Φυσική Στερεών στις Πρωτεΐνες

Μέγεθος: px
Εμφάνιση ξεκινά από τη σελίδα:

Download "Φυσική Στερεών στις Πρωτεΐνες"

Transcript

1 Φυσική Στερεών στις Πρωτεΐνες Νίκος Απ. Παπανδρέου Τ.Ε.Ι. Πειραιά Φεβρουάριος 2010

2 Ένα ελικοϊδές μονοπάτι

3 Χημική δομή μίας πρωτεΐνης Μήκος αλυσίδας ~30 έως ~1000 αµινοξέα Συνολικός αριθµός ατόµων έως ~ 10 5 Πολυπεπτιδική αλυσίδα R: πλευρική αλυσίδα Χαρακτηρίζει τον τύπο του αµινοξέος 20 είδη πλευρικών Αλυσίδων 20 τύποι αµινοξέων

4 Τα 20 αμινοξέα Υδρόφοβα Πολικά (Υδρόφιλα) Φορτισµένα

5 Αμινοξική ακολουθία AFWGYTRKLMNQSEVHPKLLIPKCGFTEVNPHCYRLIL Εδώ βρίσκεται κωδικοποιηµένη η Βιοχηµική δράση της πρωτεΐνης

6 Στερεοδομή μίας πρωτεΐνης Σε φυσιολογικές συνθήκες (υδατικό διάλυμα) η πρωτεΐνη αναδιπλώνεται σε μία μοναδική και σταθερή 3D δομή, που είναι βιοχημικά ενεργή. Αυτόνομη δομική περιοχή: ~30 έως ~200 αμινοξέα: αυτόνομη λειτουργία Οι δυνάμεις που σταθεροποιούν τη δομή είναι οι μη ομοιοπολικές δυνάμεις μεταξύ ατόμων (Van der Waals, ηλεκτροστατικές, δεσμοί υδρογόνου)

7 H 3D δοµή καθορίζεται απο την αµινοξική ακολουθία H 3D δοµή καθορίζει τη βιοχηµική λειτουργία Παράδειγμα Αναγνώριση αντιγόνου (κόκκινο) από πρωτεΐνη του ανοσοποιητικού συστήματος (μπλέ-πράσινο)

8 Η διπλωµένη, βιολογικά ενεργή πρωτεΐνη είναι ένα Στερεό Σώµα Η µελέτη της σε µικροσκοπικό επίπεδο εµπλέκει τις µεθόδους της Φυσικής των Στερεών Πειραματικός προσδιορισμός δομής πρωτεϊνών Περίθλαση ακτίνων Χ (απαιτεί παρασκευή κρυστάλλων πρωτεϊνών) NMR (γίνεται σε διάλυμα, αλλά έχει περισσότερο θόρυβο και μικρότερη ακρίβεια)

9 Το πρόβλημα της αναδίπλωσης των πρωτεΐνών Η πρόβλεψη της 3D δομής χρησιμοποιώντας ως πληροφορία μόνο την αμινοξική ακολουθία (ab initio) Άλυτο πρόβλημα σήμερα???????????????? Αριθμός γνωστών δομών << Αριθμός γνωστών ακολουθιών Σημαντικός ρόλος θεωρητικής μελέτης και προσομοίωσης

10 Αναδίπλωση: ο ρόλος της εντροπίας =Μόριο νερού

11 Αναδίπλωση: ενεργειακά μονοπάτια Ενεργειακό φάσμα παρόμοιο με τα Στερεά με Δομική Αταξία (Ημιαγωγοί Κεραμικά) Μετάβαση μεταξύ εντοπισμένων καταστάσεων με θερμική διέγερση

12 Voronoi tesselation Οι πρωτεΐνες σαν συμπαγή στερεά Κυψελίδες Voronoi: Πολύεδρα με κέντρα τα αμινοξέα Δύο αμινοξέα είναι γειτονικά στο χώρο αν έχουν κοινή έδρα

13

14 Μήκος συσχετισμού στις πρωτεΐνες TEF = Tightened-End-Fragments ΑΒ στο χώρο < 10 Å AB κατά μήκος της αλυσίδας ~ αμινοξέα Α, Β υδρόφοβα αμινοξέα του πυρήνα της πρωτεΐνης Α Β Δρουν σαν άγκυρες για τη δομή TEF = τμήμα του πρωτεϊνικού σκελετού ανάμεσα σε δύο σημεία επαφής

15 Ανάλυση 3D δομής σε TEF Η πρόβλεψη των TEF από την αμινοξική ακολουθία είναι πολύ σημαντική για την πρόβλεψη της δομής

16 Αναδίπλωση: παράδοξα και κλίμακες Αναδιπλωμένη κατάσταση = ελάχιστη ενέργεια Πρωτείνη 150 αμινοξέων Αριθμός στερεοδιατάξεων ~ 1070 Χρόνος αναδίπλωσης με τυχαία έρευνα ~ yrs Ξεπερνά την ηλικία του σύμπαντος (~ sec ~ 1010 yrs) Μία πρωτεΐνη διπλώνει σε ~ 1 sec (Παράδοξο του Levinthal) Ύπαρξη χαρακτηριστικής κλίμακας για την αναδίπλωση Για αμινοξέα ο χρόνος αναδίπλωσης με τυχαία έρευνα είναι ~ 1 sec.? Ύπαρξη στοιχειωδών τμημάτων αμινοξέων που είναι σημαντικά για την αναδίπλωση Είναι τα TEF?

17 Κρίσιμες θέσεις στην πρωτεϊνική δομή Είναι τα άκρα των TEF, που καθορίζουν τον σχηματισμό τους Ο σχηματισμός των TEF είναι το κρίσιμο σημείο στην αναδίπλωση μίας πρωτεΐνης Αντιστοιχεί στην δυσκολότερη μετάβαση του ενεργειακού μονοπατιού. Ηλεκτρικό ανάλογο στα στερεά µε δοµική αταξία Διέλευση συνεχούς ρεύµατος: υπερπήδηση του υψηλότερου ενεργειακού φράγµατος R1 R2 R3 R4 R5 R6... Rολ ~ ΜΑΧ(Ri)

18 Υπολογισµός της πιθανότητας βύθισης στο εσωτερικό της δοµής: τα µέγιστα είναι οι κρίσιµες θέσεις

19 Εφαρμογές Οι κρίσιμες θέσεις είναι οι πιο ευαίσθητες σε μεταλλάξεις Ιατρικές Βιοτεχνολογικές εφαρμογές Πρόβλεψη δομής μικρών βιομορίων Νανο-βιοτεχνολογία

20 Ευχαριστίες Dr Jacques Chomilier Institut de Minéralogie et de Physique de la Matière Condensée (IMPMC) Παρίσι Καθ. Ηλίας Ηλιόπουλος Γεωπονικό Παν/μιο Αθήνας

Ενεργειακή ανάλυση βιομορίων

Ενεργειακή ανάλυση βιομορίων Ενεργειακή ανάλυση βιομορίων Τα βιομόρια ως φυσικά συστήματα πρωτεΐνες, DNA, πεπτίδια, μικρά μόρια (ligands, φάρμακα) Αλληλεπιδράσεις μεταξύ των ατόμων + επίδραση του περιβάλλοντος νερού σταθεροποίηση

Διαβάστε περισσότερα

Άσκηση 7. Προσομοίωση 3D Δομών Βιομορίων μέσω. Ομολογίας & Threading

Άσκηση 7. Προσομοίωση 3D Δομών Βιομορίων μέσω. Ομολογίας & Threading Άσκηση 7 Προσομοίωση 3D Δομών Βιομορίων μέσω Ομολογίας & Threading Προσομοίωση 2ταγούς δομής πρωτεϊνών Δευτεροταγής Δομή: Η 2ταγής δομή των πρωτεϊνών είναι σταθερή τοπική διαμόρφωση της πολυπεπτιδικής

Διαβάστε περισσότερα

ΓΩΝΙΕΣ φ, ψ ΚΑΙ ΕΠΙΤΡΕΠΤΕΣ ΔΙΑΜΟΡΦΩΣΕΙΣ ΤΗΣ ΠΟΛΥΠΕΠΤΙΔΙΚΗΣ ΑΛΥΣΙΔΑΣ

ΓΩΝΙΕΣ φ, ψ ΚΑΙ ΕΠΙΤΡΕΠΤΕΣ ΔΙΑΜΟΡΦΩΣΕΙΣ ΤΗΣ ΠΟΛΥΠΕΠΤΙΔΙΚΗΣ ΑΛΥΣΙΔΑΣ ΓΩΝΙΕΣ φ, ψ ΚΑΙ ΕΠΙΤΡΕΠΤΕΣ ΔΙΑΜΟΡΦΩΣΕΙΣ ΤΗΣ ΠΟΛΥΠΕΠΤΙΔΙΚΗΣ ΑΛΥΣΙΔΑΣ ΜΕΤΡΗΣΗ ΤΗΣ ΓΩΝΙΑΣ φ φ Ccarbonyl n Ccarbonyl n N Cα n Ccarbonyl n-1 Cα n N φ Ccarbonyl n-1 ΜΕΤΡΗΣΗ ΤΗΣ ΓΩΝΙΑΣ ψ φ ψ Ccarbonyl n N (Ca

Διαβάστε περισσότερα

Εισαγωγή στη Μοριακή Προσοµοίωση

Εισαγωγή στη Μοριακή Προσοµοίωση Κεφάλαιο 6 Εισαγωγή στη Μοριακή Προσοµοίωση 6.1. Μοριακή Μηχανική 6.1.1. Εισαγωγή στη µεθοδολογία του «απ αρχής» διπλώµατος της πρωτείνης. Η ενέργεια κάθε µορίου µπορεί θεωρητικά να υπολογιστεί µε την

Διαβάστε περισσότερα

Αρχιτεκτονική της τρισδιάστατης δομής πρωτεϊνών

Αρχιτεκτονική της τρισδιάστατης δομής πρωτεϊνών Αρχιτεκτονική της τρισδιάστατης δομής πρωτεϊνών Βασίλης Προμπονάς, PhD Ερευνητικό Εργαστήριο Βιοπληροφορικής Τμήμα Βιολογικών Επιστημών Νέα Παν/πολη, Γραφείο B161 Πανεπιστήμιο Κύπρου Ταχ.Κιβ. 20537 1678,

Διαβάστε περισσότερα

Πρωτεινική αναδίπλωση

Πρωτεινική αναδίπλωση Πρωτεινική αναδίπλωση Η αμινοξική αλληλουχία καθορίζει την τριτοταγή δομή - Οι πληροφορίες για τη βιολογικά δραστική στερεοδιάταξη είναι κωδικοποιημένες στην αμινοξική αλληλουχία Ριβονουκλεάση- Anfinsen,

