SUPPLEMENTARY INFORMATION

Σχετικά έγγραφα
Table S1. Neutralization IC 50 and IC 80 Titers (µg/ml) of the Antibody VRC08 against 195 HIV-1 Envpesudoviruses,

Molecular evolutionary dynamics of respiratory syncytial virus group A in

N-isobutyl-1-octyl-5-phenyl-1H-imidazol-2-amine (8a). Obtained from the general procedure

Robin A Weiss on behalf of the UCL Vaccine Discovery Consortium: Vaccine-Induced Protective Cross-Neutralization of HIV-1

Laura Albrecht, Katie A. Wilson and Stacey D. Wetmore

Supporting Information

A strategy for the identification of combinatorial bioactive compounds. contributing to the holistic effect of herbal medicines

SIEMENS Squirrel Cage Induction Standard Three-phase Motors

SUPPLEMENTARY INFORMATION

Synthesis of Imines from Amines in Aliphatic Alcohols on Pd/ZrO 2 Catalyst at Ambient Conditions

Loïc Decrey a and Tamar Kohn a *

«Βιοδοκιμές αποτελεσματικότητας ουσιών φυτικής προέλευσης επί του δορυφόρου της πατάτας Leptinotarsa decemlineata (Say) (Coleoptera: Chrysomelidae)»

Supporting Information

ΜΕΤΑΠΤΥΧΙΑΚΗ ΜΕΛΕΤΗ ΟΛΓΑ ΝΑΣΤΑ

New Cytotoxic Constituents from the Red Sea Soft Coral Nephthea sp.

Self and Mutual Inductances for Fundamental Harmonic in Synchronous Machine with Round Rotor (Cont.) Double Layer Lap Winding on Stator

SUPPLEMENTAL INFORMATION. Fully Automated Total Metals and Chromium Speciation Single Platform Introduction System for ICP-MS

CMOS Technology for Computer Architects

CHAPTER (2) Electric Charges, Electric Charge Densities and Electric Field Intensity

IL - 13 /IL - 18 ELISA PCR RT - PCR. IL - 13 IL - 18 mrna. 13 IL - 18 mrna IL - 13 /IL Th1 /Th2

( )( ) La Salle College Form Six Mock Examination 2013 Mathematics Compulsory Part Paper 2 Solution

Supporting Information

GREECE BULGARIA 6 th JOINT MONITORING

Electronic Supplementary Information (ESI)

Chapter 7b, Torsion. τ = 0. τ T. T τ D'' A'' C'' B'' 180 -rotation around axis C'' B'' D'' A'' A'' D'' 180 -rotation upside-down C'' B''

!"!# ""$ %%"" %$" &" %" "!'! " #$!

SUPPORTING INFORMATION

Oscillatory integrals

Solutions 3. February 2, Apply composite Simpson s rule with m = 1, 2, 4 panels to approximate the integrals:

encouraged to use the Version of Record that, when published, will replace this version. The most /BCJ BIOCHEMICAL JOURNAL

Πρόβλημα 1: Αναζήτηση Ελάχιστης/Μέγιστης Τιμής

Supporting Information

West China Journal of Stomatology Vol.29 No.4 Aug.2011 http // GOHAI. Williams AL GOHAI

Solutions_3. 1 Exercise Exercise January 26, 2017

The effect of curcumin on the stability of Aβ. dimers

Cable Systems - Postive/Negative Seq Impedance

encouraged to use the Version of Record that, when published, will replace this version. The most /BCJ

Sample BKC-10 Mn. Sample BKC-23 Mn. BKC-10 grt Path A Path B Path C. garnet resorption. garnet resorption. BKC-23 grt Path A Path B Path C


Το άτομο του Υδρογόνου

... 5 A.. RS-232C ( ) RS-232C ( ) RS-232C-LK & RS-232C-MK RS-232C-JK & RS-232C-KK

Supplementary Figure 1

Supporting Information. Generation Response. Physics & Chemistry of CAS, 40-1 South Beijing Road, Urumqi , China. China , USA

Cellular Physiology and Biochemistry

Supporting Information

Supporting information. An unusual bifunctional Tb-MOF for highly sensing of Ba 2+ ions and remarkable selectivities of CO 2 /N 2 and CO 2 /CH 4

ΜΟΡΙΑΚΕΣ ΜΕΘΟΔΟΙ ΚΡΙΤΗΡΙΑ ΕΠΙΛΟΓΗΣ ΑΞΙΟΛΟΓΗΣΗ

Strain gauge and rosettes

Electronic Supplementary Information

Probing micro-solvation in numbers : The case of neutral dipeptides in water.

ΓΗ ΚΑΙ ΣΥΜΠΑΝ. Εικόνα 1. Φωτογραφία του γαλαξία μας (από αρχείο της NASA)

HONDA. Έτος κατασκευής

Lewis Acid Catalyzed Propargylation of Arenes with O-Propargyl Trichloroacetimidate: Synthesis of 1,3-Diarylpropynes

Supporting Information

Vidyamandir Classes. Solutions to Revision Test Series - 2/ ACEG / IITJEE (Mathematics) = 2 centre = r. a

ΓΕΩΠΟΝΙΚΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΑΘΗΝΩΝ ΤΜΗΜΑ ΕΠΙΣΤΗΜΗΣ ΤΡΟΦΙΜΩΝ ΚΑΙ ΔΙΑΤΡΟΦΗΣ ΤΟΥ ΑΝΘΡΩΠΟΥ ΤΜΗΜΑ ΦΥΤΙΚΗΣ ΠΑΡΑΓΩΓΗΣ ΔΠΜΣ ΑΜΠΕΛΟΥΡΓΙΑ- ΟΙΝΟΛΟΓΙΑ

