οι πληροφορίες για τη βιολογικά δραστική στερεοδιάταξη είναι κωδικοποιημένες στην αμινοξική αλληλουχία Ριβονουκλεάση- Anfinsen,

Διαβάστε περισσότερα

ΔΟΜΗ ΚΑΙ ΑΝΑΛΥΣΗ ΒΙΟΜΟΡΙΩΝ

ΔΟΜΗ ΚΑΙ ΑΝΑΛΥΣΗ ΒΙΟΜΟΡΙΩΝ ΔΟΜΗ ΚΑΙ ΑΝΑΛΥΣΗ ΒΙΟΜΟΡΙΩΝ Διδάσκοντες: Δ.Δ. Λεωνίδας, Α.-Μ. Ψαρρά Κωδικός e-class: SEYC194 28/9/2015 Δ.Δ. Λεωνίδας 28/9/2015 Δ.Δ. Λεωνίδας Βιοχημεία είναι η Χημεία που εμφανίζεται μέσα στους ζώντες οργανισμούς

Διαβάστε περισσότερα

Μικρά αμινοξέα. Βιοχημεία Ι Β-3

Μικρά αμινοξέα. Βιοχημεία Ι Β-3 Βιοχημεία Ι Β-2 Μικρά αμινοξέα Βιοχημεία Ι Β-3 Aλειφατικά αμινοξέα Βιοχημεία Ι Β-4 Ιμινοξύ Βιοχημεία Ι Β-5 Αρωματικά αμινοξέα Βιοχημεία Ι Β-6 Βιοχημεία Ι Β-7 Η Tyr και η Trp απορροφούν στα 280nm-έτσι μετράται

Διαβάστε περισσότερα

Δομή πρωτεϊνών: Τριτοταγής διαμόρφωση της δομής

Δομή πρωτεϊνών: Τριτοταγής διαμόρφωση της δομής Δομή πρωτεϊνών: Τριτοταγής διαμόρφωση της δομής - Αναφέρεται στην αναδίπλωση της πολυπεπτιδικής αλυσίδας πάνω στον εαυτό της και στο τελικό σχήμα που θα πάρει στο χώρο -Σ αυτή τη διαμόρφωση σημαντικό ρόλο

Διαβάστε περισσότερα

Βιοφυσική. ΦΥΣ 415 Διδάσκων Σ. Σκούρτης (χειμερινό εξάμηνο ) 3 η Διάλεξη

Βιοφυσική. ΦΥΣ 415 Διδάσκων Σ. Σκούρτης (χειμερινό εξάμηνο ) 3 η Διάλεξη Βιοφυσική ΦΥΣ 415 Διδάσκων Σ. Σκούρτης (χειμερινό εξάμηνο 2009-10) 3 η Διάλεξη Από την προηγούμενη διάλεξη: Οι πρωτεΐνες εκτελούν τις περισσότερες βιολογικές λειτουργίες π.χ Ενζυμική κατάλυση (επιτάχυνση

Διαβάστε περισσότερα

Δευτεροταγής Δομή Πρωτεϊνών

Δευτεροταγής Δομή Πρωτεϊνών Δευτεροταγής Δομή Πρωτεϊνών Πρωτεϊνικό δίπλωμα Oι στόχοι μιας πρωτεΐνης όταν διπλωθεί είναι: 1. H xαμηλή ενέργεια διαμόρφωσης του κάθε αμινοξέος 2. Να επιτευχθούν υδρογονικοί δεσμοί από πολικά αμινοξέα

Διαβάστε περισσότερα

Τα χημικά στοιχεία που είναι επικρατέστερα στους οργανισμούς είναι: i..

Τα χημικά στοιχεία που είναι επικρατέστερα στους οργανισμούς είναι: i.. ΦΥΛΛΟ ΕΡΓΑΣΙΑΣ ΣΤΟ 1 ο ΚΕΦΑΛΑΙΟ «XHMIKH ΣΥΣΤΑΣΗ ΤΟΥ ΚΥΤΤΑΡΟΥ» ΕΙΣΑΓΩΓΗ ΚΑΙ Η ΧΗΜΕΙΑ ΤΗΣ ΖΩΗΣ Α. ΔΡΑΣΤΗΡΙΟΤΗΤΕΣ ΜΕΣΑ ΣΤΗΝ ΤΑΞΗ 1. Όταν αναφερόμαστε στον όρο «Χημική Σύσταση του Κυττάρου», τί νομίζετε ότι

Διαβάστε περισσότερα

Δομές (Διαμορφώσεις) Πρωτεινικών μορίων

Δομές (Διαμορφώσεις) Πρωτεινικών μορίων Δομές (Διαμορφώσεις) Πρωτεινικών μορίων Πρωτοταγής δομή (αλληλουχία αμινοξέων) Δευτεροταγής δομή Η διάταξη της πεπτιδικής αλυσίδας στον χωρο αυτής καθ αυτής (χωρίς να ληφθούν υπ όψη οι ομάδες R) Τριτοταγής

Διαβάστε περισσότερα

Τα τείχη έχουν πέσει: Κυτταρική Βιολογία, Βιοχημεία, Γενετική γέννησαν τη σύγχρονη Βιοϊατρική. Βιοχημεία Ι Α-2

Τα τείχη έχουν πέσει: Κυτταρική Βιολογία, Βιοχημεία, Γενετική γέννησαν τη σύγχρονη Βιοϊατρική. Βιοχημεία Ι Α-2 Περιεχόμενο της σύγχρονης Βιοχημείας Η περιγραφή της δομής, της οργάνωσης και της λειτουργίας του κυττάρου σε μοριακό επίπεδο Η διερεύνηση της σχέσης δομής-λειτουργίας των βιομορίων Η μελέτη του μεταβολισμού

Διαβάστε περισσότερα

πρωτεΐνες πολυμερείς ουσίες δομούν λειτουργούν λευκώματα 1.Απλές πρωτεΐνες 2.Σύνθετες πρωτεΐνες πρωτεΐδια μη πρωτεϊνικό μεταλλοπρωτεΐνες

πρωτεΐνες πολυμερείς ουσίες δομούν λειτουργούν λευκώματα 1.Απλές πρωτεΐνες 2.Σύνθετες πρωτεΐνες πρωτεΐδια μη πρωτεϊνικό μεταλλοπρωτεΐνες ΠΡΩΤΕΙΝΕΣ Οι πρωτεΐνες είναι πολυμερείς ουσίες με κυρίαρχο και πρωταρχικό ρόλο στη ζωή. Πρωτεΐνες είναι οι ουσίες που κυρίως δομούν και λειτουργούν τους οργανισμούς. Λέγονται και λευκώματα λόγω του λευκού

Διαβάστε περισσότερα

Κεφάλαιο 3. Δομές τάξης α

Κεφάλαιο 3. Δομές τάξης α Κεφάλαιο 3 Δομές τάξης α Κεφάλαιο 3 Δομές Τάξης α: Σπειρωμένα Σπειράματα Εικόνα 3.1 Σχηματικό διάγραμμα της δομής ενός σπειρωμένου σπειράματος α-ελίκων. Δύο α-έλικες συμπλέκονται και σταδιακά τυλίγονται

Διαβάστε περισσότερα

ΠΡΩΤΕΪΝΕΣ. Φατούρος Ιωάννης Αναπληρωτής Καθηγητής

ΠΡΩΤΕΪΝΕΣ. Φατούρος Ιωάννης Αναπληρωτής Καθηγητής ΠΡΩΤΕΪΝΕΣ Φατούρος Ιωάννης Αναπληρωτής Καθηγητής Θέματα Διάλεξης Δομή, αριθμός και διαχωρισμός των αμινοξέων Ένωση αμινοξέων με τον πεπτιδικό δεσμό για τη δημιουργία πρωτεΐνης Λειτουργίες των πρωτεϊνών

Διαβάστε περισσότερα

πρωτεϊνες νουκλεϊκά οξέα Βιολογικά Μακρομόρια υδατάνθρακες λιπίδια

πρωτεϊνες νουκλεϊκά οξέα Βιολογικά Μακρομόρια υδατάνθρακες λιπίδια πρωτεϊνες νουκλεϊκά οξέα Βιολογικά Μακρομόρια υδατάνθρακες λιπίδια Περιγραφή μαθήματος Επανάληψη σημαντικών εννοιών από την Οργανική Χημεία Χημική σύσταση των κυττάρων Μονοσακχαρίτες Αμινοξέα Νουκλεοτίδια

Διαβάστε περισσότερα

ΘΕΜΑ 1 Ο Για τι προτάσει 1.1 και 1.2 να γράψετε στο τετράδιό σα τον αριθµό τη πρόταση και δίπλα το γράµµα που αντιστοιχεί στη σωστή συµπλήρωσή τη.