Διαβάστε περισσότερα

ΔΟΜΗ ΚΑΙ ΑΝΑΛΥΣΗ ΒΙΟΜΟΡΙΩΝ

ΔΟΜΗ ΚΑΙ ΑΝΑΛΥΣΗ ΒΙΟΜΟΡΙΩΝ ΔΟΜΗ ΚΑΙ ΑΝΑΛΥΣΗ ΒΙΟΜΟΡΙΩΝ Διδάσκοντες: Δ.Δ. Λεωνίδας, Α.-Μ. Ψαρρά Κωδικός e-class: SEYC194 28/9/2015 Δ.Δ. Λεωνίδας 28/9/2015 Δ.Δ. Λεωνίδας Βιοχημεία είναι η Χημεία που εμφανίζεται μέσα στους ζώντες οργανισμούς

Διαβάστε περισσότερα

Δομή πρωτεϊνών: Τριτοταγής διαμόρφωση της δομής

Δομή πρωτεϊνών: Τριτοταγής διαμόρφωση της δομής Δομή πρωτεϊνών: Τριτοταγής διαμόρφωση της δομής - Αναφέρεται στην αναδίπλωση της πολυπεπτιδικής αλυσίδας πάνω στον εαυτό της και στο τελικό σχήμα που θα πάρει στο χώρο -Σ αυτή τη διαμόρφωση σημαντικό ρόλο

Διαβάστε περισσότερα

Δομές (Διαμορφώσεις) Πρωτεινικών μορίων

Δομές (Διαμορφώσεις) Πρωτεινικών μορίων Δομές (Διαμορφώσεις) Πρωτεινικών μορίων Πρωτοταγής δομή (αλληλουχία αμινοξέων) Δευτεροταγής δομή Η διάταξη της πεπτιδικής αλυσίδας στον χωρο αυτής καθ αυτής (χωρίς να ληφθούν υπ όψη οι ομάδες R) Τριτοταγής

Διαβάστε περισσότερα

Τα τείχη έχουν πέσει: Κυτταρική Βιολογία, Βιοχημεία, Γενετική γέννησαν τη σύγχρονη Βιοϊατρική. Βιοχημεία Ι Α-2

Τα τείχη έχουν πέσει: Κυτταρική Βιολογία, Βιοχημεία, Γενετική γέννησαν τη σύγχρονη Βιοϊατρική. Βιοχημεία Ι Α-2 Περιεχόμενο της σύγχρονης Βιοχημείας Η περιγραφή της δομής, της οργάνωσης και της λειτουργίας του κυττάρου σε μοριακό επίπεδο Η διερεύνηση της σχέσης δομής-λειτουργίας των βιομορίων Η μελέτη του μεταβολισμού

Διαβάστε περισσότερα

πρωτεΐνες πολυμερείς ουσίες δομούν λειτουργούν λευκώματα 1.Απλές πρωτεΐνες 2.Σύνθετες πρωτεΐνες πρωτεΐδια μη πρωτεϊνικό μεταλλοπρωτεΐνες

πρωτεΐνες πολυμερείς ουσίες δομούν λειτουργούν λευκώματα 1.Απλές πρωτεΐνες 2.Σύνθετες πρωτεΐνες πρωτεΐδια μη πρωτεϊνικό μεταλλοπρωτεΐνες ΠΡΩΤΕΙΝΕΣ Οι πρωτεΐνες είναι πολυμερείς ουσίες με κυρίαρχο και πρωταρχικό ρόλο στη ζωή. Πρωτεΐνες είναι οι ουσίες που κυρίως δομούν και λειτουργούν τους οργανισμούς. Λέγονται και λευκώματα λόγω του λευκού

Διαβάστε περισσότερα

ΘΕΜΑ 1 Ο Για τι προτάσει 1.1 και 1.2 να γράψετε στο τετράδιό σα τον αριθµό τη πρόταση και δίπλα το γράµµα που αντιστοιχεί στη σωστή συµπλήρωσή τη.

ΘΕΜΑ 1 Ο Για τι προτάσει 1.1 και 1.2 να γράψετε στο τετράδιό σα τον αριθµό τη πρόταση και δίπλα το γράµµα που αντιστοιχεί στη σωστή συµπλήρωσή τη. Γ' ΛΥΚΕΙΟΥ ΤΕΧΝΟΛΟΓΙΚΗ ΚΑΤΕΥΘΥΝΣΗ ΧΗΜΕΙΑ - ΒΙΟΧΗΜΕΙΑ ΘΕΜΑ Ο Για τι προτάσει. και.2 να γράψετε στο τετράδιό σα τον αριθµό τη πρόταση και δίπλα το γράµµα που αντιστοιχεί στη σωστή συµπλήρωσή τη.. Ποια από

Διαβάστε περισσότερα

Τμήμα Βιολογίας Μάθημα: ΒΙΟΛΟΓΙΑ ΚΥΤΤΑΡΟΥ Γ εξάμηνο 2014-2015 Διαλέξεις κάθε Τρίτη 13-15 μ.μ. και Παρασκευή 11-13

Τμήμα Βιολογίας Μάθημα: ΒΙΟΛΟΓΙΑ ΚΥΤΤΑΡΟΥ Γ εξάμηνο 2014-2015 Διαλέξεις κάθε Τρίτη 13-15 μ.μ. και Παρασκευή 11-13 Τμήμα Βιολογίας Μάθημα: ΒΙΟΛΟΓΙΑ ΚΥΤΤΑΡΟΥ Γ εξάμηνο 2014-2015 Διαλέξεις κάθε Τρίτη 13-15 μ.μ. και Παρασκευή 11-13 Ισιδώρα Παπασιδέρη, Καθηγήτρια...για περισσότερα... http://kyttariki.biol.uoa.gr, ttp://multimedia.biol.uoa.gr

Διαβάστε περισσότερα

Μοριακή Αναγνώριση. 5.1. Εισαγωγή. 5.2. Σταθερές σύνδεσης και αποχωρισµού. [A][B] k d = ----------- [AB] [ΑΒ] k i = ---------- [Α][Β] Κεφάλαιο

Μοριακή Αναγνώριση. 5.1. Εισαγωγή. 5.2. Σταθερές σύνδεσης και αποχωρισµού. [A][B] k d = ----------- [AB] [ΑΒ] k i = ---------- [Α][Β] Κεφάλαιο Κεφάλαιο 5-1 5 Μοριακή Αναγνώριση 5.1. Εισαγωγή Ένα από τα σηµαντικότερα χαρακτηριστικά των ζωντανών οργανισµών είναι ότι τα µακροµόρια που περιέχουν κάνουν πολύ εξειδικευµένες αλληλεπιδράσεις µε άλλα

Διαβάστε περισσότερα

Θέµατα ιάλεξης ΠΡΩΤΕΪΝΕΣ - ΕΝΖΥΜΑ ΠΡΩΤΕΪΝΕΣ. ιαχωρισµός Αµινοξέων

Θέµατα ιάλεξης ΠΡΩΤΕΪΝΕΣ - ΕΝΖΥΜΑ ΠΡΩΤΕΪΝΕΣ. ιαχωρισµός Αµινοξέων MANAGING AUTHORITY OF THE OPERATIONAL PROGRAMME EDUCATION AND INITIAL VOCATIONAL TRAINING ΠΡΩΤΕΪΝΕΣ - ΕΝΖΥΜΑ Θέµατα ιάλεξης οµή, αριθµός και διαχωρισµός των αµινοξέων Ένωση αµινοξέων µε τον πεπτιδικό δεσµό

Διαβάστε περισσότερα

Κεφάλαιο 2 Χημικοί Δεσμοί

Κεφάλαιο 2 Χημικοί Δεσμοί Κεφάλαιο 2 Χημικοί Δεσμοί Σύνοψη Παρουσιάζονται οι χημικοί δεσμοί, ιοντικός, μοριακός, ατομικός, μεταλλικός. Οι ιδιότητες των υλικών τόσο οι φυσικές όσο και οι χημικές εξαρτώνται από το είδος ή τα είδη

Διαβάστε περισσότερα

Δομικές κατηγορίες πρωτεϊνών

Δομικές κατηγορίες πρωτεϊνών 3-1 Κεφάλαι ο Δομικές κατηγορίες πρωτεϊνών 3.1. α-δομές πρωτεϊνών Οι α-έλικες είναι δομικά στοιχεία που μπορούν να σχηματίσουν πολλές κατηγορίες στερεοδομών και με πολλές διαφορετικές λειτουργίες. Εκτός

Διαβάστε περισσότερα

1.Μαθησιακοί στόχοι του μαθήματος

1.Μαθησιακοί στόχοι του μαθήματος BIOXHMEIA, TOMOΣ I ΠANEΠIΣTHMIAKEΣ EKΔOΣEIΣ KPHTHΣ 1.Μαθησιακοί στόχοι του μαθήματος της ΒΙΟΧΗΜΕΙΑΣ (ΕΤΥ-232) 1)εξοικείωση των φοιτητών με τον μοριακό σχεδιασμό της ζωής 2)εμπέδωση της δομής και λειτουργίας

Διαβάστε περισσότερα

Οι πρωτεΐνες συμμετέχουν σε όλες τις κυτταρικές λειτουργίες

Οι πρωτεΐνες συμμετέχουν σε όλες τις κυτταρικές λειτουργίες Οι πρωτεΐνες συμμετέχουν σε όλες τις κυτταρικές λειτουργίες Γένωμα vs Πρωτέωμα Όλη η αλληλουχία βάσεων στο DNA Τι είναι δυνατόν Συγκεκριμένο Στατικό Οι πρωτεΐνες που κωδικοποιούνται από το γένωμα Τι είναι

Διαβάστε περισσότερα

οµή και Αναδίπλωση πρωτεϊνών

οµή και Αναδίπλωση πρωτεϊνών οµή και Αναδίπλωση πρωτεϊνών Νηφόρου Κατερίνα Μεταδιδακτορική Ερευνήτρια, Οµάδα Μοριακής Καρκινογένεσης, Εργ/ριο Ιστολογίας-Εµβρυολογίας, Ιατρική Σχολή Αθηνών Σηµασία των πρωτεϊνών Ενζυµική κατάλυση Μεταφορά

Διαβάστε περισσότερα

«ΠΡΩΤΕΪΝΕΣ: ΧΗΜΙΚΗ ΔΟΜΗ ΚΑΙ ΒΙΟΛΟΓΙΚΟΣ ΡΟΛΟΣ»