Supporting Information

Estimation of grain boundary segregation enthalpy and its role in stable nanocrystalline alloy design

ΠΑΝΕΠΙΣΤΗΜΙΟ ΑΙΓΑΙΟΥ ΣΧΟΛΗ ΕΠΙΣΤΗΜΩΝ ΤΗΣ ΙΟΙΚΗΣΗΣ ΠΡΟΓΡΑΜΜΑ ΜΕΤΑΠΤΥΧΙΑΚΩΝ ΣΠΟΥ ΩΝ ΜΕΤΑΠΤΥΧΙΑΚΟ ΙΠΛΩΜΑ ΙΟΙΚΗΣΗΣ ΕΠΙΧΕΙΡΗΣΕΩΝ ΜΕ. Ι..Ε.

BMI/CS 776 Lecture #14: Multiple Alignment - MUSCLE. Colin Dewey

MSM Men who have Sex with Men HIV -

SUPPORTING INFORMATION

!"#$%& '!(#)& a<.21c67.<9 /06 :6>/ 54.6: 1. ]1;A76 _F -. /06 4D26.36 <> A.:4D6:6C C4/4 /06 D:43? C</ O=47?6C b*dp 12 :1?6:E /< D6 3:4221N6C 42 D:A6 O=

Supporting Information for. Update of spectroscopic data for 4-hydroxyldictyolactone and dictyol E isolated from a Halimeda stuposa - Dictyota

Supplementary information

Structures and Reaction Mechanisms of Glycerol Dehydration over H ZSM 5 Zeolite: A Density Functional Theory Study. Supporting Information

ΠΕΡΙΟΔΙΚΟΣ ΠΙΝΑΚΑΣ ΣΤΟΙΧΕΙΩΝ

Supporting Information

Engineering Tunable Single and Dual Optical. Emission from Ru(II)-Polypyridyl Complexes. Through Excited State Design

encouraged to use the Version of Record that, when published, will replace this version. The most /BCJ

Το απόθεμα των σπόρων στο έδαφος σε λιβαδικά οικοσυστήματα του όρους Ψηλορείτη Κρήτης

Probability theory STATISTICAL METHODS FOR SAFETY ANALYSIS FMS065 TABLE OF FORMULÆ (2016) Basic probability theory. One-dimensional random variables

Highly enantioselective cascade synthesis of spiropyrazolones. Supporting Information. NMR spectra and HPLC traces

DuPont Suva. DuPont. Thermodynamic Properties of. Refrigerant (R-410A) Technical Information. refrigerants T-410A ENG

Table S1. Summary of data collections and structure refinements for crystals 1Rb-1h, 1Rb-2h, and 1Rb-4h.

9-amino-(9-deoxy)cinchona alkaloids-derived novel chiral phase-transfer catalysts

[11].,, , 316 6, ,., 15.5%, 9.8%, 2006., IDF,, ,500, 2,830.,, ,200.,,, β, [12]. 90% 2,,,,, [13-15].,, [13,

Appendix B Table of Radionuclides Γ Container 1 Posting Level cm per (mci) mci

Single-site association results for 136 SCARB1 genotyped variants with HDL-C.

CONSULTING Engineering Calculation Sheet

Metal-free Oxidative Coupling of Amines with Sodium Sulfinates: A Mild Access to Sulfonamides

Multifunctinality and Crystal Dynamics of Highly Stable Porous Metal-Organic Framework [Zn 4 O(NTB) 2 ]

If ABC is any oblique triangle with sides a, b, and c, the following equations are valid. 2bc. (a) a 2 b 2 c 2 2bc cos A or cos A b2 c 2 a 2.

Fe II aq Fe III oxide electron transfer and Fe exchange: effect of organic carbon

Copper-Catalyzed Oxidative Coupling of Acids with Alkanes Involving Dehydrogenation: Facile Access to Allylic Esters and Alkylalkenes

ITU-R P (2012/02) &' (

LAPLACE TYPE PROBLEMS FOR A DELONE LATTICE AND NON-UNIFORM DISTRIBUTIONS

Math221: HW# 1 solutions

Copper-catalyzed formal O-H insertion reaction of α-diazo-1,3-dicarb- onyl compounds to carboxylic acids with the assistance of isocyanide

Νόµοςπεριοδικότητας του Moseley:Η χηµική συµπεριφορά (οι ιδιότητες) των στοιχείων είναι περιοδική συνάρτηση του ατοµικού τους αριθµού.

Electronic Supplementary Information (ESI)

(... )..!, ".. (! ) # - $ % % $ & % 2007

20/01/ of 8 TOW SSD v3. C 2.78AC Σ Cumul. A*C. Tc 1 =A14+1 =B14+1 =C14+1 =D14+1 =E14+1 =F14+1 =G14+1 =H14+1 =I14+1 =J14+1 =K14+1

Electronic Supplementary Information:

Second Order RLC Filters

Na/K (mole) A/CNK

Probability and Random Processes (Part II)

Japanese Fuzzy String Matching in Cooking Recipes

Supporting Information for: electron ligands: Complex formation, oxidation and

BGP TRACP-5b BGP TRACP-5b P 0.05

Transcript:

SUPPLEMENTARY INFORMATION doi:.8/nture7 Supplementry Tble. Serum neutrlizing ctivity of selected donors. Clde A Clde B Clde C CRF_AE Donor presumed clde Score 94UG 9BR JRCSF MGRM-C6 9IN95 9TH #6 CRF_AG.67 9 9 7 7 7 7 #84 A or D. 7 7 7 #7 A.8 7 9 7 7 < #9 C.8 9 9 7 7 Supplementry Tble : Antibody sequence chrcteristics Hevy Chin Sequences Puttive V- CDR length Somtic muttions Somtic muttions Muttion frequency Muttion frequency Nme Donor gene gene (mino cids) b CDR sequence (mino cids) (nucleotides) c (mino cids) c (nucleotides) c (mino cids) c PGT TLHGRRIYGIVAFNEWFTYFYMDV 65 7 7 % % 7 IGHV4-59* IGHJ6* 4 Insertion/Deletions (number of mino cids/position) PGT TKHGRRIYGVVAFKEWFTYFYMDV 68 8 % 4 % PGT ALHGKRIYGIVALGELFTYFYMDV 79 5 % 7 % PGT5 FDGEVLVYNHWPKPAWVDL 78 6 % 7 % +6 in CDR PGT6 FDGEVLVYHDWPKPAWVDL 67 7 % % +6 in CDR PGT7 FGGEVLVYRDWPKPAWVDL 58 5 % % +6 in CDR PGT8 6 IGHV4-9*7 IGHJ5* 9 FGGEVLRYTDWPKPAWVDL 75 6 9 % 8 % +6 in CDR PGT SGGDILYYYEWQKPHWFSP 8 4 % 4 % PGT SGGDILYYIEWQKPHWFYP 84 4 % % PGT5 HRHHDVFMLVPIAGWFDV 67 7 7 % 9 % +5 in CDR PGT6 9 IGHV4-9*7 IGHJ5* 8 HKYHDIFRVVPVAGWFDP 6 5 % 5 % +5 in CDR/+ in CDR PGT7 HKYHDIVMVVPIAGWFDP 77 8 % 9 % +5 in CDR PGT4 GSKHRLRDYVLYDDYGLINYQEWNDYLEFLDV 5 9 % % or + in CDR d PGT4 GSKHRLRDYVLYDDYGLINYQEWNDYLEFLDV 5 % % or + in CDR d PGT4 84 IGHV-8* IGHJ6* / GSKHRLRDYVLYDDYGLINYQEWNDYLEFLDV 5 9 % % or + in CDR d PGT44 GSKHRLRDYVLYDDYGLINQQEWNDYLEFLDV 59 4 % 4 % or + in CDR d PGT45 GSKHRLRDYFLYNEYGPNYEEWGDYLATLDV 7 9 8 % 9 % - or in CDR d Puttive J- Light Chin Sequences Puttive V- CDR length Somtic Somtic Muttion Muttion Insertion/Deletions muttions muttions frequency frequency (number of mino Nme Donor gene gene (mino cids) b CDR sequence (mino cids) (nucleotides) c (mino cids) c (nucleotides) c (mino cids) c cids/position) PGT HIWDSRVPTKWV 56 8 % % -7 in FR/+ in FR PGT 7 IGLV-* IGLJ* HIWDSRRPTNWV 58 7 9 % 6 % -7 in FR/+ in FR PGT HIYDARGGTNWV 7 9 4 % 8 % -7 in FR/+ in FR PGT5 GSLVGNWDVI 46 5 % % -5 in CDR PGT6 SSLVGNWDVI 8 4 9 % % -5 in CDR PGT7 IGLJ* or SSLVGNWDVI 7 9 % % -5 in CDR 6 IGLV-8* PGT8 IGLJ* GSLVGNWDVI 7 4 9 % 4 % -5 in CDR PGT SSLFGRWDVV 9 % 9 % PGT SSLSGRWDIV 44 5 % % PGT5 QQYEEWPRT 5 9 6 % 8 % PGT6 9 IGKV-5* IGKJ* 9 QQYEEWPRT 9 % % PGT7 QQYEEWPRT 5 9 % 8 % PGT4 MQGLNRPWT 46 4 % % PGT4 MQGLNRPWT 46 4 % % IGKV-8* or PGT4 84 IGKJ* 9 IGKVD-8* MQGLNRPWT 46 4 4 % % PGT44 MQGLNRPWT 44 5 % % PGT45 MQGLHSPWT 5 6 6 % 4 % ) Puttive V- or J-gene of the common germline ncestor of ech clonlly relted ntibody cluster. b) CDR lenghts ccording to the Kbt definiton. c) Somtic muttions were counted over the whole vrible region s nucleotides or mino cids differing from puttive germline sequence. For ech cluster of clonlly relted ntibodies, germline sequence ws composed of the puttive V-gene, consensus junction, the puttive J-gene, nd consensus insertion where present. Sequences derived from ' cloning primers were excluded from the frequency clcultions. d) Either n insertion in PGT4 to 44 or deletion in PGT45. e) Insertion of two mino cids in J-region due to mispriming in cloning PCR. WWW.NATURE.COM/NATURE