ΘΕΜΑ 1 Ο Για τι προτάσει 1.1 και 1.2 να γράψετε στο τετράδιό σα τον αριθµό τη πρόταση και δίπλα το γράµµα που αντιστοιχεί στη σωστή συµπλήρωσή τη. Γ' ΛΥΚΕΙΟΥ ΤΕΧΝΟΛΟΓΙΚΗ ΚΑΤΕΥΘΥΝΣΗ ΧΗΜΕΙΑ - ΒΙΟΧΗΜΕΙΑ ΘΕΜΑ Ο Για τι προτάσει. και.2 να γράψετε στο τετράδιό σα τον αριθµό τη πρόταση και δίπλα το γράµµα που αντιστοιχεί στη σωστή συµπλήρωσή τη.. Ποια από

Διαβάστε περισσότερα

Τμήμα Βιολογίας Μάθημα: ΒΙΟΛΟΓΙΑ ΚΥΤΤΑΡΟΥ Γ εξάμηνο 2014-2015 Διαλέξεις κάθε Τρίτη 13-15 μ.μ. και Παρασκευή 11-13

Τμήμα Βιολογίας Μάθημα: ΒΙΟΛΟΓΙΑ ΚΥΤΤΑΡΟΥ Γ εξάμηνο 2014-2015 Διαλέξεις κάθε Τρίτη 13-15 μ.μ. και Παρασκευή 11-13 Τμήμα Βιολογίας Μάθημα: ΒΙΟΛΟΓΙΑ ΚΥΤΤΑΡΟΥ Γ εξάμηνο 2014-2015 Διαλέξεις κάθε Τρίτη 13-15 μ.μ. και Παρασκευή 11-13 Ισιδώρα Παπασιδέρη, Καθηγήτρια...για περισσότερα... http://kyttariki.biol.uoa.gr, ttp://multimedia.biol.uoa.gr

Διαβάστε περισσότερα

ΟΡΓΑΝΩΣΗ ΛΙΠΙΔΙΩΝ ΣΕ ΥΔΑΤΙΚΟ ΠΕΡΙΒΑΛΛΟΝ

ΟΡΓΑΝΩΣΗ ΛΙΠΙΔΙΩΝ ΣΕ ΥΔΑΤΙΚΟ ΠΕΡΙΒΑΛΛΟΝ ΟΡΓΑΝΩΣΗ ΛΙΠΙΔΙΩΝ ΣΕ ΥΔΑΤΙΚΟ ΠΕΡΙΒΑΛΛΟΝ ΜΟΝΤΕΛΑ ΜΕΜΒΡΑΝΙΚΩΝ ΣΥΣΤΗΜΑΤΩΝ 1. Μονοστιβάδες 2. Διπλοστιβάδες 3. Λιποσώματα 1.1 ΜΟΝΟΣΤΙΒΑΔΕΣ Σχηματίζονται από μη-πολικά μόρια στη μεσόφαση αέρα/νερού Συσκευή

Διαβάστε περισσότερα

Θέµατα ιάλεξης ΠΡΩΤΕΪΝΕΣ - ΕΝΖΥΜΑ ΠΡΩΤΕΪΝΕΣ. ιαχωρισµός Αµινοξέων

Θέµατα ιάλεξης ΠΡΩΤΕΪΝΕΣ - ΕΝΖΥΜΑ ΠΡΩΤΕΪΝΕΣ. ιαχωρισµός Αµινοξέων MANAGING AUTHORITY OF THE OPERATIONAL PROGRAMME EDUCATION AND INITIAL VOCATIONAL TRAINING ΠΡΩΤΕΪΝΕΣ - ΕΝΖΥΜΑ Θέµατα ιάλεξης οµή, αριθµός και διαχωρισµός των αµινοξέων Ένωση αµινοξέων µε τον πεπτιδικό δεσµό

Διαβάστε περισσότερα

Μοριακή Αναγνώριση. 5.1. Εισαγωγή. 5.2. Σταθερές σύνδεσης και αποχωρισµού. [A][B] k d = ----------- [AB] [ΑΒ] k i = ---------- [Α][Β] Κεφάλαιο

Μοριακή Αναγνώριση. 5.1. Εισαγωγή. 5.2. Σταθερές σύνδεσης και αποχωρισµού. [A][B] k d = ----------- [AB] [ΑΒ] k i = ---------- [Α][Β] Κεφάλαιο Κεφάλαιο 5-1 5 Μοριακή Αναγνώριση 5.1. Εισαγωγή Ένα από τα σηµαντικότερα χαρακτηριστικά των ζωντανών οργανισµών είναι ότι τα µακροµόρια που περιέχουν κάνουν πολύ εξειδικευµένες αλληλεπιδράσεις µε άλλα

Διαβάστε περισσότερα

Κεφάλαιο 2 Χημικοί Δεσμοί

Κεφάλαιο 2 Χημικοί Δεσμοί Κεφάλαιο 2 Χημικοί Δεσμοί Σύνοψη Παρουσιάζονται οι χημικοί δεσμοί, ιοντικός, μοριακός, ατομικός, μεταλλικός. Οι ιδιότητες των υλικών τόσο οι φυσικές όσο και οι χημικές εξαρτώνται από το είδος ή τα είδη

Διαβάστε περισσότερα

BΑΣΙΚΕΣ ΑΡΧΕΣ ΒΙΟΧΗΜΕΙΑΣ ΕΝΕΡΓΕΙΑ ΚΑΙ ΜΕΤΑΒΟΛΙΣΜΟΣ ΧΗΜΙΚΗ ΣΥΣΤΑΣΗ ΤΩΝ ΚΥΤΤΑΡΩΝ

BΑΣΙΚΕΣ ΑΡΧΕΣ ΒΙΟΧΗΜΕΙΑΣ ΕΝΕΡΓΕΙΑ ΚΑΙ ΜΕΤΑΒΟΛΙΣΜΟΣ ΧΗΜΙΚΗ ΣΥΣΤΑΣΗ ΤΩΝ ΚΥΤΤΑΡΩΝ BΑΣΙΚΕΣ ΑΡΧΕΣ ΒΙΟΧΗΜΕΙΑΣ ΕΝΕΡΓΕΙΑ ΚΑΙ ΜΕΤΑΒΟΛΙΣΜΟΣ ΧΗΜΙΚΗ ΣΥΣΤΑΣΗ ΤΩΝ ΚΥΤΤΑΡΩΝ 1. ΧΗΜΙΚΗ ΣΥΣΤΑΣΗ ΤΩΝ ΚΥΤΤΑΡΩΝ 2. BΑΣΙΚΕΣ ΑΡΧΕΣ ΒΙΟΧΗΜΕΙΑΣ Ι. ΑΤΟΜΑ ΚΑΙ ΜΟΡΙΑ ΙΙ. ΧΗΜΙΚΟΙ ΔΕΣΜΟΙ ΙΙΙ. ΜΑΚΡΟΜΟΡΙΑ ΣΤΑ ΚΥΤΤΑΡΑ

Διαβάστε περισσότερα

Δομικές κατηγορίες πρωτεϊνών

Δομικές κατηγορίες πρωτεϊνών 3-1 Κεφάλαι ο Δομικές κατηγορίες πρωτεϊνών 3.1. α-δομές πρωτεϊνών Οι α-έλικες είναι δομικά στοιχεία που μπορούν να σχηματίσουν πολλές κατηγορίες στερεοδομών και με πολλές διαφορετικές λειτουργίες. Εκτός

Διαβάστε περισσότερα

1.Μαθησιακοί στόχοι του μαθήματος

1.Μαθησιακοί στόχοι του μαθήματος BIOXHMEIA, TOMOΣ I ΠANEΠIΣTHMIAKEΣ EKΔOΣEIΣ KPHTHΣ 1.Μαθησιακοί στόχοι του μαθήματος της ΒΙΟΧΗΜΕΙΑΣ (ΕΤΥ-232) 1)εξοικείωση των φοιτητών με τον μοριακό σχεδιασμό της ζωής 2)εμπέδωση της δομής και λειτουργίας

Διαβάστε περισσότερα

Οι πρωτεΐνες συμμετέχουν σε όλες τις κυτταρικές λειτουργίες

Οι πρωτεΐνες συμμετέχουν σε όλες τις κυτταρικές λειτουργίες Οι πρωτεΐνες συμμετέχουν σε όλες τις κυτταρικές λειτουργίες Γένωμα vs Πρωτέωμα Όλη η αλληλουχία βάσεων στο DNA Τι είναι δυνατόν Συγκεκριμένο Στατικό Οι πρωτεΐνες που κωδικοποιούνται από το γένωμα Τι είναι

Διαβάστε περισσότερα

οµή και Αναδίπλωση πρωτεϊνών

οµή και Αναδίπλωση πρωτεϊνών οµή και Αναδίπλωση πρωτεϊνών Νηφόρου Κατερίνα Μεταδιδακτορική Ερευνήτρια, Οµάδα Μοριακής Καρκινογένεσης, Εργ/ριο Ιστολογίας-Εµβρυολογίας, Ιατρική Σχολή Αθηνών Σηµασία των πρωτεϊνών Ενζυµική κατάλυση Μεταφορά

Διαβάστε περισσότερα

Φασματοσκοπίας UV/ορατού Φασματοσκοπίας υπερύθρου Φασματοσκοπίας άπω υπερύθρου / μικροκυμάτων Φασματοσκοπίας φθορισμού Φασματοσκοπίας NMR

Φασματοσκοπίας UV/ορατού Φασματοσκοπίας υπερύθρου Φασματοσκοπίας άπω υπερύθρου / μικροκυμάτων Φασματοσκοπίας φθορισμού Φασματοσκοπίας NMR Φασματοσκοπία Ερμηνεία & εφαρμογές : Φασματοσκοπίας UV/ορατού Φασματοσκοπίας υπερύθρου Φασματοσκοπίας άπω υπερύθρου / μικροκυμάτων Φασματοσκοπίας φθορισμού Φασματοσκοπίας NMR Ποια φαινόμενα παράγουν τα