«ΠΡΩΤΕΪΝΕΣ: ΧΗΜΙΚΗ ΔΟΜΗ ΚΑΙ ΒΙΟΛΟΓΙΚΟΣ ΡΟΛΟΣ» «ΠΡΩΤΕΪΝΕΣ: ΧΗΜΙΚΗ ΔΟΜΗ ΚΑΙ ΒΙΟΛΟΓΙΚΟΣ ΡΟΛΟΣ» Τι είναι οι πρωτεΐνες; Από τι αποτελούνται; Ποιος είναι ο βιολογικός του ρόλος; Ας ρίξουμε μία ματιά σε όλα αυτά τα ερωτήματα που μας απασχολούν ΚΕΦΑΛΑΙΟ 1:

Διαβάστε περισσότερα

Φασματοσκοπίας UV/ορατού Φασματοσκοπίας υπερύθρου Φασματοσκοπίας άπω υπερύθρου / μικροκυμάτων Φασματοσκοπίας φθορισμού Φασματοσκοπίας NMR

Φασματοσκοπίας UV/ορατού Φασματοσκοπίας υπερύθρου Φασματοσκοπίας άπω υπερύθρου / μικροκυμάτων Φασματοσκοπίας φθορισμού Φασματοσκοπίας NMR Φασματοσκοπία Ερμηνεία & εφαρμογές : Φασματοσκοπίας UV/ορατού Φασματοσκοπίας υπερύθρου Φασματοσκοπίας άπω υπερύθρου / μικροκυμάτων Φασματοσκοπίας φθορισμού Φασματοσκοπίας NMR Ποια φαινόμενα παράγουν τα

Διαβάστε περισσότερα

Kυτταρική Bιολογία ΔΟΜΗ ΚΑΙ ΛΕΙΤΟΥΡΓΙΕΣ ΤΩΝ ΠΡΩΤΕΪΝΩΝ ΔIAΛEΞΗ 3 (7/3/2012) Δρ. Xρήστος Παναγιωτίδης, Τμήμα Φαρμακευτικής Α.Π.Θ.

Kυτταρική Bιολογία ΔΟΜΗ ΚΑΙ ΛΕΙΤΟΥΡΓΙΕΣ ΤΩΝ ΠΡΩΤΕΪΝΩΝ ΔIAΛEΞΗ 3 (7/3/2012) Δρ. Xρήστος Παναγιωτίδης, Τμήμα Φαρμακευτικής Α.Π.Θ. Kυτταρική Bιολογία ΔIAΛEΞΗ 3 (7/3/2012) ΔΟΜΗ ΚΑΙ ΛΕΙΤΟΥΡΓΙΕΣ ΤΩΝ ΠΡΩΤΕΪΝΩΝ AΣ ΘYMHΘOYME Στην προηγούμενη διάλεξη μιλήσαμε για τη χημική σύσταση των κυττάρων και για τα βιολογικά πολυμερή που αποτελούν

Διαβάστε περισσότερα

1.1. Να γράψετε στο τετράδιό σας το γράµµα που αντιστοιχεί στη σωστή απάντηση:

1.1. Να γράψετε στο τετράδιό σας το γράµµα που αντιστοιχεί στη σωστή απάντηση: ΘΕΜΑ 1o 1.1. Να γράψετε στο τετράδιό σας το γράµµα που αντιστοιχεί στη σωστή απάντηση: Η σταθερά Κ w στους 25 ο C έχει τιµή 10-14 : α. µόνο στο καθαρό νερό β. σε οποιοδήποτε υδατικό διάλυµα γ. µόνο σε

Διαβάστε περισσότερα

ΘΕΜΑ 1 ο 1.1. Να γράψετε στο τετράδιό σας το γράμμα που αντιστοιχεί στη σωστή απάντηση:

ΘΕΜΑ 1 ο 1.1. Να γράψετε στο τετράδιό σας το γράμμα που αντιστοιχεί στη σωστή απάντηση: ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΕΝΙΑΙΟΥ ΛΥΚΕΙΟΥ ΤΡΙΤΗ 5 ΙΟΥΝΙΟΥ 2001 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΤΕΧΝΟΛΟΓΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ (ΚΥΚΛΟΣ ΤΕΧΝΟΛΟΓΙΑΣ ΚΑΙ ΠΑΡΑΓΩΓΗΣ) : ΧΗΜΕΙΑ - ΒΙΟΧΗΜΕΙΑ ΘΕΜΑ 1 ο 1.1. Να γράψετε στο τετράδιό

Διαβάστε περισσότερα

ΕΝΘΕΤΟ. Έννοιες που εξετάζονται από άλλες φυσικές επιστήμες

ΕΝΘΕΤΟ. Έννοιες που εξετάζονται από άλλες φυσικές επιστήμες ΕΝΘΕΤΟ Έννοιες που εξετάζονται από άλλες φυσικές επιστήμες ΟΜΟΙΟΠΟΛΙΚΟΙ ΔΕΣΜΟΣ - ΔΕΣΜΟΣ ΥΔΡΟΓΟΝΟΥ Ο σχηματισμός του μορίου του νερού (Η20) μπορεί να εξηγηθεί με βάση την ηλεκτρονιακή του δομή. Καθένα από

Διαβάστε περισσότερα

Η ΧΗΜΕΙΑ ΤΗΣ ΖΩΗΣ. Καρβουντζή Ηλιάνα Βιολόγος

Η ΧΗΜΕΙΑ ΤΗΣ ΖΩΗΣ. Καρβουντζή Ηλιάνα Βιολόγος Η ΧΗΜΕΙΑ ΤΗΣ ΖΩΗΣ Χημικά στοιχεία που συνθέτουν τους οργανισμούς Ο C, το H 2, το O 2 και το N 2 είναι τα επικρατέστερα στους οργανισμούς σε ποσοστό 96% κ.β. Γιατί; Συμμετέχουν σε σημαντικό βαθμό στη σύνθεση

Διαβάστε περισσότερα

Ηλίας Ηλιόπουλος Εργαστήριο Γενετικής, Τμήμα Βιοτεχνολογίας, Γεωπονικό Πανεπιστήμιο Αθηνών

Ηλίας Ηλιόπουλος Εργαστήριο Γενετικής, Τμήμα Βιοτεχνολογίας, Γεωπονικό Πανεπιστήμιο Αθηνών Το δίπλωμα των πρωτεϊνών Ηλίας Ηλιόπουλος Εργαστήριο Γενετικής, Τμήμα Βιοτεχνολογίας, Γεωπονικό Πανεπιστήμιο Αθηνών Εισαγωγή Η πλειονότητα των πρωτεϊνών διπλώνει σε μία μοναδική τρισδιάστατη δομή βιολογικά

Διαβάστε περισσότερα

ΙΑΤΡΙΚΗ ΠΑΝΕΠΙΣΤΗΜΙΟΥ ΑΘΗΝΩΝ (ΕΚΠΑ) ΚΑΤΑΤΑΚΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ ΑΚ.ΕΤΟΥΣ ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΧΗΜΕΙΑ

ΙΑΤΡΙΚΗ ΠΑΝΕΠΙΣΤΗΜΙΟΥ ΑΘΗΝΩΝ (ΕΚΠΑ) ΚΑΤΑΤΑΚΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ ΑΚ.ΕΤΟΥΣ ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΧΗΜΕΙΑ ΙΑΤΡΙΚΗ ΠΑΝΕΠΙΣΤΗΜΙΟΥ ΑΘΗΝΩΝ (ΕΚΠΑ) ΚΑΤΑΤΑΚΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ ΑΚ.ΕΤΟΥΣ 2015-2016 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΧΗΜΕΙΑ 1)Πώς το φαινόμενο Bohr επηρεάζει την πρόσδεση οξυγόνου στην αιμοσφαιρίνη; Που συνδέονται τα ιόντα

Διαβάστε περισσότερα

6. ιαμοριακές δυνάμεις

6. ιαμοριακές δυνάμεις 6. ιαμοριακές δυνάμεις ΣΚΟΠΟΣ Σκοπός αυτού του κεφαλαίου είναι να γνωρίσουμε τα είδη των ελκτικών δυνάμεων που αναπτύσσονται μεταξύ των μορίων των ομοιοπολικών ενώσεων και την επίδραση που ασκούν οι δυνάμεις

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ. Παραδόσεις του μαθήματος γενικής παιδείας (Β λυκείου) Επιμέλεια: ΑΡΓΥΡΗΣ ΙΩΑΝΝΗΣ Βιολόγος M.Sc. Καθηγητής 3 ου λυκ.

ΒΙΟΛΟΓΙΑ. Παραδόσεις του μαθήματος γενικής παιδείας (Β λυκείου) Επιμέλεια: ΑΡΓΥΡΗΣ ΙΩΑΝΝΗΣ Βιολόγος M.Sc. Καθηγητής 3 ου λυκ. ΒΙΟΛΟΓΙΑ Παραδόσεις του μαθήματος γενικής παιδείας (Β λυκείου) Επιμέλεια: ΑΡΓΥΡΗΣ ΙΩΑΝΝΗΣ Βιολόγος M.Sc. Καθηγητής 3 ου λυκ. Ηλιούπολης Κεφάλαιο 1ο ΒΙΟΛΟΓΙΚΑ ΜΑΚΡΟΜΟΡΙΑ Η ΙΕΡΑΡΧΙΑ ΤΩΝ ΒΙΟΜΟΡΙΩΝ ΠΡΟΔΡΟΜΕΣ

Διαβάστε περισσότερα

Ερωτησεις στη Βιοφυσική & Νανοτεχνολογία. Χειμερινό Εξάμηνο 2012

Ερωτησεις στη Βιοφυσική & Νανοτεχνολογία. Χειμερινό Εξάμηνο 2012 Ερωτησεις στη Βιοφυσική & Νανοτεχνολογία. Χειμερινό Εξάμηνο 2012 1) Ποιο φυσικό φαινόμενο βοηθάει στην αυτοσυναρμολόγηση μοριακών συστημάτων? α) Η τοποθέτηση μοριων με χρήση μικροσκοπίου σάρωσης δείγματος

Διαβάστε περισσότερα

Δρ. Ιωάννης Καλαμαράς, Διδάκτωρ Χημικός. Όλα τα Θέματα της Τράπεζας στη Χημεία που σχετίζονται με το Χημικό Δεσμό

Δρ. Ιωάννης Καλαμαράς, Διδάκτωρ Χημικός. Όλα τα Θέματα της Τράπεζας στη Χημεία που σχετίζονται με το Χημικό Δεσμό Όλα τα Θέματα της Τράπεζας στη Χημεία που σχετίζονται με το Χημικό Δεσμό Θέμα 1. Να αναφέρετε δυο διαφορές μεταξύ ομοιοπολικών και ιοντικών ενώσεων. Στις ιοντικές ενώσεις οι δομικές μονάδες είναι τα ιόντα,