RESEARCH SUPPLEMENTARY INFORMATION Supplementry Tble : Medin ICs nd percent viruses neutrlized A) Medin IC 5 (μg/ml) ginst viruses neutrlized with n IC 5 < 5 μg/ml Clde n PGT PGT PGT PGT5 PGT6 PGT7 PGT8 PGT PGT PGT5 PGT6 PGT7 PGT4 PGT4 PGT4 PGT44 PGT45 VRC PGV4 b G 4E A 6..7......9.9.64.4.7..5.7.8.4..6.4 6.98 7. 5.95 B......6..9.7.5.9 8.55.48.4.9.7.9.4.4.7.8.8 5.9 C 7....8.8.55.4.5.78.5 7.5...9.7.85.4..48.79 5.46.9.98 D 5....9.4.49..65.85.69.5 6..7.9.8..7..44.44.47 4.57 4.54 F 5..4.9.4.8.65.5.7.56. 4.75 6..4..6.5.8.9.9.8 n 9..6 G 5..5.4..8..4 4.4.54.4 8.95.....84..7..8.99..44 AE n n n..77 n.6.7.8 n n n.....97..56.4.7 n.6 AG.49.75.6...4.67.4.8 7.7 9. 8..5.6. 8.6.6.56...4.95.4 All 6..5..4.4.8..6.5.7 7.8.46.5...6.9....8.8.4 B) Percent viruses neutrlized with n IC 5 < 5 μg/ml Clde n PGT PGT PGT PGT5 PGT6 PGT7 PGT8 PGT PGT PGT5 PGT6 PGT7 PGT4 PGT4 PGT4 PGT44 PGT45 VRC PGV4 b G 4E A 6 6 58 58 65 54 5 58 5 8 9 4 65 69 65 46 8 85 9 5 96 B 84 84 8 74 8 8 8 65 45 9 9 9 5 5 5 9 77 74 94 58 7 97 C 7 85 8 85 56 74 5 78 48 4 7 7 7 7 5 7 67 89 7 6 89 D 5 48 4 48 4 5 48 6 44 6 4 4 8 8 8 6 7 76 84 76 48 4 96 F 5 9 8 8 7 8 6 67 67 67 5 67 9 9 G 5 8 8 8 7 5 4 67 47 4 4 7 67 67 67 8 8 9 87 AE 6 4 6 8 6 4 4 4 9 9 4 AG 7 6 6 5 4 9 5 4 5 6 5 7 8 9 5 All 6 7 65 67 5 6 5 7 5 4 6 56 57 56 8 78 77 9 88 4 96 C) Medin IC 5 (μg/ml) ginst ll viruses Clde n PGT PGT PGT PGT5 PGT6 PGT7 PGT8 PGT PGT PGT5 PGT6 PGT7 PGT4 PGT4 PGT4 PGT44 PGT45 VRC PGV4 b G 4E A 6.87.9.69.6..7.5 4.9 5. 5. 5. 5..9. 6.4 5..6..8.4 5. 5. 6.9 B..5.4.6.4.. 5.7 5. 5. 5. 5.. 5.5 5.89 5..4.8.4.5 4.7.9 5.76 C 7..4. 7.48.79 9.9.8 5. 5. 5. 5. 5..8.79.8 48.89.49.57.7.76 5. 5..98 D 5 5. 5. 5. 5. 4.4 5..4 5. 5. 5. 5. 5. 5. 5. 5. 5...9.58. 5. 5. 5. F 5.7.9. 5. 5. 5.. 5. 5. 7.79 5. 5..5.8.98.56.8.58.9.8 5. 5..6 G 5.6.5.8 5. 48.85 5.. 5. 5. 5. 5. 5. 4.69 5.95 4.77 5...5.. 5. 5..44 AE 5. 5. 5..6 5. 5...58.6 5. 5. 5. 5. 5. 5. 5..7..56.6 5. 5..6 AG.6 8.45 8.4 5..7 5..6.75 5. 5. 5. 5.. 6.4 4.4 5..7.47.6. 5. 4..4 All 6...5 4.97.8 4.8..98 5. 5. 5. 5. 6. 9.46.76 5..86.6.4. 5. 5..5 D) Medin IC 9 (μg/ml) ginst viruses neutrlized with n IC 9 < 5 μg/ml Clde n PGT PGT PGT PGT5 PGT6 PGT7 PGT8 PGT PGT PGT5 PGT6 PGT7 PGT4 PGT4 PGT4 PGT44 PGT45 VRC PGV4 b G 4E A 6...8.7.8.6.4 4.99.7. n.54.88.7.57 4.5 4..4..45 48.45 7.77 4.6 B..5.4..7.6.7.77.5.87.9 n 4.6 9.5.84 7.8.54.6.5.66 5.96 4.9. C 7..7.8.8.98 7.99.7.67 5.8.8.8..8.69..4.76 7.68 6.8.8 7.4 8.67. D 5....87..8..8.67.. 6. 5. 9.75 8.6 9.6 5.7.8 5.7..68 8.77.46 F 5.7 5.5.74.7..86.7 4.84.9.6 n.9 4.55.45 6.8 7.79 9.74.5.7.4 n.5 7.6 G 5..65.9.5.7.67. 8.6 n. 7.54.45.58.99.85 7.57.8 6.5.44.74.8 n 6.57 AE n n n. 9.58 n.47.8. n n n...5.4.9. 4.8 8.8.68 n.96 AG.56.97.7.5.8.4..7.6 n n n.66 5.5 4.97 n.87.6.7.97 6.98 7.4 5.6 All 6..6.6.6.7.46..68.54..9..89.75.6 8.7...79. 6. 6.96.7 E) Percent viruses neutrlized with n IC 9 < 5 μg/ml Clde n PGT PGT PGT PGT5 PGT6 PGT7 PGT8 PGT PGT PGT5 PGT6 PGT7 PGT4 PGT4 PGT4 PGT44 PGT45 VRC PGV4 b G 4E A 6 5 5 5 54 5 46 5 4 8 46 5 4 46 69 88 88 4 4 B 8 77 77 58 74 65 77 4 9 9 9 6 9 84 45 5 6 C 7 67 59 6 6 48 8 67 6 48 58 5 9 58 48 8 48 7 4 4 D 5 6 8 6 8 48 6 8 8 4 4 6 8 6 4 7 56 8 F 5 6 7 5 7 5 7 7 47 5 47 7 67 4 9 7 4 G 5 6 6 47 7 47 7 7 47 4 7 67 4 9 87 5 AE 4 5 5 4 6 7 8 7 AG 4 5 5 4 9 6 All 6 55 54 5 7 45 6 57 8 9 7 5 7 5 4 4 5 46 89 77 9 5 4 F) Medin IC 9 (μg/ml) ginst ll viruses Clde n PGT PGT PGT PGT5 PGT6 PGT7 PGT8 PGT PGT PGT5 PGT6 PGT7 PGT4 PGT4 PGT4 PGT44 PGT45 VRC PGV4 b G 4E A 6 47.89 48.7.6 6.6 6.7 5. 9.8 5. 5. 5. 5. 5. 5. 5. 5. 5. 5..7.8.6 5. 5. 5. B..4.4.49.9.7. 5. 5. 5. 5. 5. 5. 5. 5. 5. 6.5 5..5.5 5. 44. 5. C 7.47 7.99 7.9 5. 5. 5..54 5. 5. 5. 5. 5. 5. 4. 5. 5..57. 6.7 5. 5. 5. 5. D 5 5. 5. 5. 5. 5. 5. 5. 5. 5. 5. 5. 5. 5. 5. 5. 5. 5. 5. 8.77 7.58 5. 5. 5. F 5.88.47 5.5 5. 5. 5. 8.4 5. 5. 5. 5. 5. 5. 4.5 5. 5. 6.4 5..7.5 5. 5. 5. G 5. 6.5 5. 5. 5. 5. 5. 5. 5. 5. 5. 5. 5. 5. 5. 5. 9.9 5..69.7 5. 5. 9.65 AE 5. 5. 5. 5. 5. 5. 9. 5.65 5. 5. 5. 5. 5. 5. 5. 5. 9.7.78 4.8. 5. 5. 9.49 AG 5. 5. 5. 5. 5. 5. 4.87 5. 5. 5. 5. 5. 5. 5. 5. 5. 5.44 5..4.97 5. 5. 6.5 All 6.49 8. 6.5 5. 5. 5..7 5. 5. 5. 5. 5. 5. 5. 5. 5.. 45.5. 4. 5. 5. 5. WWW.NATURE.COM/NATURE