Διαβάστε περισσότερα

ΑΙΜΟΣΦΑΙΡΙΝΗ (ΑΜΦ) ΑΙΜΟΣΦΑΙΡΙΝΗ: Hb, είναι τετραμερής πρωτείνη. ΜΕΤΑΠΤΩΣΗ ΑΠΟ Τ <=> R

ΑΙΜΟΣΦΑΙΡΙΝΗ (ΑΜΦ) ΑΙΜΟΣΦΑΙΡΙΝΗ: Hb, είναι τετραμερής πρωτείνη. ΜΕΤΑΠΤΩΣΗ ΑΠΟ Τ <=> R ΑΙΜΟΣΦΑΙΡΙΝΗ (ΑΜΦ) ΑΙΜΟΣΦΑΙΡΙΝΗ: Hb, είναι τετραμερής πρωτείνη. ΜΕΤΑΠΤΩΣΗ ΑΠΟ Τ R ΔΕΟΞΥΑΙΜΟΣΦΑΙΡΙΝΗ ΟΞΥΑΙΜΟΣΦΑΙΡΙΝΗ (Σταθερότητα, χαμηλή συγγένεια για Ο2Εύκαμπτη, υψηλή συγγένεια για Ο2) Λόγο των

Διαβάστε περισσότερα

«ΠΡΩΤΕΪΝΕΣ: ΧΗΜΙΚΗ ΔΟΜΗ ΚΑΙ ΒΙΟΛΟΓΙΚΟΣ ΡΟΛΟΣ»

«ΠΡΩΤΕΪΝΕΣ: ΧΗΜΙΚΗ ΔΟΜΗ ΚΑΙ ΒΙΟΛΟΓΙΚΟΣ ΡΟΛΟΣ» «ΠΡΩΤΕΪΝΕΣ: ΧΗΜΙΚΗ ΔΟΜΗ ΚΑΙ ΒΙΟΛΟΓΙΚΟΣ ΡΟΛΟΣ» Τι είναι οι πρωτεΐνες; Από τι αποτελούνται; Ποιος είναι ο βιολογικός του ρόλος; Ας ρίξουμε μία ματιά σε όλα αυτά τα ερωτήματα που μας απασχολούν ΚΕΦΑΛΑΙΟ 1:

Διαβάστε περισσότερα

Στοιχεία Φυσικοχηµείας και Βιοφυσικής

Στοιχεία Φυσικοχηµείας και Βιοφυσικής Στοιχεία Φυσικοχηµείας και Βιοφυσικής Β. Φαδούλογλου 2008 Στοιχεία Φυσικοχηµείας και Βιοφυσικής Εργαστήρια Βιβλίο Εξετάσεις Ύλη Στοιχεία Φυσικοχηµείας και Βιοφυσικής Εργαστήρια Βιβλίο Εξετάσεις Ύλη Στοιχεία

Διαβάστε περισσότερα

Ηλίας Ηλιόπουλος Εργαστήριο Γενετικής, Τμήμα Βιοτεχνολογίας, Γεωπονικό Πανεπιστήμιο Αθηνών

Ηλίας Ηλιόπουλος Εργαστήριο Γενετικής, Τμήμα Βιοτεχνολογίας, Γεωπονικό Πανεπιστήμιο Αθηνών Μοριακή Αναγνώριση Ηλίας Ηλιόπουλος Εργαστήριο Γενετικής, Τμήμα Βιοτεχνολογίας, Γεωπονικό Πανεπιστήμιο Αθηνών 1 Μοριακή Αναγνώριση Με τον όρο μοριακή αναγνώριση περιγράφουμε την αλληλεπίδραση μεταξύ δύο

Διαβάστε περισσότερα

1.1. Να γράψετε στο τετράδιό σας το γράµµα που αντιστοιχεί στη σωστή απάντηση:

1.1. Να γράψετε στο τετράδιό σας το γράµµα που αντιστοιχεί στη σωστή απάντηση: ΘΕΜΑ 1o 1.1. Να γράψετε στο τετράδιό σας το γράµµα που αντιστοιχεί στη σωστή απάντηση: Η σταθερά Κ w στους 25 ο C έχει τιµή 10-14 : α. µόνο στο καθαρό νερό β. σε οποιοδήποτε υδατικό διάλυµα γ. µόνο σε

Διαβάστε περισσότερα

Βιολογία Γενικής Παιδείας Β Λυκείου

Βιολογία Γενικής Παιδείας Β Λυκείου Απρίλιος Μάιος 12 Βιολογία Γενικής Παιδείας Β Λυκείου Βιολογία Γενικής Παιδείας Β Λυκείου (Ερωτήσεις που παρουσιάζουν ενδιαφέρον) 1. Τι είναι τα βιομόρια και ποια είναι τα βασικά χαρακτηριστικά τους; Βιομόρια

Διαβάστε περισσότερα

ΘΕΜΑ 1 ο 1.1. Να γράψετε στο τετράδιό σας το γράμμα που αντιστοιχεί στη σωστή απάντηση:

ΘΕΜΑ 1 ο 1.1. Να γράψετε στο τετράδιό σας το γράμμα που αντιστοιχεί στη σωστή απάντηση: ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΕΝΙΑΙΟΥ ΛΥΚΕΙΟΥ ΤΡΙΤΗ 5 ΙΟΥΝΙΟΥ 2001 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΤΕΧΝΟΛΟΓΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ (ΚΥΚΛΟΣ ΤΕΧΝΟΛΟΓΙΑΣ ΚΑΙ ΠΑΡΑΓΩΓΗΣ) : ΧΗΜΕΙΑ - ΒΙΟΧΗΜΕΙΑ ΘΕΜΑ 1 ο 1.1. Να γράψετε στο τετράδιό

Διαβάστε περισσότερα

Kυτταρική Bιολογία ΔΟΜΗ ΚΑΙ ΛΕΙΤΟΥΡΓΙΕΣ ΤΩΝ ΠΡΩΤΕΪΝΩΝ ΔIAΛEΞΗ 3 (7/3/2012) Δρ. Xρήστος Παναγιωτίδης, Τμήμα Φαρμακευτικής Α.Π.Θ.

Kυτταρική Bιολογία ΔΟΜΗ ΚΑΙ ΛΕΙΤΟΥΡΓΙΕΣ ΤΩΝ ΠΡΩΤΕΪΝΩΝ ΔIAΛEΞΗ 3 (7/3/2012) Δρ. Xρήστος Παναγιωτίδης, Τμήμα Φαρμακευτικής Α.Π.Θ. Kυτταρική Bιολογία ΔIAΛEΞΗ 3 (7/3/2012) ΔΟΜΗ ΚΑΙ ΛΕΙΤΟΥΡΓΙΕΣ ΤΩΝ ΠΡΩΤΕΪΝΩΝ AΣ ΘYMHΘOYME Στην προηγούμενη διάλεξη μιλήσαμε για τη χημική σύσταση των κυττάρων και για τα βιολογικά πολυμερή που αποτελούν

Διαβάστε περισσότερα

1.1. Να γράψετε στο τετράδιό σας το γράµµα που αντιστοιχεί στη σωστή απάντηση:

1.1. Να γράψετε στο τετράδιό σας το γράµµα που αντιστοιχεί στη σωστή απάντηση: ΘΕΜΑ 1o 1.1. Να γράψετε στο τετράδιό σας το γράµµα που αντιστοιχεί στη σωστή απάντηση: Η σταθερά Κ w στους 5 ο C έχει τιµή 10-14 : α. µόνο στο καθαρό νερό β. σε οποιοδήποτε υδατικό διάλυµα γ. µόνο σε υδατικά

Διαβάστε περισσότερα

ÈÅÌÁÔÁ 2011 ÏÅÖÅ Γ' ΛΥΚΕΙΟΥ ΤΕΧΝΟΛΟΓΙΚΗ ΚΑΤΕΥΘΥΝΣΗ ΧΗΜΕΙΑ ΒΙΟΧΗΜΕΙΑ ΑΠΑΝΤΗΣΕΙΣ. ΘΕΜΑ 1 ο. ΘΕΜΑ 2 ο δ δ α. Λ β. Λ γ. Σ δ. Λ ε.