Διαβάστε περισσότερα

ΕΡΓΑΣΤΗΡΙΑΚΟ ΚΕΝΤΡΟ ΦΥΣΙΚΩΝ ΕΠΙΣΤΗΜΩΝ Ν. ΜΑΓΝΗΣΙΑΣ ( Ε.Κ.Φ.Ε ) ΕΡΓΑΣΤΗΡΙΟ ΒΙΟΛΟΓΙΑΣ

ΕΡΓΑΣΤΗΡΙΑΚΟ ΚΕΝΤΡΟ ΦΥΣΙΚΩΝ ΕΠΙΣΤΗΜΩΝ Ν. ΜΑΓΝΗΣΙΑΣ ( Ε.Κ.Φ.Ε ) ΕΡΓΑΣΤΗΡΙΟ ΒΙΟΛΟΓΙΑΣ ΕΡΓΑΣΤΗΡΙΑΚΟ ΚΕΝΤΡΟ ΦΥΣΙΚΩΝ ΕΠΙΣΤΗΜΩΝ Ν. ΜΑΓΝΗΣΙΑΣ ( Ε.Κ.Φ.Ε ) ΕΡΓΑΣΤΗΡΙΟ ΒΙΟΛΟΓΙΑΣ Θέμα: ΜΕΤΟΥΣΙΩΣΗ ΠΡΩΤΕΪΝΩΝ (άσκηση 7 του εργαστηριακού οδηγού) Μέσος χρόνος πειράματος: 45 λεπτά Α. ΑΝΑΛΩΣΙΜΑ Εργαλεία

Διαβάστε περισσότερα

ΘΕΜΑ 1 ο 1.1. Να γράψετε στο τετράδιό σας το γράμμα που αντιστοιχεί στη σωστή απάντηση:

ΘΕΜΑ 1 ο 1.1. Να γράψετε στο τετράδιό σας το γράμμα που αντιστοιχεί στη σωστή απάντηση: ΑΡΧΗ 1ΗΣ ΣΕΛΙΔΑΣ Γ ΤΑΞΗ ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΕΝΙΑΙΟΥ ΛΥΚΕΙΟΥ ΤΡΙΤΗ 5 ΙΟΥΝΙΟΥ 2001 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΤΕΧΝΟΛΟΓΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ (ΚΥΚΛΟΣ ΤΕΧΝΟΛΟΓΙΑΣ ΚΑΙ ΠΑΡΑΓΩΓΗΣ): ΧΗΜΕΙΑ - ΒΙΟΧΗΜΕΙΑ ΣΥΝΟΛΟ ΣΕΛΙΔΩΝ:

Διαβάστε περισσότερα

Το ένζυμο Καρβοξυπεπτιδάση Α έχει τα εξής χαρακτηριστικά

Το ένζυμο Καρβοξυπεπτιδάση Α έχει τα εξής χαρακτηριστικά Το ένζυμο Καρβοξυπεπτιδάση Α έχει τα εξής χαρακτηριστικά Είναι απλή πολυπεπτιδική αλυσίδα 307 αμινοξέων Είναι συμπαγής και έχει σχήμα ελλειψοειδές διαστάσεων 50 x 42 x 38 A Περιέχει περιοχές α-έλικος 38%

Διαβάστε περισσότερα

Κυκλικός διχρωισµός, Circular Dichroism (CD)

Κυκλικός διχρωισµός, Circular Dichroism (CD) Κυκλικός διχρωισµός, Circular Dichroism (CD) Κυκλικός διχρωισµός Προβλήµατα που µπορούν να διερευνηθούν µε CD: Στοιχεία δευτεροταγούς δοµής. Αλλαγές στη διαµόρφωση πρωτεϊνών που οφείλονται σε µεταβολές

Διαβάστε περισσότερα

Χηµεία-Βιοχηµεία Τεχνολογικής Κατεύθυνσης Γ Λυκείου 2001

Χηµεία-Βιοχηµεία Τεχνολογικής Κατεύθυνσης Γ Λυκείου 2001 Χηµεία-Βιοχηµεία Τεχνολογικής Κατεύθυνσης Γ Λυκείου 2001 ΕΚΦΩΝΗΣΕΙΣ Ζήτηµα 1ο 1. Να γράψετε στο τετράδιό σας το γράµµα που αντιστοιχεί στη σωστή απάντηση: Η σταθερά Κ w στους 25 ο C έχει τιµή 10-14 : α.

Διαβάστε περισσότερα

Επίδραση και άλλων παραγόντων στην Αλλοστερική συμπεριφορά της Αιμοσφαιρίνης

Επίδραση και άλλων παραγόντων στην Αλλοστερική συμπεριφορά της Αιμοσφαιρίνης Επίδραση και άλλων παραγόντων στην Αλλοστερική συμπεριφορά της Αιμοσφαιρίνης Καθώς το οξυγόνο χρησιμοποιείται στους ιστούς παράγεται CO2 το οποίο πρέπει να μεταφερθεί πίσω στους πνεύμονες ή τα βράγχια

Διαβάστε περισσότερα

Αρχές οµικής Βιοπληροφορικής. Πρωτεΐνες. Αµινοξέα. (Υδρόφοβα)

Αρχές οµικής Βιοπληροφορικής. Πρωτεΐνες. Αµινοξέα. (Υδρόφοβα) Αρχές οµικής Βιοπληροφορικής Πρωτεΐνες Αµινοξέα (Υδρόφοβα) Αµινοξέα Αµινοξέα (πολικά) Αµινοξέα φορτισµένα πολικά Αµινοξέα (φορτισµένα) Αµινοξέα Αµινοξέα Αµινοξέα Τί µένει; Σπάνια αµινοξέα πρωτεϊνών (π.χ.

Διαβάστε περισσότερα

ΔΟΜΗ ΠΡΩΤΕΪΝΩΝ II. Σελίδα 1 ΒΙΟΠΛΗΡΟΦΟΡΙΚΗ. Τ. Θηραίου

ΔΟΜΗ ΠΡΩΤΕΪΝΩΝ II. Σελίδα 1 ΒΙΟΠΛΗΡΟΦΟΡΙΚΗ. Τ. Θηραίου ΔΟΜΗ ΠΡΩΤΕΪΝΩΝ II Σελίδα 1 Υπολογιστικός Προσδιορισμός Δομής πειραματικός προσδιορισμός δομών κρυσταλλογραφία ακτίνων X πυρηνικός μαγνητικός συντονισμός (NMR) χρόνος / κόστος / περιορισμοί sequence - structure

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ Β ΛΥΚΕΙΟΥ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ

ΒΙΟΛΟΓΙΑ Β ΛΥΚΕΙΟΥ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ ΕΚΠΑΙΔΕΥΤΗΡΙΑ ΣΥΓΧΡΟΝΗ ΠΑΙΔΕΙΑ ΒΙΟΛΟΓΙΑ Β ΛΥΚΕΙΟΥ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ ΕΠΙΜΕΛΕΙΑ:Ν.ΠΑΠΑΓΙΑΝΝΗΣ 2 Η ΧΗΜΕΙΑ ΤΗΣ ΖΩΗΣ 3 1. Ποια είναι τα επίπεδα οργάνωσης της ζωής και ποια τα χημικά χαρακτηριστικά της; Στην

Διαβάστε περισσότερα

Χηµεία-Βιοχηµεία Τεχνολογικής Κατεύθυνσης Γ Λυκείου 2001

Χηµεία-Βιοχηµεία Τεχνολογικής Κατεύθυνσης Γ Λυκείου 2001 Ζήτηµα 1ο Χηµεία-Βιοχηµεία Τεχνολογικής Κατεύθυνσης Γ Λυκείου 2001 1. Να γράψετε στο τετράδιό σας το γράµµα που αντιστοιχεί στη σωστή απάντηση: Η σταθερά Κ w στους 25 ο C έχει τιµή 10-14 : α. µόνο στο

Διαβάστε περισσότερα

ΦΥΛΛΟ ΕΡΓΑΣΙΑΣ ΣΤΗ ΒΙΟΛΟΓΙΑ Γ ΛΥΚΕΙΟΥ

ΦΥΛΛΟ ΕΡΓΑΣΙΑΣ ΣΤΗ ΒΙΟΛΟΓΙΑ Γ ΛΥΚΕΙΟΥ ΦΥΛΛΟ ΕΡΓΑΣΙΑΣ ΣΤΗ ΒΙΟΛΟΓΙΑ Γ ΛΥΚΕΙΟΥ ΕΝΟΤΗΤΑ: ΕΝΖΥΜΑ ΚΑΘΗΓΗΤΗΣ: ΠΑΤΗΡ ΑΝΑΣΤΑΣΙΟΣ ΙΣΑΑΚ 1. Να εξηγήσετε γιατί πολλές βιταμίνες, παρά τη μικρή συγκέντρωσή τους στον οργανισμό, είναι πολύ σημαντικές για

Διαβάστε περισσότερα

(Από το βιβλίο Γενική Χημεία των Ebbing, D. D., Gammon, S. D., Εκδόσεις Παπασωτηρίου )

(Από το βιβλίο Γενική Χημεία των Ebbing, D. D., Gammon, S. D., Εκδόσεις Παπασωτηρίου ) Δυνάμεις διπόλου διπόλου (Από το βιβλίο Γενική Χημεία των Ebbing, D. D., Gammon, S. D., Εκδόσεις Παπασωτηρίου ) Τα πολικά μόρια μπορούν να έλκονται αμοιβαία μέσω δυνάμεων διπόλου διπόλου. Η δύναμη διπόλου

Διαβάστε περισσότερα

Υλικά Ηλεκτρονικής & Διατάξεις

Υλικά Ηλεκτρονικής & Διατάξεις Τμήμα Ηλεκτρονικών Μηχανικών Υλικά Ηλεκτρονικής & Διατάξεις 2 η σειρά διαφανειών Δημήτριος Λαμπάκης ΜΟΡΙΑΚΗ ΔΟΜΗ Μεμονωμένα άτομα: Μόνο τα ευγενή αέρια Μόρια: Τα υπόλοιπα άτομα σχηματίζουν μόρια, γιατί

Διαβάστε περισσότερα

οµή και λειτουργία των µεγάλων βιολογικών µορίων

οµή και λειτουργία των µεγάλων βιολογικών µορίων οµή και λειτουργία των µεγάλων βιολογικών µορίων οµή και λειτουργία των µεγάλων βιολογικών µορίων κατηγορίες υδατάνθρακες πρωτεΐνες νουκλεϊνικά οξέα λιπίδια Οι πρωτεΐνες, υδατάνθρακες, νουκλεϊνικά οξέα

Διαβάστε περισσότερα

3 ο Κ Ε Φ Α Λ Α Ι Ο ΠΡΩΤΕΪΝΕΣ Α. ΕΡΩΤΗΣΕΙΣ ΚΛΕΙΣΤΟΥ ΤΥΠΟΥ

3 ο Κ Ε Φ Α Λ Α Ι Ο ΠΡΩΤΕΪΝΕΣ Α. ΕΡΩΤΗΣΕΙΣ ΚΛΕΙΣΤΟΥ ΤΥΠΟΥ 3 ο Κ Ε Φ Α Λ Α Ι Ο ΠΡΩΤΕΪΝΕΣ Α. ΕΡΩΤΗΣΕΙΣ ΚΛΕΙΣΤΟΥ ΤΥΠΟΥ Ερωτήσεις πολλαπλής επιλογής Να βάλετε σε κύκλο το γράµµα που αντιστοιχεί στη σωστή απάντηση ή στη φράση που συµπληρώνει σωστά την πρόταση. 1.