SUPPLEMENTARY INFORMATION RESEARCH Supplementry Tble 4. Neutrlizing ctivity of PGT mabs ginst cross-clde 6-pseudovirus pnel. IC5 (µg/ml) IC5 (/dil'n) Isolte Subtype PGT- PGT- PGT- PGT-5 PGT-6 PGT-7 PGT-8 PGT- PGT- PGT-5 PGT-6 PGT-7 PGT-4 PGT-4 PGT-4 PGT-44 PGT-45 VRC PGV4 #7 #84 #6 #9 9RW8....4.8...89..47 >5.48.579.447.85 >5.4.7.4.6 65.7 9.5 84. 644. 9RW9.79 4.46 5.68.44 >5 >5.8.74.5 >5 >5 >5..6..89.6.87.8.5 46.6 47.6 4. < 9RW.4.9..4.6..5.9.68.67.5.5 >5.5 >5 >5.997..55.4 567. 48. 67. 7. 9RW.9..5.5.6..5.4. >5 >5.56 >5 >5 >5 >5.6.66.8.7 4.6 9. 44.8 48. 9RW4 >5 >5 >5 5.5 4.995 >5 >5 >5 >5 >5 >5 >5.75.69. 6.46.69.7..58 < 57.7 49.7 78. 9RW6.4.6..7.8.4..7.4.68 >5.9.78.78 5.64.69.45 N/A.4.64 56. 77. 8.4 46. 9UG >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5.9.5.95.75..469 4.46.65 < 8.5 4. 459. 9UG7..68..5..4.6.6.48.67 >5 >5.76.557.854 8.4.48.45.45.4.4 5.8 4.8 4. 9RW9 >5 >5 >5 >5 >5 >5 >5 4.64 >5 >5 >5 >5.9.4.5 4.9 >5.57.54.69 < 589. < 7. 9UG77.9.84.8...55.4.9 >5 >5 >5 >5 >5 >5 >5 >5 >5.97.8 >5 8.8 6.4 77. 46. 94UG.58.4.678.8.8.7..4.97 >5 >5 >5 >5 >5 >5 >5..85..4 9.4 8. 8.4 568. MGRM-A- >5 >5 >5.9 >5 >5 >5 >5 >5 >5 >5 >5.9.69.74..6 >5 6.78 >5 <.7 < 49. MGRM-A-..7...5 9.4.49. >5 >5 >5 >5.7.7.6.85.9 N/A.9. 89. 5. 78. 64. MGRM-A- A.45.794.495 >5 >5 >5 >5 >5 >5 >5 >5 >5 7.96 9.9.54 >5.5.4.8.94 < 6. < 75. MGRM-A-4 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5.7..7.855.68.64.75. < 4567. < 9. MGRM-A-5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5. 9.695 7.48 8.59.8.95.4.75 < 5. < 8. MGRM-A-6.96 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5.5.44 >5 6.6 646.5. 564. MGRM-A-7 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5.584 7..6 < < < 556. MGRM-A-8 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5..555 >5 < < < 96. MGRM-A-9.6..4.9.4..5.8.5 >5 >5 >5.9.58.5.84.5.8.. 455.8 8.7 6.4 86. MGRM-A-.444.59.75.4..7.5.5. >5 >5 >5..5.9.79.8.5.5. 7. 74. 779. 79. MGRM-A- >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5.484.7.9. < 4. < 69. MGRM-A-.9.57.9.77.97.5.5 >5 >5 >5 >5 >5 >5 >5 >5 >5. >5.5 9.94 9.9 < 7.6 5. MGRM-A-.87.474.565.4.6.9.8 >5 >5 >5 >5 49.88 9.856.75 9.4 >5.76.5.86. 89. 6.8 85.9 776. MGRM-A-4..7..9..4.7.6 5.444.66 >5 8.576.68.67.7 >5.57.5.7.48 7.6 4.6 75. 68. VLGCA >5 >5 >5.78 >5 >5.88 >5 >5 >5 >5 >5.67.754 7.89 >5 8.9.6.4.69 <.. < 94KE5 AC.9.56.4.4.6..7.4..6 >5 8.548.4.9.68.9.7.499.98 7.875 955. 5. 454. 6. 9TH >5 >5 >5.6.97 >5..9.4 >5 >5 >5....5..66.89.59 < 598... CMU >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5.45.55.8 >5 <. <. MGRM-AE- >5 >5 >5.948 9.684 >5.69.5 4.85 >5 >5 >5 >5 >5 >5 >5.96.67.6.586 < <.6. MGRM-AE- >5 >5 >5 >5 >5 >5.5.54 >5 >5 >5 >5 >5 >5 >5 >5.868.7.569.4 < 69. 54. 49. MGRM-AE- >5 >5 >5.9 >5 >5.8.7.47 >5 >5 >5 >5 >5 >5 >5.55.685 6.4.44 < 5. < 8. MGRM-AE-4 AE >5 >5 >5 >5 >5 >5 >5.49 >5 >5 >5 >5....4.6.87.8.9 < 696.5.7. MGRM-AE-5 >5 >5 >5..4 >5..6.7 >5 >5 >5 >5 >5 >5 >5.967.9.5.8 < 8. 77. 