ÈÅÌÁÔÁ 2011 ÏÅÖÅ Γ' ΛΥΚΕΙΟΥ ΤΕΧΝΟΛΟΓΙΚΗ ΚΑΤΕΥΘΥΝΣΗ ΧΗΜΕΙΑ ΒΙΟΧΗΜΕΙΑ ΑΠΑΝΤΗΣΕΙΣ. ΘΕΜΑ 1 ο. ΘΕΜΑ 2 ο δ δ α. Λ β. Λ γ. Σ δ. Λ ε. 1 Γ' ΛΥΚΕΙΟΥ ΤΕΧΝΟΛΟΓΙΚΗ ΚΑΤΕΥΘΥΝΣΗ ΧΗΜΕΙΑ ΒΙΟΧΗΜΕΙΑ ΘΕΜΑ 1 ο 1.1. δ 1.. δ 1.. α. Λ β. Λ γ. Σ δ. Λ ε. Σ ΑΠΑΝΤΗΣΕΙΣ 1.. CH C CH CuCl NH CH C CCu NH Cl CH CH MgCl H O CH CH Mg(OH)Cl 1.5. A: CH OH B: CH Cl

Διαβάστε περισσότερα

ΕΝΘΕΤΟ. Έννοιες που εξετάζονται από άλλες φυσικές επιστήμες

ΕΝΘΕΤΟ. Έννοιες που εξετάζονται από άλλες φυσικές επιστήμες ΕΝΘΕΤΟ Έννοιες που εξετάζονται από άλλες φυσικές επιστήμες ΟΜΟΙΟΠΟΛΙΚΟΙ ΔΕΣΜΟΣ - ΔΕΣΜΟΣ ΥΔΡΟΓΟΝΟΥ Ο σχηματισμός του μορίου του νερού (Η20) μπορεί να εξηγηθεί με βάση την ηλεκτρονιακή του δομή. Καθένα από

Διαβάστε περισσότερα

ΙΑΤΡΙΚΗ ΠΑΝΕΠΙΣΤΗΜΙΟΥ ΑΘΗΝΩΝ (ΕΚΠΑ) ΚΑΤΑΤΑΚΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ ΑΚ.ΕΤΟΥΣ ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΧΗΜΕΙΑ

ΙΑΤΡΙΚΗ ΠΑΝΕΠΙΣΤΗΜΙΟΥ ΑΘΗΝΩΝ (ΕΚΠΑ) ΚΑΤΑΤΑΚΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ ΑΚ.ΕΤΟΥΣ ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΧΗΜΕΙΑ ΙΑΤΡΙΚΗ ΠΑΝΕΠΙΣΤΗΜΙΟΥ ΑΘΗΝΩΝ (ΕΚΠΑ) ΚΑΤΑΤΑΚΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ ΑΚ.ΕΤΟΥΣ 2015-2016 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΧΗΜΕΙΑ 1)Πώς το φαινόμενο Bohr επηρεάζει την πρόσδεση οξυγόνου στην αιμοσφαιρίνη; Που συνδέονται τα ιόντα

Διαβάστε περισσότερα

Ηλίας Ηλιόπουλος Εργαστήριο Γενετικής, Τμήμα Βιοτεχνολογίας, Γεωπονικό Πανεπιστήμιο Αθηνών

Ηλίας Ηλιόπουλος Εργαστήριο Γενετικής, Τμήμα Βιοτεχνολογίας, Γεωπονικό Πανεπιστήμιο Αθηνών Το δίπλωμα των πρωτεϊνών Ηλίας Ηλιόπουλος Εργαστήριο Γενετικής, Τμήμα Βιοτεχνολογίας, Γεωπονικό Πανεπιστήμιο Αθηνών Εισαγωγή Η πλειονότητα των πρωτεϊνών διπλώνει σε μία μοναδική τρισδιάστατη δομή βιολογικά

Διαβάστε περισσότερα

Εξερευνώντας την Εξέλιξη Κεφάλαιο 7

Εξερευνώντας την Εξέλιξη Κεφάλαιο 7 Εξερευνώντας την Εξέλιξη Κεφάλαιο 7 Εξερευνώντας την Εξέλιξη Σχέση μεταξύ αλληλουχίας αμινοξέων, δομής και λειτουργίας πρωτεϊνών Καταγωγή από έναν κοινό πρόγονο Εξελικτική Συγγένεια/Προέλευση Δύο ομάδες

Διαβάστε περισσότερα

Η ΧΗΜΕΙΑ ΤΗΣ ΖΩΗΣ. Καρβουντζή Ηλιάνα Βιολόγος

Η ΧΗΜΕΙΑ ΤΗΣ ΖΩΗΣ. Καρβουντζή Ηλιάνα Βιολόγος Η ΧΗΜΕΙΑ ΤΗΣ ΖΩΗΣ Χημικά στοιχεία που συνθέτουν τους οργανισμούς Ο C, το H 2, το O 2 και το N 2 είναι τα επικρατέστερα στους οργανισμούς σε ποσοστό 96% κ.β. Γιατί; Συμμετέχουν σε σημαντικό βαθμό στη σύνθεση

Διαβάστε περισσότερα

Ασκήσεις 3& 4. Πρωτεϊνική Αρχιτεκτονική. Πλατφόρμες Πρόβλεψης & Προσομοίωσης 2ταγούς Δομής. Μοριακή Απεικόνιση

Ασκήσεις 3& 4. Πρωτεϊνική Αρχιτεκτονική. Πλατφόρμες Πρόβλεψης & Προσομοίωσης 2ταγούς Δομής. Μοριακή Απεικόνιση Ασκήσεις 3& 4 Πρωτεϊνική Αρχιτεκτονική Πλατφόρμες Πρόβλεψης & Προσομοίωσης 2ταγούς Δομής Μοριακή Απεικόνιση Πρωτεϊνική Αρχιτεκτονική Πρωτεϊνική Αρχιτεκτονική: Η τρισδιάστατη δομή μιας πρωτεΐνης και πως

Διαβάστε περισσότερα

Δρ. Ιωάννης Καλαμαράς, Διδάκτωρ Χημικός. Όλα τα Θέματα της Τράπεζας στη Χημεία που σχετίζονται με το Χημικό Δεσμό

Δρ. Ιωάννης Καλαμαράς, Διδάκτωρ Χημικός. Όλα τα Θέματα της Τράπεζας στη Χημεία που σχετίζονται με το Χημικό Δεσμό Όλα τα Θέματα της Τράπεζας στη Χημεία που σχετίζονται με το Χημικό Δεσμό Θέμα 1. Να αναφέρετε δυο διαφορές μεταξύ ομοιοπολικών και ιοντικών ενώσεων. Στις ιοντικές ενώσεις οι δομικές μονάδες είναι τα ιόντα,

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ. Παραδόσεις του μαθήματος γενικής παιδείας (Β λυκείου) Επιμέλεια: ΑΡΓΥΡΗΣ ΙΩΑΝΝΗΣ Βιολόγος M.Sc. Καθηγητής 3 ου λυκ.

ΒΙΟΛΟΓΙΑ. Παραδόσεις του μαθήματος γενικής παιδείας (Β λυκείου) Επιμέλεια: ΑΡΓΥΡΗΣ ΙΩΑΝΝΗΣ Βιολόγος M.Sc. Καθηγητής 3 ου λυκ. ΒΙΟΛΟΓΙΑ Παραδόσεις του μαθήματος γενικής παιδείας (Β λυκείου) Επιμέλεια: ΑΡΓΥΡΗΣ ΙΩΑΝΝΗΣ Βιολόγος M.Sc. Καθηγητής 3 ου λυκ. Ηλιούπολης Κεφάλαιο 1ο ΒΙΟΛΟΓΙΚΑ ΜΑΚΡΟΜΟΡΙΑ Η ΙΕΡΑΡΧΙΑ ΤΩΝ ΒΙΟΜΟΡΙΩΝ ΠΡΟΔΡΟΜΕΣ

Διαβάστε περισσότερα

ΕΡΓΑΣΤΗΡΙΑΚΟ ΚΕΝΤΡΟ ΦΥΣΙΚΩΝ ΕΠΙΣΤΗΜΩΝ Ν. ΜΑΓΝΗΣΙΑΣ ( Ε.Κ.Φ.Ε ) ΕΡΓΑΣΤΗΡΙΟ ΒΙΟΛΟΓΙΑΣ

ΕΡΓΑΣΤΗΡΙΑΚΟ ΚΕΝΤΡΟ ΦΥΣΙΚΩΝ ΕΠΙΣΤΗΜΩΝ Ν. ΜΑΓΝΗΣΙΑΣ ( Ε.Κ.Φ.Ε ) ΕΡΓΑΣΤΗΡΙΟ ΒΙΟΛΟΓΙΑΣ ΕΡΓΑΣΤΗΡΙΑΚΟ ΚΕΝΤΡΟ ΦΥΣΙΚΩΝ ΕΠΙΣΤΗΜΩΝ Ν. ΜΑΓΝΗΣΙΑΣ ( Ε.Κ.Φ.Ε ) ΕΡΓΑΣΤΗΡΙΟ ΒΙΟΛΟΓΙΑΣ Θέμα: ΜΕΤΟΥΣΙΩΣΗ ΠΡΩΤΕΪΝΩΝ (άσκηση 7 του εργαστηριακού οδηγού) Μέσος χρόνος πειράματος: 45 λεπτά Α. ΑΝΑΛΩΣΙΜΑ Εργαλεία

Διαβάστε περισσότερα

ΘΕΜΑ 1 ο 1.1. Να γράψετε στο τετράδιό σας το γράμμα που αντιστοιχεί στη σωστή απάντηση:

ΘΕΜΑ 1 ο 1.1. Να γράψετε στο τετράδιό σας το γράμμα που αντιστοιχεί στη σωστή απάντηση: ΑΡΧΗ 1ΗΣ ΣΕΛΙΔΑΣ Γ ΤΑΞΗ ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΕΝΙΑΙΟΥ ΛΥΚΕΙΟΥ ΤΡΙΤΗ 5 ΙΟΥΝΙΟΥ 2001 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΤΕΧΝΟΛΟΓΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ (ΚΥΚΛΟΣ ΤΕΧΝΟΛΟΓΙΑΣ ΚΑΙ ΠΑΡΑΓΩΓΗΣ): ΧΗΜΕΙΑ - ΒΙΟΧΗΜΕΙΑ ΣΥΝΟΛΟ ΣΕΛΙΔΩΝ:

Διαβάστε περισσότερα

Ερωτησεις στη Βιοφυσική & Νανοτεχνολογία. Χειμερινό Εξάμηνο 2012

Ερωτησεις στη Βιοφυσική & Νανοτεχνολογία. Χειμερινό Εξάμηνο 2012 Ερωτησεις στη Βιοφυσική & Νανοτεχνολογία. Χειμερινό Εξάμηνο 2012 1) Ποιο φυσικό φαινόμενο βοηθάει στην αυτοσυναρμολόγηση μοριακών συστημάτων? α) Η τοποθέτηση μοριων με χρήση μικροσκοπίου σάρωσης δείγματος

Διαβάστε περισσότερα

Το ένζυμο Καρβοξυπεπτιδάση Α έχει τα εξής χαρακτηριστικά

Το ένζυμο Καρβοξυπεπτιδάση Α έχει τα εξής χαρακτηριστικά Το ένζυμο Καρβοξυπεπτιδάση Α έχει τα εξής χαρακτηριστικά Είναι απλή πολυπεπτιδική αλυσίδα 307 αμινοξέων Είναι συμπαγής και έχει σχήμα ελλειψοειδές διαστάσεων 50 x 42 x 38 A Περιέχει περιοχές α-έλικος 38%

Διαβάστε περισσότερα

ΟΡΓΑΝΙΚΗ ΧΗΜΕΙΑ ΚΑΙ ΒΙΟΧΗΜΕΙΑ ΠΙΝΑΚΑΣ ΚΑΤΑΝΟΜΗΣ ΛΙΛΑΚΤΙΚΩΝ ΩΡΩΝ

ΟΡΓΑΝΙΚΗ ΧΗΜΕΙΑ ΚΑΙ ΒΙΟΧΗΜΕΙΑ ΠΙΝΑΚΑΣ ΚΑΤΑΝΟΜΗΣ ΛΙΛΑΚΤΙΚΩΝ ΩΡΩΝ ΚΕΦΑΛΑΙΟ 1 ΟΡΓΑΝΙΚΗ ΧΗΜΕΙΑ ΚΑΙ ΒΙΟΧΗΜΕΙΑ ΠΙΝΑΚΑΣ ΚΑΤΑΝΟΜΗΣ ΛΙΛΑΚΤΙΚΩΝ ΩΡΩΝ ΔΙΔΑΚΤΙΚΗ ΕΝΟΤΗΤΑ Οργανική Χημεία και Βιοχημεία ΩΡΕΣ ΑΙΑΑΚΤΙΚΟΙ ΣΤΟΧΟΙ Στο τέλος της διδασκαλίας της ενότητας αυτής ο μαθητής

Διαβάστε περισσότερα

ΤΕΧΝΟΛΟΓΙΑ & ΕΠΙΣΤΗΜΗ ΤΩΝ ΥΛΙΚΩΝ

ΤΕΧΝΟΛΟΓΙΑ & ΕΠΙΣΤΗΜΗ ΤΩΝ ΥΛΙΚΩΝ Τμήμα Τεχνολόγων Περιβάλλοντος Κατεύθυνσης Συντήρησης Πολιτισμικής Κληρονομιάς ΤΕΧΝΟΛΟΓΙΑ & ΕΠΙΣΤΗΜΗ ΤΩΝ ΥΛΙΚΩΝ 3 η Ενότητα ΔΕΣΜΟΙ Δημήτριος Λαμπάκης ΜΟΡΙΑΚΗ ΔΟΜΗ Μεμονωμένα άτομα: Μόνο τα ευγενή αέρια

Διαβάστε περισσότερα

Επίδραση και άλλων παραγόντων στην Αλλοστερική συμπεριφορά της Αιμοσφαιρίνης

Επίδραση και άλλων παραγόντων στην Αλλοστερική συμπεριφορά της Αιμοσφαιρίνης Επίδραση και άλλων παραγόντων στην Αλλοστερική συμπεριφορά της Αιμοσφαιρίνης Καθώς το οξυγόνο χρησιμοποιείται στους ιστούς παράγεται CO2 το οποίο πρέπει να μεταφερθεί πίσω στους πνεύμονες ή τα βράγχια

Διαβάστε περισσότερα

Κυκλικός διχρωισµός, Circular Dichroism (CD)

Κυκλικός διχρωισµός, Circular Dichroism (CD) Κυκλικός διχρωισµός, Circular Dichroism (CD) Κυκλικός διχρωισµός Προβλήµατα που µπορούν να διερευνηθούν µε CD: Στοιχεία δευτεροταγούς δοµής. Αλλαγές στη διαµόρφωση πρωτεϊνών που οφείλονται σε µεταβολές

Διαβάστε περισσότερα

Χηµεία-Βιοχηµεία Τεχνολογικής Κατεύθυνσης Γ Λυκείου 2001

Χηµεία-Βιοχηµεία Τεχνολογικής Κατεύθυνσης Γ Λυκείου 2001 Χηµεία-Βιοχηµεία Τεχνολογικής Κατεύθυνσης Γ Λυκείου 2001 ΕΚΦΩΝΗΣΕΙΣ Ζήτηµα 1ο 1. Να γράψετε στο τετράδιό σας το γράµµα που αντιστοιχεί στη σωστή απάντηση: Η σταθερά Κ w στους 25 ο C έχει τιµή 10-14 : α.

Διαβάστε περισσότερα

Καταστάσεις της ύλης. Αέρια: Παντελής απουσία τάξεως. Τα µόρια βρίσκονται σε συνεχή τυχαία κίνηση σε σχεδόν κενό χώρο.

Καταστάσεις της ύλης. Αέρια: Παντελής απουσία τάξεως. Τα µόρια βρίσκονται σε συνεχή τυχαία κίνηση σε σχεδόν κενό χώρο. Καταστάσεις της ύλης Αέρια: Παντελής απουσία τάξεως. Τα µόρια βρίσκονται σε συνεχή τυχαία κίνηση σε σχεδόν κενό χώρο. Υγρά: Τάξη πολύ µικρού βαθµού και κλίµακας-ελκτικές δυνάµεις-ολίσθηση. Τα µόρια βρίσκονται

Διαβάστε περισσότερα

Θεµατικό Περιεχόµενο Μαθήµατος

Θεµατικό Περιεχόµενο Μαθήµατος Θεµατικό Περιεχόµενο Μαθήµατος 1. Κρυσταλικές δοµές Ιονική ακτίνα Ενέργεια πλέγµατος Πυκνές διατάξεις 4εδρικές 8εδρικές οπές Μέταλλα ιοντικά στερεά Πώς περιγράφεται η δοµή τους Πως προσδιορίζεται η δοµή

Διαβάστε περισσότερα

Αρχές οµικής Βιοπληροφορικής. Πρωτεΐνες. Αµινοξέα. (Υδρόφοβα)

Αρχές οµικής Βιοπληροφορικής. Πρωτεΐνες. Αµινοξέα. (Υδρόφοβα) Αρχές οµικής Βιοπληροφορικής Πρωτεΐνες Αµινοξέα (Υδρόφοβα) Αµινοξέα Αµινοξέα (πολικά) Αµινοξέα φορτισµένα πολικά Αµινοξέα (φορτισµένα) Αµινοξέα Αµινοξέα Αµινοξέα Τί µένει; Σπάνια αµινοξέα πρωτεϊνών (π.χ.

Διαβάστε περισσότερα

ΔΙΑΚΡΙΣΗ ΣΤΟΙΧΕΙΩΝ ΜΑΚΡΟΘΡΕΠΤΙΚΑ (C, H, N, O) 96% ΜΙΚΡΟΘΡΕΠΤΙΚΑ (πχ. Na, K, P, Ca, Mg) 4% ΙΧΝΟΣΤΟΙΧΕΙΑ (Fe, I) 0,01%

ΔΙΑΚΡΙΣΗ ΣΤΟΙΧΕΙΩΝ ΜΑΚΡΟΘΡΕΠΤΙΚΑ (C, H, N, O) 96% ΜΙΚΡΟΘΡΕΠΤΙΚΑ (πχ. Na, K, P, Ca, Mg) 4% ΙΧΝΟΣΤΟΙΧΕΙΑ (Fe, I) 0,01% ΔΙΑΚΡΙΣΗ ΣΤΟΙΧΕΙΩΝ ΜΑΚΡΟΘΡΕΠΤΙΚΑ (C, H, N, O) 96% ΜΙΚΡΟΘΡΕΠΤΙΚΑ (πχ. Na, K, P, Ca, Mg) 4% ΙΧΝΟΣΤΟΙΧΕΙΑ (Fe, I) 0,01% Ο άνθρακας, το υδρογόνο, το οξυγόνο και το άζωτο συμμετέχουν, σε σημαντικό βαθμό, στη

Διαβάστε περισσότερα

ΔΟΜΗ ΠΡΩΤΕΪΝΩΝ II. Σελίδα 1 ΒΙΟΠΛΗΡΟΦΟΡΙΚΗ. Τ. Θηραίου

ΔΟΜΗ ΠΡΩΤΕΪΝΩΝ II. Σελίδα 1 ΒΙΟΠΛΗΡΟΦΟΡΙΚΗ. Τ. Θηραίου ΔΟΜΗ ΠΡΩΤΕΪΝΩΝ II Σελίδα 1 Υπολογιστικός Προσδιορισμός Δομής πειραματικός προσδιορισμός δομών κρυσταλλογραφία ακτίνων X πυρηνικός μαγνητικός συντονισμός (NMR) χρόνος / κόστος / περιορισμοί sequence - structure