Διαβάστε περισσότερα

Χημική σύσταση του κυττάρου

Χημική σύσταση του κυττάρου 1 Χημική σύσταση του κυττάρου Τα χημικά στοιχεία, που συμμετέχουν στη δομή των βιολογικών μορίων, συγκαταλέγονται στα στοιχεία που συνθέτουν τον φλοιό της γης. Όλοι οι οργανισμοί από τον πιο απλό μέχρι

Διαβάστε περισσότερα

BIO111 Μικροβιολογια ιαλεξη 3. Κυτταρικη Χηµεια

BIO111 Μικροβιολογια ιαλεξη 3. Κυτταρικη Χηµεια BIO111 Μικροβιολογια ιαλεξη 3 Κυτταρικη Χηµεια Mικροβιολογία = Bιολογία των µονοκύτταρων οργανισµών και των ιών H µεγάλη σας φίλη Το βακτηριο E.coli 1.000.000X C Γλυκόζη trna αντισωµα ριβοσωµα ATP DNA

Διαβάστε περισσότερα

2.1 Ηλεκτρονική δοµή των ατόµων

2.1 Ηλεκτρονική δοµή των ατόµων ΕΡΩΤΗΣΕΙΣ ΑΠΑΝΤΗΣΕΙΣ ΑΠΟ ΤΗΝ ΕΞΕΤΑΣΤΕΑ ΥΛΗ ΤΟΥ 2ου ΚΕΦΑΛΑΙΟΥ 2.1 Ηλεκτρονική δοµή των ατόµων ΕΡΩΤΗΣΗ 1 : Πως περιέγραψε ο Bohr την δοµή του ατόµου; ΑΠΑΝΤΗΣΗ : Ο Bohr φαντάστηκε το άτοµο σαν ένα µικροσκοπικό

Διαβάστε περισσότερα

ΑΠΑΝΤΗΣΕΙΣ. ΘΕΜΑ Α Α1. β Α2. γ Α3. δ Α4. γ Α5. β

ΑΠΑΝΤΗΣΕΙΣ. ΘΕΜΑ Α Α1. β Α2. γ Α3. δ Α4. γ Α5. β ΘΕΜΑ Α Α1. β Α2. γ Α3. δ Α4. γ Α5. β 1 ΕΙΣΑΓΩΓΙΚΕΣ ΕΞΕΤΑΣΕΙΣ ΤΕΚΝΩΝ ΕΛΛΗΝΩΝ ΤΟΥ ΕΞΩΤΕΡΙΚΟΥ ΚΑΙ ΤΕΚΝΩΝ ΕΛΛΗΝΩΝ ΥΠΑΛΛΗΛΩΝ ΣΤΟ ΕΞΩΤΕΡΙΚΟ ΤΕΤΑΡΤΗ 10 ΣΕΠΤΕΜΒΡΙΟΥ 2014 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ:

Διαβάστε περισσότερα

Κεφάλαια 8 ο Ένζυμα και κατάλυση

Κεφάλαια 8 ο Ένζυμα και κατάλυση Κεφάλαια 8 ο Ένζυμα και κατάλυση Τα ένζυμα είναι βιομόρια που μεσολαβούν στους χημικούς μετασχηματισμούς και στη μετατροπή της ενέργειας Κύρια χαρακτηριστικά τους η ισχύς και η εξειδίκευση Πλέον θα τα

Διαβάστε περισσότερα

Κεφάλαιο 22 Πρωτεΐνες

Κεφάλαιο 22 Πρωτεΐνες Κεφάλαιο 22 Πρωτεΐνες Σύνοψη Οι πρωτεΐνες είναι μακρομόρια που προκύπτουν από την ένωση α-αμινοξέων. Τα α-αμινοξέα είναι οργανικές ενώσεις που έχουν μία αμινομάδα (ΝΗ 2 ) και καρβοξύλιο (COOH) συνδεδεμένα

Διαβάστε περισσότερα

Χαρακτηριστικά της δομής της Μυοσφαιρίνης

Χαρακτηριστικά της δομής της Μυοσφαιρίνης Χαρακτηριστικά της δομής της Μυοσφαιρίνης Η μυοσφαιρίνη είναι ενα εξαιρετικά συμπαγές μόριο.οι διαστάσεις είναι 45Χ35Χ25 Α και υπαρχει πολύ λίγος αδειος χώρος στο εσωτερικό τού μορίου Γυρω στα 75% της

Διαβάστε περισσότερα

οµικά στοιχεία βιοµορίων

οµικά στοιχεία βιοµορίων 2-1 Κεφάλαιο 2 οµικά στοιχεία βιοµορίων 2.1. ιαστάσεις των Βιοµορίων Οι διαστάσεις των βιοµορίων κυµαίνονται από µερικά Ångströms (10-10 m) έως µερικές εκατοντάδες Ångströms (10-8 m). (εικόνα 2.1, 2.2)

Διαβάστε περισσότερα

ΚΕΦΑΛΑΙΟ 2 Ο H XHΜΕΙΑ ΤΗΣ ΖΩΗΣ. Χημεία της ζωής 1

ΚΕΦΑΛΑΙΟ 2 Ο H XHΜΕΙΑ ΤΗΣ ΖΩΗΣ. Χημεία της ζωής 1 ΚΕΦΑΛΑΙΟ 2 Ο H XHΜΕΙΑ ΤΗΣ ΖΩΗΣ Χημεία της ζωής 1 2.1 ΒΑΣΙΚΕΣ ΧΗΜΙΚΕΣ ΕΝΝΟΙΕΣ Η Βιολογία μπορεί να μελετηθεί μέσα από πολλά και διαφορετικά επίπεδα. Οι βιοχημικοί, για παράδειγμα, ενδιαφέρονται περισσότερο

Διαβάστε περισσότερα

Διάλεξη 7: Μοριακή Δομή

Διάλεξη 7: Μοριακή Δομή Μεμονωμένα άτομα: Μόνο τα ευγενή αέρια Μόρια: Τα υπόλοιπα άτομα σχηματίζουν μόρια Γιατί; Διότι η ολική ενέργεια ενός ευσταθούς μορίου είναι μικρότερη από την ολική ενέργεια των μεμονωμένων ατόμων που αποτελούν

Διαβάστε περισσότερα

ΠΥΡΗΝΙΚΟΣ ΜΑΓΝΗΤΙΚΟΣ ΣΥΝΤΟΝΙΣΜΟΣ ΚΑΙ ΔΟΜΗ ΤΟΥ ΑΤΟΜΟΥ. Του Αλέκου Χαραλαμπόπουλου ΕΙΣΑΓΩΓΗ

ΠΥΡΗΝΙΚΟΣ ΜΑΓΝΗΤΙΚΟΣ ΣΥΝΤΟΝΙΣΜΟΣ ΚΑΙ ΔΟΜΗ ΤΟΥ ΑΤΟΜΟΥ. Του Αλέκου Χαραλαμπόπουλου ΕΙΣΑΓΩΓΗ ΠΥΡΗΝΙΚΟΣ ΜΑΓΝΗΤΙΚΟΣ ΣΥΝΤΟΝΙΣΜΟΣ ΚΑΙ ΔΟΜΗ ΤΟΥ ΑΤΟΜΟΥ Του Αλέκου Χαραλαμπόπουλου ΕΙΣΑΓΩΓΗ Ένα επαναλαμβανόμενο περιοδικά φαινόμενο, έχει μία συχνότητα επανάληψης μέσα στο χρόνο και μία περίοδο. Επειδή κάθε

Διαβάστε περισσότερα

Τίτλος Μαθήματος: Βασικές Έννοιες Φυσικής. Ενότητα: Στερεά. Διδάσκων: Καθηγητής Κ. Κώτσης. Τμήμα: Παιδαγωγικό, Δημοτικής Εκπαίδευσης

Τίτλος Μαθήματος: Βασικές Έννοιες Φυσικής. Ενότητα: Στερεά. Διδάσκων: Καθηγητής Κ. Κώτσης. Τμήμα: Παιδαγωγικό, Δημοτικής Εκπαίδευσης Τίτλος Μαθήματος: Βασικές Έννοιες Φυσικής Ενότητα: Στερεά Διδάσκων: Καθηγητής Κ. Κώτσης Τμήμα: Παιδαγωγικό, Δημοτικής Εκπαίδευσης 7. Στερεά Η επιβεβαίωση ότι τα στερεά σώματα αποτελούνται από μια ιδιαίτερη

Διαβάστε περισσότερα

ΚΕΦΑΛΑΙΟ 29 Σύνθεση πρωτεϊνών

ΚΕΦΑΛΑΙΟ 29 Σύνθεση πρωτεϊνών ΚΕΦΑΛΑΙΟ 29 Σύνθεση πρωτεϊνών Αφού είδαμε πως το DNA αντιγράφεται και μεταγράφεται, τώρα θα εξετάσουμε τη διαδικασία με την παράγονται οι πρωτεϊνες Στην ουσία θα πρέπει να συνδυαστεί ο κώδικας δύο βιβλιοθηκών,

Διαβάστε περισσότερα

Διδάσκων: Καθηγητής Εμμανουήλ Μ. Παπαμιχαήλ

Διδάσκων: Καθηγητής Εμμανουήλ Μ. Παπαμιχαήλ Τίτλος Μαθήματος: Ενζυμολογία Ενότητα: Εισαγωγή Διδάσκων: Καθηγητής Εμμανουήλ Μ. Παπαμιχαήλ Τμήμα: Χημείας 8 1. EIΣAΓΩΓH Tα ένζυμα είναι οι καταλύτες της ζώσης ύλης. Καταλύουν τις χημικές αντιδράσεις,