65. MGRM-AE-6 >5 >5 >5.9 7.68 >5.44.9.6 >5 >5 >5 >5 >5 >5 >5 >5 4.648 >5.6 < 7.5 5.7 94. MGRM-AE-7 >5 >5 >5.876 >5 >5 >5.8.6 >5 >5 >5. 6.697.558 >5.8.85 5.75.8 < 7.9 444.5 84. MGRM-AE-8 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5..8.5.55.464.75.5.48 < 6.7 < 4. MGRM-AG-.96 4.47.59 >5 >5 >5 4.7 >5 >5 >5 >5 >5 8..4 8.9 >5.64.8.8 7.5 74.8 9.. 499. MGRM-AG- >5 >5 >5 >5 >5 >5 4.987 >5 >5 >5 >5 >5.49.44.76 7.78.56.95.879.76 5.5 748. 9.4 6. MGRM-AG-.465 4.66 >5 >5 >5 >5 4.787.4.97 >5 >5 >5 >5 >5 >5 >5 >5.4.58 >5 < 55. <. MGRM-AG-5.649.86.49 >5.7.59.7.54.4 >5 >5 >5.497.8.4 >5.45.9.7 >5 57. 775.6 865.9 78. MGRM-AG-6.4.8.4.8...9.9.9 7.89 9.8 8.98 >5 >5 >5 >5 6.6.44. >5 5.. 46. 56. MGRM-AG-8 AG.494 >5 9.6 >5 >5 >5.668 >5 >5 >5 >5 >5 9.4.5 4.9 >5.44.4.484. 5. 87.8 < 69. MGRM-AG-9.8.8.7.6..59. 9.46 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5.48 >5 55..4. 8. MGRM-AG- >5 >5 >5 >5.45 >5.9 >5 >5 >5 >5 >5.8.8.56 44.56..84.7.7 < 785.8 8. 74. MGRM-AG- >5 >5 >5 >5 >5 >5 >5 >5 >5 4.885 >5 >5 >5 >5 >5 >5 >5..4.845 4.9 < 6.6 5. MGRM-AG-.557.5.7.4.8.8.4.. >5 >5 >5 >5.79 >5 >5 4.87.97..59. 9. 55.6. IC5 (µg/ml) IC5 (/dil'n) b Isolte Subtype PGT- PGT- PGT- PGT-5 PGT-6 PGT-7 PGT-8 PGT- PGT- PGT-5 PGT-6 PGT-7 PGT-4 PGT-4 PGT-4 PGT-44 PGT-45 VRC PGV4 #7 #84 #6 #9 655..5.6.4......56 >5 >5 >5 >5 >5 >5 >5 >5.755.757.5 7. 477.8 848. 87. 9BR.4..8.6.5.59.9.95 6.57.7 8.68 7.8.99 5.46 5.89 44.6.5.9.5 >5 6.7 6. 74. 4. 9TH5.7..8.8..7.6..6 >5.4 >5 >5 5.856 7.7 >5..4.55 8.4 675. 88. 5.7 6. APV_.5.778.8.7..6.8.5.89.76 >5 >5 >5 >5 >5 >5.7.657.7 >5 77.8.6 46. 7. APV_7.66.5.4 8.6.5.78.6.66 >5 >5 >5 >5.59.68.8.98.488.477.9 4.778 47. 6.5 79.4 48. APV_6.8.9...7.4.7 >5 >5 >5 >5 >5 4.6 4.75.968 >5.4.8 4.87.8 94.6 5. 5.9 76. CAAN.A...5 5.467.7.7.48 >5 >5 5.54 >5 >5 >5 >5 >5 >5 7.85.7.6 9.67 74. 7. 48.8. JRFL..6.4.9.4.9.7.46.454 >5 >5 >5 >5 >5 >5 >5.4.4. >5 9.5 48.5 858. 47. MGRM-Chronic-B-..8.5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5..66.48 >5. 6.6 46. 9. MGRM-Chronic-B-.86.8.4.64.78.79.6 >5 >5 >5 >5 >5 >5 >5 >5 >5.67.7.4.49. < 44.4. MGRM-Chronic-B-..8.8.57.4..7 >5 >5 >5 >5 >5.4.484.854 7.48.45..58 >5 664.9 7. 7.4. MGRM-Chronic-B-4.9.8.8.7..8.9..4 >5 >5 >5.586.7.95 9.45..55.47.5 874.9 796.5 46. 4. MGRM-Chronic-B-8.7.7. >5 5.89.55.4 5.8 >5 >5 >5 >5 >5 >5 >5 >5.9.55.66 8.784 85. 5.8 6. 685. MGRM-Chronic-B-.4.8.9.6.5.9.4.6.6 >5 >5 >5 >5 >5 >5 >5 >5.56.744.4 45.5 44. 4.8 8. MGRM-Chronic-B- >5 >5 >5.8.8.97..5 6.468 >5 >5 >5.4.994.557 5.67.6.587.497 >5.8 458.4. 759. MGRM-Chronic-B-.6.66.7.6.7.75.6.7 5.78.66 4.4 >5 >5 >5 >5 >5 9.6. >5. 9.5 48.6 64. 664. B MGRM-Chronic-B-7 >5 5.664 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5.47.76.45.7.54.4.9.688.7 7.6 < 8. MGRM-Chronic-B-8 >5 >5 >5 >5.5.896..87 >5 >5 >5 >5.57..77.97..8.64.6 < 6.7 89. 75. MGRM-Chronic-B-.4.5.5.87..5.7.4.5.57 >5.85 >5 >5 >5 >5 >5.44.6 >5 4. 9. 858.8 5. MGRM-Chronic-B-.5..55 >5 >5 >5 >5 >5 >5.9 >5 >5.8.486.6 >5.9.75.9.7 6.5 95. 96.7 5. MGRM-Chronic-B-4.95.8 >5 >5 >5 >5 >5 5.776 >5 >5 >5 >5..5..4.8.77.57. 