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ Β ΛΥΚΕΙΟΥ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ

ΒΙΟΛΟΓΙΑ Β ΛΥΚΕΙΟΥ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ ΕΚΠΑΙΔΕΥΤΗΡΙΑ ΣΥΓΧΡΟΝΗ ΠΑΙΔΕΙΑ ΒΙΟΛΟΓΙΑ Β ΛΥΚΕΙΟΥ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ ΕΠΙΜΕΛΕΙΑ:Ν.ΠΑΠΑΓΙΑΝΝΗΣ 2 Η ΧΗΜΕΙΑ ΤΗΣ ΖΩΗΣ 3 1. Ποια είναι τα επίπεδα οργάνωσης της ζωής και ποια τα χημικά χαρακτηριστικά της; Στην

Διαβάστε περισσότερα

Χηµεία-Βιοχηµεία Τεχνολογικής Κατεύθυνσης Γ Λυκείου 2001

Χηµεία-Βιοχηµεία Τεχνολογικής Κατεύθυνσης Γ Λυκείου 2001 Ζήτηµα 1ο Χηµεία-Βιοχηµεία Τεχνολογικής Κατεύθυνσης Γ Λυκείου 2001 1. Να γράψετε στο τετράδιό σας το γράµµα που αντιστοιχεί στη σωστή απάντηση: Η σταθερά Κ w στους 25 ο C έχει τιµή 10-14 : α. µόνο στο

Διαβάστε περισσότερα

6. ιαμοριακές δυνάμεις

6. ιαμοριακές δυνάμεις 6. ιαμοριακές δυνάμεις ΣΚΟΠΟΣ Σκοπός αυτού του κεφαλαίου είναι να γνωρίσουμε τα είδη των ελκτικών δυνάμεων που αναπτύσσονται μεταξύ των μορίων των ομοιοπολικών ενώσεων και την επίδραση που ασκούν οι δυνάμεις

Διαβάστε περισσότερα

Βιολογικές Μεμβράνες και Μεταγωγή Σήματος

Βιολογικές Μεμβράνες και Μεταγωγή Σήματος ΠΑΝΕΠΙΣΤΗΜΙΟ ΙΩΑΝΝΙΝΩΝ ΑΝΟΙΚΤΑ ΑΚΑΔΗΜΑΪΚΑ ΜΑΘΗΜΑΤΑ Βιολογικές Μεμβράνες και Μεταγωγή Σήματος Πολυμορφισμός Διδάσκουσα: Καθ. Μαρία - Ελένη Ε. Λέκκα Άδειες Χρήσης Το παρόν εκπαιδευτικό υλικό υπόκειται σε

Διαβάστε περισσότερα

ΦΥΛΛΟ ΕΡΓΑΣΙΑΣ ΣΤΗ ΒΙΟΛΟΓΙΑ Γ ΛΥΚΕΙΟΥ

ΦΥΛΛΟ ΕΡΓΑΣΙΑΣ ΣΤΗ ΒΙΟΛΟΓΙΑ Γ ΛΥΚΕΙΟΥ ΦΥΛΛΟ ΕΡΓΑΣΙΑΣ ΣΤΗ ΒΙΟΛΟΓΙΑ Γ ΛΥΚΕΙΟΥ ΕΝΟΤΗΤΑ: ΕΝΖΥΜΑ ΚΑΘΗΓΗΤΗΣ: ΠΑΤΗΡ ΑΝΑΣΤΑΣΙΟΣ ΙΣΑΑΚ 1. Να εξηγήσετε γιατί πολλές βιταμίνες, παρά τη μικρή συγκέντρωσή τους στον οργανισμό, είναι πολύ σημαντικές για

Διαβάστε περισσότερα

(Από το βιβλίο Γενική Χημεία των Ebbing, D. D., Gammon, S. D., Εκδόσεις Παπασωτηρίου )

(Από το βιβλίο Γενική Χημεία των Ebbing, D. D., Gammon, S. D., Εκδόσεις Παπασωτηρίου ) Δυνάμεις διπόλου διπόλου (Από το βιβλίο Γενική Χημεία των Ebbing, D. D., Gammon, S. D., Εκδόσεις Παπασωτηρίου ) Τα πολικά μόρια μπορούν να έλκονται αμοιβαία μέσω δυνάμεων διπόλου διπόλου. Η δύναμη διπόλου

Διαβάστε περισσότερα

οµή και λειτουργία των µεγάλων βιολογικών µορίων

οµή και λειτουργία των µεγάλων βιολογικών µορίων οµή και λειτουργία των µεγάλων βιολογικών µορίων οµή και λειτουργία των µεγάλων βιολογικών µορίων κατηγορίες υδατάνθρακες πρωτεΐνες νουκλεϊνικά οξέα λιπίδια Οι πρωτεΐνες, υδατάνθρακες, νουκλεϊνικά οξέα

Διαβάστε περισσότερα

Υλικά Ηλεκτρονικής & Διατάξεις

Υλικά Ηλεκτρονικής & Διατάξεις Τμήμα Ηλεκτρονικών Μηχανικών Υλικά Ηλεκτρονικής & Διατάξεις 2 η σειρά διαφανειών Δημήτριος Λαμπάκης ΜΟΡΙΑΚΗ ΔΟΜΗ Μεμονωμένα άτομα: Μόνο τα ευγενή αέρια Μόρια: Τα υπόλοιπα άτομα σχηματίζουν μόρια, γιατί

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ Β ΛΥΚΕΙΟΥ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ

ΒΙΟΛΟΓΙΑ Β ΛΥΚΕΙΟΥ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ Α. Εισαγωγικές έννοιες ΜΕΣΑ ΣΤΑ ΚΥΤΤΑΡΑ Μπορούμε να διακρίνουμε δύο περιβάλλοντα ΥΔΡΟΦΙΛΟ υδατικό κυτταρόπλασμα ΥΔΡΟΦΟΒΟ λιπιδικο-μεμβρανικό Δηλαδή τα μόρια χαρακτηρίζονται έτσι λόγω της υδρόφοβης φύσης

Διαβάστε περισσότερα

3 ο Κ Ε Φ Α Λ Α Ι Ο ΠΡΩΤΕΪΝΕΣ Α. ΕΡΩΤΗΣΕΙΣ ΚΛΕΙΣΤΟΥ ΤΥΠΟΥ

3 ο Κ Ε Φ Α Λ Α Ι Ο ΠΡΩΤΕΪΝΕΣ Α. ΕΡΩΤΗΣΕΙΣ ΚΛΕΙΣΤΟΥ ΤΥΠΟΥ 3 ο Κ Ε Φ Α Λ Α Ι Ο ΠΡΩΤΕΪΝΕΣ Α. ΕΡΩΤΗΣΕΙΣ ΚΛΕΙΣΤΟΥ ΤΥΠΟΥ Ερωτήσεις πολλαπλής επιλογής Να βάλετε σε κύκλο το γράµµα που αντιστοιχεί στη σωστή απάντηση ή στη φράση που συµπληρώνει σωστά την πρόταση. 1.

Διαβάστε περισσότερα

Χημική σύσταση του κυττάρου

Χημική σύσταση του κυττάρου 1 Χημική σύσταση του κυττάρου Τα χημικά στοιχεία, που συμμετέχουν στη δομή των βιολογικών μορίων, συγκαταλέγονται στα στοιχεία που συνθέτουν τον φλοιό της γης. Όλοι οι οργανισμοί από τον πιο απλό μέχρι

Διαβάστε περισσότερα

ΑΠΑΝΤΗΣΕΙΣ ΤΩΝ ΕΡΩΤΗΣΕΩΝ.-ΑΣΚΗΣΕΩΝ ΚΑΙ ΠΡΟΒΛΗΜΑΤΩΝ ΤΟΥ ΒΙΒΛΙΟΥ ΤΟΥ ΜΑΘΗΤΗ

ΑΠΑΝΤΗΣΕΙΣ ΤΩΝ ΕΡΩΤΗΣΕΩΝ.-ΑΣΚΗΣΕΩΝ ΚΑΙ ΠΡΟΒΛΗΜΑΤΩΝ ΤΟΥ ΒΙΒΛΙΟΥ ΤΟΥ ΜΑΘΗΤΗ ΑΠΑΝΤΗΣΕΙΣ ΤΩΝ ΕΡΩΤΗΣΕΩΝ.-ΑΣΚΗΣΕΩΝ ΚΑΙ ΠΡΟΒΛΗΜΑΤΩΝ ΤΟΥ ΒΙΒΛΙΟΥ ΤΟΥ ΜΑΘΗΤΗ 1. Τοποθετείστε στο διάγραμμα που ακολουθεί, τους όρους: σύνθεση, υδρόλυση, μακρομόριο, μονομερή. Ερμηνεύστε το διάγραμμα. Η -Q-