Διαβάστε περισσότερα

Προγνωστικές μέθοδοι με βάση αμινοξικές αλληλουχίες

Προγνωστικές μέθοδοι με βάση αμινοξικές αλληλουχίες Προγνωστικές μέθοδοι με βάση αμινοξικές αλληλουχίες Vasilis Promponas Bioinformatics Research Laboratory Department of Biological Sciences University of Cyprus ΣΥΝΟΨΗ Εισαγωγή Πρόγνωση της δομής πρωτεϊνών

Διαβάστε περισσότερα

KΕΦΑΛΑΙΟ 1ο Χημική σύσταση του κυττάρου. Να απαντήσετε σε καθεμιά από τις παρακάτω ερωτήσεις με μια πρόταση:

KΕΦΑΛΑΙΟ 1ο Χημική σύσταση του κυττάρου. Να απαντήσετε σε καθεμιά από τις παρακάτω ερωτήσεις με μια πρόταση: KΕΦΑΛΑΙΟ 1ο Χημική σύσταση του κυττάρου Ενότητα 1.1: Χημεία της ζωής Ενότητα 2.1: Μακρομόρια Να απαντήσετε σε καθεμιά από τις παρακάτω ερωτήσεις με μια πρόταση: 1. Για ποιο λόγο θεωρείται αναγκαία η σταθερότητα

Διαβάστε περισσότερα

Μάθηµα: Κίνηση πρωτεινών

Μάθηµα: Κίνηση πρωτεινών Μάθηµα: Κίνηση πρωτεινών ιάλεξη 1:Σύνθεση πρωτεινών- Ριβόσωµα Κώστας Τοκατλίδης Η σύνθεση πρωτεινών απαιτεί την µετάφραση αλληλουχίας νουκλεοτιδίων σε αλληλουχία αµινοξέων Οι συνθετάσες των αµινοακυλο-trna

Διαβάστε περισσότερα

ΕΡΕΥΝΗΤΙΚΗ ΕΡΓΑΣΙΑ: AN EXPERIMENTAL BIOLOGY MYSEYM

ΕΡΕΥΝΗΤΙΚΗ ΕΡΓΑΣΙΑ: AN EXPERIMENTAL BIOLOGY MYSEYM Γενικό Λύκειο Μοιρών 2012-2013 ΕΡΕΥΝΗΤΙΚΗ ΕΡΓΑΣΙΑ: AN EXPERIMENTAL BIOLOGY MYSEYM ΩΣΜΩΣΗ-ΜΕΤΟΥΣΙΩΣΗ Γρηγοράκη Αγγελική Ντρετάκη Αγάπη Πηρουνάκη Στέλλα Πολυχρονάκη Παναγιώτα ΠΕΡΙΕΧΟΜΕΝΑ Εισαγωγή..3 Μεθοδολογία.4

Διαβάστε περισσότερα

Οι πρωτεΐνες μπορεί να είναι σφαιρικές (συμπαγείς) ή ινώδεις

Οι πρωτεΐνες μπορεί να είναι σφαιρικές (συμπαγείς) ή ινώδεις Οι πρωτεΐνες μπορεί να είναι σφαιρικές (συμπαγείς) ή ινώδεις Β-1 Οι συμπαγείς, σφαιροειδείς πρωτεΐνες Είναι ευδιάλυτες στο νερό Έχουν σφαιρικό σχήμα Έχουν τα περισσότερα πολικά αμινοξέα στην εξωτερική

Διαβάστε περισσότερα

Η κυτταρική µετατόπιση των πρωτεϊνών

Η κυτταρική µετατόπιση των πρωτεϊνών 9-1 Κεφάλαιο 9 Η κυτταρική µετατόπιση των πρωτεϊνών Εισαγωγή Στο κύτταρο η έκφραση των πρωτεϊνών γίνεται από µόνο ένα τύπο ριβοσώµατος (εκτός των µιτοχονδριακών και των χλωροπλαστικών που µοιάζουν µε αυτά

Διαβάστε περισσότερα

Υλικά Ηλεκτρονικής & Διατάξεις

Υλικά Ηλεκτρονικής & Διατάξεις Τμήμα Ηλεκτρονικών Μηχανικών Υλικά Ηλεκτρονικής & Διατάξεις 3 η σειρά διαφανειών Δημήτριος Λαμπάκης Τύποι Στερεών Βασική Ερώτηση: Πως τα άτομα διατάσσονται στο χώρο ώστε να σχηματίσουν στερεά? Τύποι Στερεών

Διαβάστε περισσότερα

Kυτταρική Bιολογία ΒΙΟΛΟΓΙΚΕΣ ΜΕΜΒΡΑΝΕΣ, ΜΕΜΒΡΑΝΙΚΑ ΔΙΑΜΕΡΙΣΜΑΤΑ & ΔΙΑΛΟΓΗ ΠΡΩΤΕΪΝΩΝ ΔIAΛEΞΗ 4 (6/3/2013)

Kυτταρική Bιολογία ΒΙΟΛΟΓΙΚΕΣ ΜΕΜΒΡΑΝΕΣ, ΜΕΜΒΡΑΝΙΚΑ ΔΙΑΜΕΡΙΣΜΑΤΑ & ΔΙΑΛΟΓΗ ΠΡΩΤΕΪΝΩΝ ΔIAΛEΞΗ 4 (6/3/2013) Kυτταρική Bιολογία ΔIAΛEΞΗ 4 (6/3/2013) ΒΙΟΛΟΓΙΚΕΣ ΜΕΜΒΡΑΝΕΣ, ΜΕΜΒΡΑΝΙΚΑ ΔΙΑΜΕΡΙΣΜΑΤΑ & ΔΙΑΛΟΓΗ ΠΡΩΤΕΪΝΩΝ Οι λιπιδικές διπλοστιβάδες ως φραγμοί Νερό Υδρόφιλες φωσφολιπιδικές κεφαλές Φωσφολιπιδική μεμβράνη

Διαβάστε περισσότερα

ΚΑΤΑΤΑΚΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ ΑΚΑΔΗΜΑΙΚΟΥ ΕΤΟΥΣ 2014-2015

ΚΑΤΑΤΑΚΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ ΑΚΑΔΗΜΑΙΚΟΥ ΕΤΟΥΣ 2014-2015 ΤΕΧΝΟΛΟΓΙΚΟ ΕΚΠΑΙΔΕΥΤΙΚΟ ΙΔΡΥΜΑ ΔΥΤΙΚΗΣ ΜΑΚΕΔΟΝΙΑΣ TECHNOLOGICAL EDUCATION INSTITUTION OF WESTERN MACEDONIA ΚΟΙΛΑ ΚΟΖΑΝΗΣ-GR 50100 I KILA, GR 50101 KOZANI-GREECE http://www.teiwm.gr ΣΧΟΛΗ ΤΕΧΝΟΛΟΓΙΑΣ ΓΕΩΠΟΝΙΑΣ

Διαβάστε περισσότερα

Διαλέξεις Χημείας Αγγελική Μαγκλάρα, PhD Εργαστήριο Κλινικής Χημείας Ιατρική Σχολή Πανεπιστημίου Ιωαννίνων

Διαλέξεις Χημείας Αγγελική Μαγκλάρα, PhD Εργαστήριο Κλινικής Χημείας Ιατρική Σχολή Πανεπιστημίου Ιωαννίνων Διαλέξεις Χημείας -2014 Αγγελική Μαγκλάρα, PhD Εργαστήριο Κλινικής Χημείας Ιατρική Σχολή Πανεπιστημίου Ιωαννίνων 1. Κατάταξη 2. Λειτουργίες 1. Πεπτιδικές ορμόνες 3. Πεπτιδικός δεσμός 1. Χαρακτηριστικά

Διαβάστε περισσότερα

Θέματα πριν τις εξετάσεις. Καλό διάβασμα Καλή επιτυχία

Θέματα πριν τις εξετάσεις. Καλό διάβασμα Καλή επιτυχία Θέματα πριν τις εξετάσεις Καλό διάβασμα Καλή επιτυχία 2013-2014 Θέματα πολλαπλής επιλογής Μετουσίωση είναι το φαινόμενο α. κατά το οποίο συνδέονται δύο αμινοξέα για τον σχηματισμό μιας πρωτεΐνης β. κατά

Διαβάστε περισσότερα

Νανο-τεχνολογία. Νανο-Επιστήμη. Προσέγγιση από κάτω προς τα πάνω

Νανο-τεχνολογία. Νανο-Επιστήμη. Προσέγγιση από κάτω προς τα πάνω Νανο-τεχνολογία Ο σχεδιασμός, ο χαρακτηρισμός, η παραγωγή και η εφαρμογή των δομών, συσκευών και συστημάτων, ελέγχοντας τη μορφή και το μέγεθος σε κλίμακα νανόμετρου Νανο-Επιστήμη Η μελέτη των φαινομένων

Διαβάστε περισσότερα

BIOXHMEIA, TOMOΣ I ΠANEΠIΣTHMIAKEΣ EKΔOΣEIΣ KPHTHΣ ΑΠΕΙΚΟΝΙΣΗ ΜΟΡΙΑΚΩΝ ΔΟΜΩΝ

BIOXHMEIA, TOMOΣ I ΠANEΠIΣTHMIAKEΣ EKΔOΣEIΣ KPHTHΣ ΑΠΕΙΚΟΝΙΣΗ ΜΟΡΙΑΚΩΝ ΔΟΜΩΝ BIOXHMEIA, TOMOΣ I ΠANEΠIΣTHMIAKEΣ EKΔOΣEIΣ KPHTHΣ ΑΠΕΙΚΟΝΙΣΗ ΜΟΡΙΑΚΩΝ ΔΟΜΩΝ ΑΠΕΙΚΟΝΙΣΗ ΜΟΡΙΑΚΩΝ ΔΟΜΩΝ ΜΟΡΙΑΚΑ ΜΟΝΤΕΛΑ 1: ΧΩΡΟΠΛΗΡΩΤΙΚΟ ΜΟΝΤΕΛΟ (SPACE-FILLING) 1: ΧΩΡΟΠΛΗΡΩΤΙΚΟ ΜΟΝΤΕΛΟ (SPACE-FILLING)

Διαβάστε περισσότερα

Εργαστήριο Τεχνολογίας Υλικών

Εργαστήριο Τεχνολογίας Υλικών Εργαστήριο Τεχνολογίας Υλικών Εργαστηριακή Άσκηση 02 Μεταλλογραφική Παρατήρηση Διδάσκοντες: Δρ Γεώργιος Ι. Γιαννόπουλος Δρ Θεώνη Ασημακοπούλου Δρ ΘεόδωροςΛούτας Τμήμα Μηχανολογίας ΑΤΕΙ Πατρών Πάτρα 2011