57. 6. 4.. PVO.4.7.689.5.4.7.64.5 5.7 >5 >5 >5 >5..66.6.55.99.8.454 4.75.9 9.4 4.8. QH69.4.8.49.58.48.48.9.9 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5.94.94 >5 75. < 7.6 59. SC466.8.98..9.8.9 6.688.578 >5 >5.75 >5 >5.656.5.7 >5.79.79..477 67. 8.7 <. SF6.5.9.5.4..9.7.7.5..48.47 >5 >5 >5 >5 >5.4.8 >5 59. 49. 5. 4. THR.8 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5.7..6.9..46 >5 6.79 < 6. 7.7 6. TRJ455.58 7.95 >5 6.9.9.5.6.9..88 >5 >5 >5 >5 >5 >5 >5 >5.6.8.858 5.5 4. 46. 67. TRO..8..8..4.79.8.57.9..7 9.49.8.7.9 4.78.44.86. 6.865 76.9 86. 454.5 74. VLGCB.5.8.4.5.7.. 4.596 >5.4 >5.6 >5 >5 >5 >5 >5.8.45. 96.7 8.5. 754. NL4 >5 >5 >5 >5 >5 >5 >5 >5 >5 8.4 7.695 7.444 >5 >5 >5 >5.6..8 >5 48. 8.8.8 84. JRCSF.7.57.46.4.8.8...9. >5 >5.9..7.49..64.78. 86. 655.4 7. 4. 9IN95.5..4.9.5.4.9..77...4......8..5 496.9 487..8 667. 9MW959..6. 7.48 9.44 6.95.45 8.548 >5 >5 >5 >5......5 >5.54 6. 67.8 76. 56. 97ZA..4..465.4 >5.9.8.84 >5 >5 >5 >5 >5 >5 >5.95.88.4.4 85. 8. 4. 594. 98IN.7...57.79 9.89.4 >5 >5.4.6.48....7.5.4 5.69. 7.8 597. 79.6 98. MGRM-C- 7.48 9. 4.46 >5 >5 >5 >5 >5 >5. 7.58.5 >5 >5 >5 >5 >5.69 >5 >5 < 7. < 74. MGRM-C-.9...8..57.9 >5 >5 >5 >5 8.4 7.84.55 6.766 >5.8.577 >5 >5 799. 7.6 74. 556. MGRM-C-4...9.85..5.5.756.74.46.4.6 >5 >5 >5 >5 >5.7.899. 77.9 4.5 7.9 64. MGRM-C-5.5.7..87.98.57..95.56 >5 >5 >5 8.8.854 9.9 >5 >5 5.47.898 8.74.5 45. 8. 6. MGRM-C-6.7.8..5.4.9.4.95.6 >5 >5 >5..478.69 48.894.. >5.47 68.6. 5. 564. MGRM-C-7.96.48.547 >5 5.98 >5. >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5.64.7 44. < 44. MGRM-C-8..8. >5.8 >5.7 7.77 >5 >5 >5 >5 >5 >5 >5 >5 >5.445.79 >5 74.. < 9. MGRM-C-9 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5.4.6..56.9.6.4 >5 < 46.9 < 4. MGRM-C- >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5.4.7.7 7.66.4.85.99 >5 < 86.6 < 6. MGRM-C-...66 >5..7.58 >5 >5.7 >5. >5 >5 >5 >5 6.984.7.5.6 76. 5.6 69.8 5. C MGRM-C- 7.8.575 4.879 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 < < < 45. MGRM-C-4 6.94 >5. >5 >5 >5 >5 >5 >5 >5 >5 >5.87 6.4 8.8 >5 5.86 >5.9.99 < 7.6 < < MGRM-C-5 5.7 >5.4 >5.4 >5.96.44.5.4.66.98..8.85.6..569.98.47 4.6 544. 5.4 95. MGRM-C-7.9.5..58.7.97.65 >5 >5 >5 >5 >5 4.8. 5.7.5 >5.66.8.688 54.6 5.7 66.4 587. MGRM-C-9 >5 >5 >5..6.7....64. >5.8..4.5.5.6 9.6.5 < 4576.4 8.6 44. MGRM-C- >5.955 >5 >5 >5 >5 5.846 >5 >5 >5 >5 >5.6.446.797.88.7.96. >5.9 45.6 5. < MGRM-C-.5....96.4.4.7.78 >5 >5 >5.8.86..578.49.989 8.8.46 97.8 9. 75.8 658. MGRM-C-.7.7..4.65.8.6.5.4.6.98..5.87.48.8..77.8.64 46.6 54.6 85. 58. MGRM-C-4.5..95 >5 >5 >5 >5 >5 >5 >5 >5 >5...5.64.74.95 >5.7 78. 67. < 7. MGRM-C-5 46.75 8.69.4 4.54.786 >5.489 >5 >5 >5 >5 >5.47.8.6 7.55.44.64 >5.48 8. 886. 9.6 65. MGRM-C-6..6..5.7.4.7.6.674.4.6. >5 >5 >5 >5 >5.77..6 65.8. 48. 9554. MGRM-C-7..9. >5 5.557 >5.8.8.65 >5 >5 >5.75.79.598 >5.95.5.76 5.58 68. 859. 66.4 869. MGRM-C-8.47.6.4 4..96 7.567 4.4 >5 >5.474.676 >5.77.7.67 >5.99.9.49.67 5. 6. < 5. WWW.NATURE.COM/NATURE