Διαβάστε περισσότερα

BIO111 Μικροβιολογια ιαλεξη 3. Κυτταρικη Χηµεια

BIO111 Μικροβιολογια ιαλεξη 3. Κυτταρικη Χηµεια BIO111 Μικροβιολογια ιαλεξη 3 Κυτταρικη Χηµεια Mικροβιολογία = Bιολογία των µονοκύτταρων οργανισµών και των ιών H µεγάλη σας φίλη Το βακτηριο E.coli 1.000.000X C Γλυκόζη trna αντισωµα ριβοσωµα ATP DNA

Διαβάστε περισσότερα

2.1 Ηλεκτρονική δοµή των ατόµων

2.1 Ηλεκτρονική δοµή των ατόµων ΕΡΩΤΗΣΕΙΣ ΑΠΑΝΤΗΣΕΙΣ ΑΠΟ ΤΗΝ ΕΞΕΤΑΣΤΕΑ ΥΛΗ ΤΟΥ 2ου ΚΕΦΑΛΑΙΟΥ 2.1 Ηλεκτρονική δοµή των ατόµων ΕΡΩΤΗΣΗ 1 : Πως περιέγραψε ο Bohr την δοµή του ατόµου; ΑΠΑΝΤΗΣΗ : Ο Bohr φαντάστηκε το άτοµο σαν ένα µικροσκοπικό

Διαβάστε περισσότερα

ΑΠΑΝΤΗΣΕΙΣ. ΘΕΜΑ Α Α1. β Α2. γ Α3. δ Α4. γ Α5. β

ΑΠΑΝΤΗΣΕΙΣ. ΘΕΜΑ Α Α1. β Α2. γ Α3. δ Α4. γ Α5. β ΘΕΜΑ Α Α1. β Α2. γ Α3. δ Α4. γ Α5. β 1 ΕΙΣΑΓΩΓΙΚΕΣ ΕΞΕΤΑΣΕΙΣ ΤΕΚΝΩΝ ΕΛΛΗΝΩΝ ΤΟΥ ΕΞΩΤΕΡΙΚΟΥ ΚΑΙ ΤΕΚΝΩΝ ΕΛΛΗΝΩΝ ΥΠΑΛΛΗΛΩΝ ΣΤΟ ΕΞΩΤΕΡΙΚΟ ΤΕΤΑΡΤΗ 10 ΣΕΠΤΕΜΒΡΙΟΥ 2014 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ:

Διαβάστε περισσότερα

Τύποι νουκλεϊκών οξέων

Τύποι νουκλεϊκών οξέων Τύποι νουκλεϊκών οξέων DNA ένας τύπος, μια λειτουργία RNA - 4 τύποι, 4 λειτουργίες Ριβοσωμικό RNA Αγγελιαφόρο RNA Μεταφορικό RNA Καταλυτικό RNA Βιοχημεία Ι Δ-1 Βιοχημεία Ι Δ-2 3 5 φωσφοδιεστερικός δεσμός

Διαβάστε περισσότερα

ΜΑΘΗΜΑ / ΤΑΞΗ : ΧΗΜΕΙΑ - ΒΙΟΧΗΜΕΙΑ / Γ ΛΥΚΕΙΟΥ ΣΕΙΡΑ: 1 ΗΜΕΡΟΜΗΝΙΑ: 21 / 09 /2014

ΜΑΘΗΜΑ / ΤΑΞΗ : ΧΗΜΕΙΑ - ΒΙΟΧΗΜΕΙΑ / Γ ΛΥΚΕΙΟΥ ΣΕΙΡΑ: 1 ΗΜΕΡΟΜΗΝΙΑ: 21 / 09 /2014 ΜΑΘΗΜΑ / ΤΑΞΗ : ΧΗΜΕΙΑ - ΒΙΟΧΗΜΕΙΑ / Γ ΛΥΚΕΙΟΥ ΣΕΙΡΑ: 1 ΗΜΕΡΟΜΗΝΙΑ: 21 / 09 /2014 ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ Α Για τις ερωτήσεις Α1 έως και Α3 να γράψετε στο τετράδιό σας τον αριθμό της ερώτησης και δίπλα το γράμμα

Διαβάστε περισσότερα

Κεφάλαια 8 ο Ένζυμα και κατάλυση

Κεφάλαια 8 ο Ένζυμα και κατάλυση Κεφάλαια 8 ο Ένζυμα και κατάλυση Τα ένζυμα είναι βιομόρια που μεσολαβούν στους χημικούς μετασχηματισμούς και στη μετατροπή της ενέργειας Κύρια χαρακτηριστικά τους η ισχύς και η εξειδίκευση Πλέον θα τα

Διαβάστε περισσότερα

Κεφάλαιο 22 Πρωτεΐνες

Κεφάλαιο 22 Πρωτεΐνες Κεφάλαιο 22 Πρωτεΐνες Σύνοψη Οι πρωτεΐνες είναι μακρομόρια που προκύπτουν από την ένωση α-αμινοξέων. Τα α-αμινοξέα είναι οργανικές ενώσεις που έχουν μία αμινομάδα (ΝΗ 2 ) και καρβοξύλιο (COOH) συνδεδεμένα

Διαβάστε περισσότερα

ιαγώνισµα Β Τάξης Ενιαίου Λυκείου Κυριακή 5 Απρίλη 2015 Φως - Ατοµικά Φαινόµενα - Ακτίνες Χ

ιαγώνισµα Β Τάξης Ενιαίου Λυκείου Κυριακή 5 Απρίλη 2015 Φως - Ατοµικά Φαινόµενα - Ακτίνες Χ ιαγώνισµα Β Τάξης Ενιαίου Λυκείου Κυριακή 5 Απρίλη 2015 Φως - Ατοµικά Φαινόµενα - Ακτίνες Χ Σύνολο Σελίδων: έξι (6) - ιάρκεια Εξέτασης: 3 ώρες Βαθµολογία % Ονοµατεπώνυµο: Θέµα Α Στις ηµιτελείς προτάσεις

Διαβάστε περισσότερα

Χαρακτηριστικά της δομής της Μυοσφαιρίνης

Χαρακτηριστικά της δομής της Μυοσφαιρίνης Χαρακτηριστικά της δομής της Μυοσφαιρίνης Η μυοσφαιρίνη είναι ενα εξαιρετικά συμπαγές μόριο.οι διαστάσεις είναι 45Χ35Χ25 Α και υπαρχει πολύ λίγος αδειος χώρος στο εσωτερικό τού μορίου Γυρω στα 75% της

Διαβάστε περισσότερα

Μεταγωγή σήματος και βιολογικές μεμβράνες

Μεταγωγή σήματος και βιολογικές μεμβράνες Μεταγωγή σήματος και βιολογικές μεμβράνες ΜΕΜΒΡΑΝΙΚΕΣ ΠΡΩΤΕΪΝΕΣ ΠΡΩΤΕΪΝΕΣ ΒΙΟΛΟΓΙΚΩΝ ΜΕΜΒΡΑΝΩΝ Ορισμός / Μονάδες Δομές (πρωτοταγής κλπ) Ταξινόμηση με βάση τις λειτουργίες Απεικόνιση - Μοντέλα (συρμάτων

Διαβάστε περισσότερα

ΚΕΦΑΛΑΙΟ 2 Ο H XHΜΕΙΑ ΤΗΣ ΖΩΗΣ. Χημεία της ζωής 1

ΚΕΦΑΛΑΙΟ 2 Ο H XHΜΕΙΑ ΤΗΣ ΖΩΗΣ. Χημεία της ζωής 1 ΚΕΦΑΛΑΙΟ 2 Ο H XHΜΕΙΑ ΤΗΣ ΖΩΗΣ Χημεία της ζωής 1 2.1 ΒΑΣΙΚΕΣ ΧΗΜΙΚΕΣ ΕΝΝΟΙΕΣ Η Βιολογία μπορεί να μελετηθεί μέσα από πολλά και διαφορετικά επίπεδα. Οι βιοχημικοί, για παράδειγμα, ενδιαφέρονται περισσότερο

Διαβάστε περισσότερα

ΥΛΙΚΑ ΠΑΡΟΝ ΚΑΙ ΜΕΛΛΟΝ

ΥΛΙΚΑ ΠΑΡΟΝ ΚΑΙ ΜΕΛΛΟΝ ΥΛΙΚΑ ΠΑΡΟΝ ΚΑΙ ΜΕΛΛΟΝ Ι 4 Δεσμοί ΠΑΝΕΠΙΣΤΗΜΙΟ ΚΡΗΤΗΣ ΤΜΗΜΑ ΕΠΙΣΤΗΜΗΣ ΚΑΙ ΤΕΧΝΟΛΟΓΙΑΣ ΥΛΙΚΩΝ μεταξύ ατόμων γίνονται με τα ηλεκτρόνια σθένους κατά τέτοιο τρόπο ώστε να ελαττώνεται η συνολική ενέργεια του

Διαβάστε περισσότερα

Διάλεξη 7: Μοριακή Δομή

Διάλεξη 7: Μοριακή Δομή Μεμονωμένα άτομα: Μόνο τα ευγενή αέρια Μόρια: Τα υπόλοιπα άτομα σχηματίζουν μόρια Γιατί; Διότι η ολική ενέργεια ενός ευσταθούς μορίου είναι μικρότερη από την ολική ενέργεια των μεμονωμένων ατόμων που αποτελούν