Διαβάστε περισσότερα

αγωγοί ηµιαγωγοί µονωτές Σχήµα 1

αγωγοί ηµιαγωγοί µονωτές Σχήµα 1 Η2 Μελέτη ηµιαγωγών 1. Σκοπός Στην περιοχή της επαφής δυο ηµιαγωγών τύπου p και n δηµιουργούνται ορισµένα φαινόµενα τα οποία είναι υπεύθυνα για τη συµπεριφορά της επαφής pn ή κρυσταλλοδιόδου, όπως ονοµάζεται,

Διαβάστε περισσότερα

Ασκήσεις 1 & 2. Βάσεις Δεδομένων. Εργαλεία Αναζήτησης ClustalW & Blast

Ασκήσεις 1 & 2. Βάσεις Δεδομένων. Εργαλεία Αναζήτησης ClustalW & Blast Ασκήσεις 1 & 2 Βάσεις Δεδομένων Εργαλεία Αναζήτησης ClustalW & Blast Μοριακή Προσομοίωση Εισαγωγή: Δομική Βάση Βιολογικών Φαινομένων Η αξιοποίηση του πλήθους των δομικών στοιχείων για την εξαγωγή βιολογικά

Διαβάστε περισσότερα

Είναι σημαντικές επειδή: Αποτελούν βασικά δοµικά συστατικά του σώµατος Εξυπηρετούν ενεργειακές ανάγκες Ασκούν έλεγχο σε όλες τις βιοχηµικές διεργασίες

Είναι σημαντικές επειδή: Αποτελούν βασικά δοµικά συστατικά του σώµατος Εξυπηρετούν ενεργειακές ανάγκες Ασκούν έλεγχο σε όλες τις βιοχηµικές διεργασίες ΕΞΕΤΑΣΤΕΑ ΥΛΗ ΕΝΟΤΗΤΑ 2: Η ΧΗΜΕΙΑ ΤΗΣ ΖΩΗΣ 2.1 ΒΑΣΙΚΕΣ ΧΗΜΙΚΕΣ ΕΝΝΟΙΕΣ, 5 9 (απλή αναφορά) 2.2 ΤΟ ΝΕΡΟ ΚΑΙ Η ΒΙΟΛΟΓΙΚΗ ΤΟΥ ΣΗΜΑΣΙΑ, 9 14 (απλή αναφορά), 2.4 ΟΡΓΑΝΙΚΕΣ ΟΥΣΙΕΣ, σελ. 20 36 Οργανικές Ουσίες

Διαβάστε περισσότερα

Γ' ΛΥΚΕΙΟΥ ΤΕΧΝΟΛΟΓΙΚΗ ΚΑΤΕΥΘΥΝΣΗ ΧΗΜΕΙΑ ΒΙΟΧΗΜΕΙΑ ΕΚΦΩΝΗΣΕΙΣ

Γ' ΛΥΚΕΙΟΥ ΤΕΧΝΟΛΟΓΙΚΗ ΚΑΤΕΥΘΥΝΣΗ ΧΗΜΕΙΑ ΒΙΟΧΗΜΕΙΑ ΕΚΦΩΝΗΣΕΙΣ 1 Γ' ΛΥΚΕΙΟΥ ΤΕΧΝΟΛΟΓΙΚΗ ΚΑΤΕΥΘΥΝΣΗ ΧΗΜΕΙΑ ΒΙΟΧΗΜΕΙΑ ΘΕΜΑ 1 ο ΕΚΦΩΝΗΣΕΙΣ Για τις ερωτήσεις 1.1 και 1. να γράψετε στο τετράδιο σας τον αριθµό της ερώτησης και δίπλα το γράµµα που αντιστοιχεί στη σωστή απάντηση:

Διαβάστε περισσότερα

Κεφάλαιο 1. Οι δομικοί λίθοι

Κεφάλαιο 1. Οι δομικοί λίθοι Κεφάλαιο 1 Οι δομικοί λίθοι Κεφάλαιο 1 Οι Δομικοί Λίθοι των Πρωτεϊνών Εικόνα 1.1 Η αμινοξική αλληλουχία μιας πρωτεϊνικής πολυπεπτιδικής αλυσίδας ονομάζεται πρωτοταγής δομή. Διαφορετικές περιοχές της αλληλουχίας

Διαβάστε περισσότερα

BIOXHMEIA, TOMOΣ I ΠANEΠIΣTHMIAKEΣ EKΔOΣEIΣ KPHTHΣ ΑΠΕΙΚΟΝΙΣΗ ΜΟΡΙΑΚΩΝ ΔΟΜΩΝ

BIOXHMEIA, TOMOΣ I ΠANEΠIΣTHMIAKEΣ EKΔOΣEIΣ KPHTHΣ ΑΠΕΙΚΟΝΙΣΗ ΜΟΡΙΑΚΩΝ ΔΟΜΩΝ BIOXHMEIA, TOMOΣ I ΠANEΠIΣTHMIAKEΣ EKΔOΣEIΣ KPHTHΣ ΑΠΕΙΚΟΝΙΣΗ ΜΟΡΙΑΚΩΝ ΔΟΜΩΝ ΑΠΕΙΚΟΝΙΣΗ ΜΟΡΙΑΚΩΝ ΔΟΜΩΝ ΜΟΡΙΑΚΑ ΜΟΝΤΕΛΑ 1: ΧΩΡΟΠΛΗΡΩΤΙΚΟ ΜΟΝΤΕΛΟ (SPACE-FILLING) 1: ΧΩΡΟΠΛΗΡΩΤΙΚΟ ΜΟΝΤΕΛΟ (SPACE-FILLING)

Διαβάστε περισσότερα

ΔΟΜΗ ΚΑΙ ΙΔΙΟΤΗΤΕΣ ΤΩΝ ΚΕΡΑΜΙΚΩΝ. Χ. Κορδούλης

ΔΟΜΗ ΚΑΙ ΙΔΙΟΤΗΤΕΣ ΤΩΝ ΚΕΡΑΜΙΚΩΝ. Χ. Κορδούλης ΔΟΜΗ ΚΑΙ ΙΔΙΟΤΗΤΕΣ ΤΩΝ ΚΕΡΑΜΙΚΩΝ Χ. Κορδούλης ΚΕΡΑΜΙΚΑ ΥΛΙΚΑ Τα κεραμικά υλικά είναι ανόργανα µη μεταλλικά υλικά (ενώσεις μεταλλικών και μη μεταλλικών στοιχείων), τα οποία έχουν υποστεί θερμική κατεργασία

Διαβάστε περισσότερα

σύγχρονο προπαρασκευή για Α.Ε.Ι. & Τ.Ε.Ι. & Group µαθητικό φροντιστήριο Γραβιάς 85 ΚΗΠΟΥΠΟΛΗ

σύγχρονο προπαρασκευή για Α.Ε.Ι. & Τ.Ε.Ι. & Group µαθητικό φροντιστήριο Γραβιάς 85 ΚΗΠΟΥΠΟΛΗ σύγχρονο Φάσµα & Group προπαρασκευή για Α.Ε.Ι. & Τ.Ε.Ι. µαθητικό φροντιστήριο Γραβιάς 85 ΚΗΠΟΥΠΟΛΗ 210 50 51 557 210 50 56 296 25ης Μαρτίου 111 ΠΕΤΡΟΥΠΟΛΗ 210 50 20 990 210 50 27 990 25ης Μαρτίου 74 ΠΕΤΡΟΥΠΟΛΗ

Διαβάστε περισσότερα

Χημικοί Χημικ σμ σμ & Μοριακά Τροχιακά

Χημικοί Χημικ σμ σμ & Μοριακά Τροχιακά Χημικοί δεσμοί & Μοριακά Τροχιακά Χημικός δεσμός είναι η δύναμη που συγκρατεί τα άτομα (ήάλλ άλλες δομικές μονάδες της ύλης, π.χ ιόντα) ) ενωμένα μεταξύ τους. Δημιουργείται, όταν οι δομικές μονάδες της

Διαβάστε περισσότερα

Βιολογικές Μεμβράνες και Μεταγωγή Σήματος

Βιολογικές Μεμβράνες και Μεταγωγή Σήματος ΠΑΝΕΠΙΣΤΗΜΙΟ ΙΩΑΝΝΙΝΩΝ ΑΝΟΙΚΤΑ ΑΚΑΔΗΜΑΪΚΑ ΜΑΘΗΜΑΤΑ Βιολογικές Μεμβράνες και Μεταγωγή Σήματος Πρωτεΐνες Διδάσκουσα: Καθ. Μαρία - Ελένη Ε. Λέκκα Άδειες Χρήσης Το παρόν εκπαιδευτικό υλικό υπόκειται σε άδειες

Διαβάστε περισσότερα

Μέθοδοι μέτρησης μηχανικών ιδιοτήτων κυττάρων και μοντέλα κυτταρικής μηχανικής συμπεριφοράς

Μέθοδοι μέτρησης μηχανικών ιδιοτήτων κυττάρων και μοντέλα κυτταρικής μηχανικής συμπεριφοράς ΕΜΒΙΟΜΗΧΑΝΙΚΗ ΒΙΟΪΑΤΡΙΚΗ ΤΕΧΝΟΛΟΓΙΑ Μέθοδοι μέτρησης μηχανικών ιδιοτήτων κυττάρων και μοντέλα κυτταρικής μηχανικής συμπεριφοράς Πετρόπουλος Ηλίας Σωτηρόπουλος Εμμανουήλ Μέθοδοι μέτρησης των μηχανικών ιδιοτήτων

Διαβάστε περισσότερα

ΗΛΕΚΤΡΟΦΟΡΗΣΗ ΠΡΩΤΕΙΝΩΝ

ΗΛΕΚΤΡΟΦΟΡΗΣΗ ΠΡΩΤΕΙΝΩΝ ΗΛΕΚΤΡΟΦΟΡΗΣΗ ΠΡΩΤΕΙΝΩΝ Άννα-Μαρία Ψαρρά ΤΒΒ, Παν/μιο Θεσσαλίας Λάρισα 2015 ΗΛΕΚΤΡΟΦΟΡΗΣΗ Αναλυτικός τρόπος διαχωρισμού πρωτεϊνών και άλλων μακρομορίων όπως πρωτεϊνών DNA, RNA Αρχή της μεθόδου Μόρια που

Διαβάστε περισσότερα

Κεφάλαιο 5 Δομές β: Τρεις Κατηγορίες

Κεφάλαιο 5 Δομές β: Τρεις Κατηγορίες Κεφάλαιο 5 β-δομές Κεφάλαιο 5 Δομές β: Τρεις Κατηγορίες Οι β-επικράτειες είναι οι δομές οι οποίες αποτελούν την δεύτερη μεγάλη ομάδα πρωτεϊνικών επικρατειών. Η ομάδα αυτή παρουσιάζει τη μεγαλύτερη ποικιλομορφία

Διαβάστε περισσότερα

Σύζευξη σπιν-σπιν J = 0 J 0

Σύζευξη σπιν-σπιν J = 0 J 0 Σύζευξη σπιν-σπιν Ας υποθέσουµε ότι έχουµε δύο πυρήνες Α και Χ, οι οποίοι είτε συνδέονται απ ευθείας µε έναν δεσµό είτε η σύνδεσή γίνεται µε περισσότερους δεσµούς. A X J = 0 J 0 Α Χ Α Χ Το σπάσιµο των

Διαβάστε περισσότερα

ΦΑΣΜΑΤΟΣΚΟΠΙΑ ΟΡΓΑΝΙΚΩΝ ΕΝΩΣΕΩΝ

ΦΑΣΜΑΤΟΣΚΟΠΙΑ ΟΡΓΑΝΙΚΩΝ ΕΝΩΣΕΩΝ ΑΘ.Π.ΒΑΛΑΒΑΝΙΔΗΣ ΦΑΣΜΑΤΟΣΚΟΠΙΑ ΟΡΓΑΝΙΚΩΝ ΕΝΩΣΕΩΝ ΦΑΣΜΑΤΟΣΚΟΠΙΑ ΥΠΕΡΥΘΡΟΥ ΠΥΡΗΝΙΚΟΥ ΜΑΓΝΗΤΙΚΟΥ ΣΥΝΤΟΝΙΣΜΟΥ ΦΑΣΜΑΤΟΜΕΤΡΙΑ ΜΑΖΩΝ ΥΠΕΡΙΩΔΟΥΣ-ΟΡΑΤΟΥ, RΑΜΑΝ, ΗΛΕΚΤΡΟΝΙΚΟΥ ΠΑΡΑΜΑΓΝΗΤΙΚΟΥ ΣΥΝΤΟΝΙΣΜΟΥ Τμήμα Χημείας

Διαβάστε περισσότερα

Φάσμα group προπαρασκευή για Α.Ε.Ι. & Τ.Ε.Ι.

Φάσμα group προπαρασκευή για Α.Ε.Ι. & Τ.Ε.Ι. σύγχρονο Φάσμα group προπαρασκευή για Α.Ε.Ι. & Τ.Ε.Ι. µαθητικό φροντιστήριο Γραβιάς 85 ΚΗΠΟΥΠΟΛΗ 50.51.557 50.56.296 25ης Μαρτίου 74 ΠΛ.ΠΕΤΡΟΥΠΟΛΗΣ 50.50.658 50.60.845 25ης Μαρτίου 111 ΠΕΤΡΟΥΠΟΛΗ 50.27.990

Διαβάστε περισσότερα

β. [Η 3 Ο + ] > 10-7 Μ γ. [ΟΗ _ ] < [Η 3 Ο + ]

β. [Η 3 Ο + ] > 10-7 Μ γ. [ΟΗ _ ] < [Η 3 Ο + ] ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ ΤΑΞΗ ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ ΤΑΞΗΣ ΕΣΠΕΡΙΝΟΥ ΕΝΙΑΙΟΥ ΛΥΚΕΙΟΥ ΠΑΡΑΣΚΕΥΗ 6 ΙΟΥΝΙΟΥ 2003 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΤΕΧΝΟΛΟΓΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ (ΚΥΚΛΟΣ ΤΕΧΝΟΛΟΓΙΑΣ ΚΑΙ ΠΑΡΑΓΩΓΗΣ): ΧΗΜΕΙΑ - ΒΙΟΧΗΜΕΙΑ ΣΥΝΟΛΟ

Διαβάστε περισσότερα

BIOXHMEIA, TOMOΣ I ΠANEΠIΣTHMIAKEΣ EKΔOΣEIΣ KPHTHΣ

BIOXHMEIA, TOMOΣ I ΠANEΠIΣTHMIAKEΣ EKΔOΣEIΣ KPHTHΣ BIOXHMEIA, TOMOΣ I ΠANEΠIΣTHMIAKEΣ EKΔOΣEIΣ KPHTHΣ BIOXHMEIA, TOMOΣ I ΠANEΠIΣTHMIAKEΣ EKΔOΣEIΣ KPHTHΣ Η ΔΙΑΣΠΑΣΗ ΤΟΥ ΠΕΠΤΙΔΙΚΟΥ ΔΕΣΜΟΥ ΚΑΙ ΚΑΤΑΛΥΤΙΚΟΙ ΜΗΧΑΝΙΣΜΟΙ ΠΡΩΤΕΑΣΩΝ Η ΔΙΑΣΠΑΣΗ ΕΥΝΟΕΙΤΑΙ ΘΕΡΜΟΔΥΝΑΜΙΚΑ

Διαβάστε περισσότερα

ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΕΝΙΑΙΟΥ ΛΥΚΕΙΟΥ ΠΕΜΠΤΗ 1 ΙΟΥΛΙΟΥ 2004 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ

ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΕΝΙΑΙΟΥ ΛΥΚΕΙΟΥ ΠΕΜΠΤΗ 1 ΙΟΥΛΙΟΥ 2004 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 1 ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΕΝΙΑΙΟΥ ΛΥΚΕΙΟΥ ΠΕΜΠΤΗ 1 ΙΟΥΛΙΟΥ 2004 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ 1ο 1. β 2. γ 3. α 4. γ 5. δ ΘΕΜΑ 2ο 1. Σχολικό

Διαβάστε περισσότερα

ΑΥΤΟΣΥΓΚΡΟΤΗΣΗ ΥΠΕΡΜΟΡΙΑΚΩΝ ΔΟΜΩΝ ΚΑΨΙΔΙΑ ΙΩΝ ΚΑΙ ΦΑΓΩΝ ΒΑΚΤΗΡΙΑΚΕΣ ΜΑΣΤΗΓΙΝΕΣ ΦΥΣΙΟΛΟΓΙΚΗ ΚΑΙ ΜΗ-ΦΥΣΙΟΛΟΓΙΚΗ ΣΥΣΣΩΜΑΤΩΣΗ

ΑΥΤΟΣΥΓΚΡΟΤΗΣΗ ΥΠΕΡΜΟΡΙΑΚΩΝ ΔΟΜΩΝ ΚΑΨΙΔΙΑ ΙΩΝ ΚΑΙ ΦΑΓΩΝ ΒΑΚΤΗΡΙΑΚΕΣ ΜΑΣΤΗΓΙΝΕΣ ΦΥΣΙΟΛΟΓΙΚΗ ΚΑΙ ΜΗ-ΦΥΣΙΟΛΟΓΙΚΗ ΣΥΣΣΩΜΑΤΩΣΗ ΑΥΤΟΣΥΓΚΡΟΤΗΣΗ ΥΠΕΡΜΟΡΙΑΚΩΝ ΔΟΜΩΝ ΚΑΨΙΔΙΑ ΙΩΝ ΚΑΙ ΦΑΓΩΝ ΒΑΚΤΗΡΙΑΚΕΣ ΜΑΣΤΗΓΙΝΕΣ ΦΥΣΙΟΛΟΓΙΚΗ ΚΑΙ ΜΗ-ΦΥΣΙΟΛΟΓΙΚΗ ΣΥΣΣΩΜΑΤΩΣΗ Αυτοσυγκρότηση υπερμοριακων δομών Υπενθύμιση: κολλαγονο ΚΑΨΙΔΙΑ (ΚΕΛΥΦΗ) ΙΩΝ ΚΑΙ

Διαβάστε περισσότερα

Εργαστηριακή άσκηση 1: Παράγοντες που επηρεάζουν την ταχύτητα διάλυσης μιας ουσίας

Εργαστηριακή άσκηση 1: Παράγοντες που επηρεάζουν την ταχύτητα διάλυσης μιας ουσίας Στόχοι ΧΗΜΕΙΑ Α ΛΥΚΕΙΟΥ Θεματικές Ενότητες (Διατιθέμενος χρόνος) Εργαστηριακές ασκήσεις Ενδεικτικές δραστηριότητες να αναγνωρίζουν τη χρησιμότητα της χημείας σε διάφορους τομείς της καθημερινής ζωής, καθώς

Διαβάστε περισσότερα

ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ ΓΕΝΙΚΗΣ ΠΑΙ ΕΙΑΣ Β ΛΥΚΕΙΟΥ ΑΠΟ ΤΟ ΒΙΒΛΙΟ ΜΟΥ (YΠΟ ΕΚ ΟΣΗ): ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙ ΕΙΑΣ Β ΛΥΚΕΙΟΥ

ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ ΓΕΝΙΚΗΣ ΠΑΙ ΕΙΑΣ Β ΛΥΚΕΙΟΥ ΑΠΟ ΤΟ ΒΙΒΛΙΟ ΜΟΥ (YΠΟ ΕΚ ΟΣΗ): ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙ ΕΙΑΣ Β ΛΥΚΕΙΟΥ ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ ΓΕΝΙΚΗΣ ΠΑΙ ΕΙΑΣ Β ΛΥΚΕΙΟΥ ΑΠΟ ΤΟ ΒΙΒΛΙΟ ΜΟΥ (YΠΟ ΕΚ ΟΣΗ): ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙ ΕΙΑΣ Β ΛΥΚΕΙΟΥ (Περιέχει 67 ερωτήσεις θεωρίας µε απαντήσεις, 116 ασκήσεις ανοικτού- κλειστού τύπου µε µ

Διαβάστε περισσότερα

Κεφάλαιο 2. Μοτίβα πρωτεϊνικής δομής

Κεφάλαιο 2. Μοτίβα πρωτεϊνικής δομής Κεφάλαιο 2 Μοτίβα πρωτεϊνικής δομής Εικόνα 2.1 Το μοντέλο του Kendrew για τη δομή χαμηλής διακριτικότητας της μυοσφαιρίνης όπως φαίνεται από τρεις διαφορετικές οπτικές γωνίες. Οι επιμήκεις περιοχές αντιπροσωπεύουν

Διαβάστε περισσότερα

NH 2 R COOH. Σο R είναι το τμιμα του αμινοξζοσ που διαφζρει από αμινοξφ ςε αμινοξφ. 1 Πρωτεΐνες

NH 2 R COOH. Σο R είναι το τμιμα του αμινοξζοσ που διαφζρει από αμινοξφ ςε αμινοξφ. 1 Πρωτεΐνες 1 Πρωτεΐνες Πρωτεΐνεσ : Οι πρωτεΐνεσ είναι ουςίεσ «πρώτθσ» γραμμισ για τουσ οργανιςμοφσ (άρα και για τον άνκρωπο). Σα κφτταρα και οι ιςτοί αποτελοφνται κατά κφριο λόγο από πρωτεΐνεσ. Ο ςθμαντικότεροσ όμωσ

Διαβάστε περισσότερα