Διαβάστε περισσότερα

ΠΥΡΗΝΙΚΟΣ ΜΑΓΝΗΤΙΚΟΣ ΣΥΝΤΟΝΙΣΜΟΣ ΚΑΙ ΔΟΜΗ ΤΟΥ ΑΤΟΜΟΥ. Του Αλέκου Χαραλαμπόπουλου ΕΙΣΑΓΩΓΗ

ΠΥΡΗΝΙΚΟΣ ΜΑΓΝΗΤΙΚΟΣ ΣΥΝΤΟΝΙΣΜΟΣ ΚΑΙ ΔΟΜΗ ΤΟΥ ΑΤΟΜΟΥ. Του Αλέκου Χαραλαμπόπουλου ΕΙΣΑΓΩΓΗ ΠΥΡΗΝΙΚΟΣ ΜΑΓΝΗΤΙΚΟΣ ΣΥΝΤΟΝΙΣΜΟΣ ΚΑΙ ΔΟΜΗ ΤΟΥ ΑΤΟΜΟΥ Του Αλέκου Χαραλαμπόπουλου ΕΙΣΑΓΩΓΗ Ένα επαναλαμβανόμενο περιοδικά φαινόμενο, έχει μία συχνότητα επανάληψης μέσα στο χρόνο και μία περίοδο. Επειδή κάθε

Διαβάστε περισσότερα

Τίτλος Μαθήματος: Βασικές Έννοιες Φυσικής. Ενότητα: Στερεά. Διδάσκων: Καθηγητής Κ. Κώτσης. Τμήμα: Παιδαγωγικό, Δημοτικής Εκπαίδευσης

Τίτλος Μαθήματος: Βασικές Έννοιες Φυσικής. Ενότητα: Στερεά. Διδάσκων: Καθηγητής Κ. Κώτσης. Τμήμα: Παιδαγωγικό, Δημοτικής Εκπαίδευσης Τίτλος Μαθήματος: Βασικές Έννοιες Φυσικής Ενότητα: Στερεά Διδάσκων: Καθηγητής Κ. Κώτσης Τμήμα: Παιδαγωγικό, Δημοτικής Εκπαίδευσης 7. Στερεά Η επιβεβαίωση ότι τα στερεά σώματα αποτελούνται από μια ιδιαίτερη

Διαβάστε περισσότερα

ΔΟΜΕΣ ΠΡΩΤΕΪΝΩΝ. Fibrous - extended shape, insoluble (e.g. keratin, collagen, elastin) Globular

ΔΟΜΕΣ ΠΡΩΤΕΪΝΩΝ. Fibrous - extended shape, insoluble (e.g. keratin, collagen, elastin) Globular ΔΟΜΕΣ ΠΡΩΤΕΪΝΩΝ Fibrous - extended shape, insoluble (e.g. keratin, collagen, elastin) Globular - compact shape, water soluble (e.g. myoglobin, trypsin) Membranous - often multidomain one lipid soluble

Διαβάστε περισσότερα

ΚΕΦΑΛΑΙΟ 29 Σύνθεση πρωτεϊνών

ΚΕΦΑΛΑΙΟ 29 Σύνθεση πρωτεϊνών ΚΕΦΑΛΑΙΟ 29 Σύνθεση πρωτεϊνών Αφού είδαμε πως το DNA αντιγράφεται και μεταγράφεται, τώρα θα εξετάσουμε τη διαδικασία με την παράγονται οι πρωτεϊνες Στην ουσία θα πρέπει να συνδυαστεί ο κώδικας δύο βιβλιοθηκών,

Διαβάστε περισσότερα

Διδάσκων: Καθηγητής Εμμανουήλ Μ. Παπαμιχαήλ

Διδάσκων: Καθηγητής Εμμανουήλ Μ. Παπαμιχαήλ Τίτλος Μαθήματος: Ενζυμολογία Ενότητα: Εισαγωγή Διδάσκων: Καθηγητής Εμμανουήλ Μ. Παπαμιχαήλ Τμήμα: Χημείας 8 1. EIΣAΓΩΓH Tα ένζυμα είναι οι καταλύτες της ζώσης ύλης. Καταλύουν τις χημικές αντιδράσεις,

Διαβάστε περισσότερα

Μάθηµα: Κίνηση πρωτεινών

Μάθηµα: Κίνηση πρωτεινών Μάθηµα: Κίνηση πρωτεινών ιάλεξη 1:Σύνθεση πρωτεινών- Ριβόσωµα Κώστας Τοκατλίδης Η σύνθεση πρωτεινών απαιτεί την µετάφραση αλληλουχίας νουκλεοτιδίων σε αλληλουχία αµινοξέων Οι συνθετάσες των αµινοακυλο-trna

Διαβάστε περισσότερα

Πανεπιστήμιο Δυτικής Μακεδονίας. Τμήμα Μηχανολόγων Μηχανικών. Χημεία. Ενότητα 5: Ιοντικός δεσμός. Τόλης Ευάγγελος

Πανεπιστήμιο Δυτικής Μακεδονίας. Τμήμα Μηχανολόγων Μηχανικών. Χημεία. Ενότητα 5: Ιοντικός δεσμός. Τόλης Ευάγγελος Τμήμα Μηχανολόγων Μηχανικών Χημεία Ενότητα 5: Ιοντικός δεσμός Τόλης Ευάγγελος e-mail: etolis@uowm.gr Τμήμα Μηχανολόγων Μηχανικών Άδειες Χρήσης Το παρόν εκπαιδευτικό υλικό υπόκειται σε άδειες χρήσης Creative

Διαβάστε περισσότερα

KΕΦΑΛΑΙΟ 1ο Χημική σύσταση του κυττάρου. Να απαντήσετε σε καθεμιά από τις παρακάτω ερωτήσεις με μια πρόταση:

KΕΦΑΛΑΙΟ 1ο Χημική σύσταση του κυττάρου. Να απαντήσετε σε καθεμιά από τις παρακάτω ερωτήσεις με μια πρόταση: KΕΦΑΛΑΙΟ 1ο Χημική σύσταση του κυττάρου Ενότητα 1.1: Χημεία της ζωής Ενότητα 2.1: Μακρομόρια Να απαντήσετε σε καθεμιά από τις παρακάτω ερωτήσεις με μια πρόταση: 1. Για ποιο λόγο θεωρείται αναγκαία η σταθερότητα

Διαβάστε περισσότερα

Οι πρωτεΐνες μπορεί να είναι σφαιρικές (συμπαγείς) ή ινώδεις

Οι πρωτεΐνες μπορεί να είναι σφαιρικές (συμπαγείς) ή ινώδεις Οι πρωτεΐνες μπορεί να είναι σφαιρικές (συμπαγείς) ή ινώδεις Β-1 Οι συμπαγείς, σφαιροειδείς πρωτεΐνες Είναι ευδιάλυτες στο νερό Έχουν σφαιρικό σχήμα Έχουν τα περισσότερα πολικά αμινοξέα στην εξωτερική

Διαβάστε περισσότερα

ΕΡΕΥΝΗΤΙΚΗ ΕΡΓΑΣΙΑ: AN EXPERIMENTAL BIOLOGY MYSEYM

ΕΡΕΥΝΗΤΙΚΗ ΕΡΓΑΣΙΑ: AN EXPERIMENTAL BIOLOGY MYSEYM Γενικό Λύκειο Μοιρών 2012-2013 ΕΡΕΥΝΗΤΙΚΗ ΕΡΓΑΣΙΑ: AN EXPERIMENTAL BIOLOGY MYSEYM ΩΣΜΩΣΗ-ΜΕΤΟΥΣΙΩΣΗ Γρηγοράκη Αγγελική Ντρετάκη Αγάπη Πηρουνάκη Στέλλα Πολυχρονάκη Παναγιώτα ΠΕΡΙΕΧΟΜΕΝΑ Εισαγωγή..3 Μεθοδολογία.4

Διαβάστε περισσότερα

Προγνωστικές μέθοδοι με βάση αμινοξικές αλληλουχίες

Προγνωστικές μέθοδοι με βάση αμινοξικές αλληλουχίες Προγνωστικές μέθοδοι με βάση αμινοξικές αλληλουχίες Vasilis Promponas Bioinformatics Research Laboratory Department of Biological Sciences University of Cyprus ΣΥΝΟΨΗ Εισαγωγή Πρόγνωση της δομής πρωτεϊνών

Διαβάστε περισσότερα

Η κυτταρική µετατόπιση των πρωτεϊνών

Η κυτταρική µετατόπιση των πρωτεϊνών 9-1 Κεφάλαιο 9 Η κυτταρική µετατόπιση των πρωτεϊνών Εισαγωγή Στο κύτταρο η έκφραση των πρωτεϊνών γίνεται από µόνο ένα τύπο ριβοσώµατος (εκτός των µιτοχονδριακών και των χλωροπλαστικών που µοιάζουν µε αυτά

Διαβάστε περισσότερα

Υλικά Ηλεκτρονικής & Διατάξεις

Υλικά Ηλεκτρονικής & Διατάξεις Τμήμα Ηλεκτρονικών Μηχανικών Υλικά Ηλεκτρονικής & Διατάξεις 3 η σειρά διαφανειών Δημήτριος Λαμπάκης Τύποι Στερεών Βασική Ερώτηση: Πως τα άτομα διατάσσονται στο χώρο ώστε να σχηματίσουν στερεά? Τύποι Στερεών

Διαβάστε περισσότερα