RESEARCH SUPPLEMENTARY INFORMATION IC5 (µg/ml) IC5 (/dil'n) b Isolte Subtype PGT- PGT- PGT- PGT-5 PGT-6 PGT-7 PGT-8 PGT- PGT- PGT-5 PGT-6 PGT-7 PGT-4 PGT-4 PGT-4 PGT-44 PGT-45 VRC PGV4 #7 #84 #6 #9 98CN9 CRF7_BC.9..7..9.9.5.6 4.5.7.48 5.59.77.999.6 >5.6.46.5.7 55. 469.5 756. 4. 98CN6 CRF8_BC...8..46.67.5.58 5.86.49.46.7 >5 >5 >5 >5 >5.655. >5 98.7 65. 67. 98. 9UG >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5.59.55 >5 < < < 6. 9UG5 8.9 >5 9.794 >5.7.7.8.959.854 >5 >5 >5 >5 >5 >5 >5 >5.576.44 >5 65.5 < 59. 48. 9UG4 >5 >5 >5 >5 >5 >5 >5 >5 >5..5.6 >5 >5 >5 >5.6.576..86 <. 8. 9. 9UG46 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5.687.6.86 <.5 < 7. 94UG4.4..5.49.8 7.9.8 >5 >5.89 >5 >5 >5 >5 >5 >5...46 4.68 59. < 9. 548. MGRM-D-.65..47.87.84.4.8 >5 >5 >5 >5 >5 >5 >5 >5 >5.56 >5 >5 >5 < <.8 < MGRM-D-.6.5..8.9.6..869.5 >5 >5 >5 >5 >5 >5 >5 >5.5.. 596.5 < 76.4 44. MGRM-D-.685 >5.76.65..9.9.65 9.64 >5 >5 >5 >5 >5 >5 >5.6.64 >5. 8. 695.8 44.7 76. MGRM-D-4 >5 >5 >5.7 >5 >5 4.887.8.7 >5 >5 >5 >5 >5 >5 >5.88.5 4..6 < 5.9 8.5 97. MGRM-D-5 >5 >5 >5 >5.79 6.44.5 >5 >5 >5 >5 >5 5.54.5.44 4.87.98 >5 >5.8 < 5.9 9. 49. MGRM-D-8 >5 >5 >5 >5 4.9 >5. >5 >5 >5 >5 >5.7.74.5 9.849.5.854.564.454 < 48.8 < 56. MGRM-D-.8.9..8.9.5.7.9.756.478 >5 6.97 >5 >5 >5 >5 4.655.75.5.7 7.5. 769. 498. MGRM-D- >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5.6.5 6.8 < 9. 9. 6. D MGRM-D- >5 >5 >5 >5 >5 >5 8.847.49 4.4 >5 >5 >5.79..86 >5.48.87.88. < 745.4 4.8 77. MGRM-D-4.9..9...9..6.56.9 >5 >5..5.9..5..94. 49.9 56.5 48.. MGRM-D-6 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5.45..98 < 8.7.4 5. MGRM-D-8.5.7.7.49.9..8.49.48.9 >5 5. >5 >5 >5 >5.65 >5 7.58.5 66.6 59. 7.4 64. MGRM-D-9 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5.655.55.77 >5..9.5.8 < 96.7 6. 467. MGRM-D-..7.8.5..5. 4.677 >5 >5 >5 >5 >5 >5 >5 >5..9.97.665 488. < 9.5 9. MGRM-D- 5.4.75..4.47.56.4.56.6 >5 >5 >5 >5 >5 >5 >5 >5.445 >5 >5 < < 457.5 48. MGRM-D- >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 4.5 >5 >5 >5 < < < < MGRM-D-4.8.85. >5.76.945.67 >5 >5 >5 >5 >5 >5 >5 >5 >5.4.66 >5.8 55. 44.4 4.7 99. MGRM-D-6 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5.48.5 44.566 >5.4.45.76.664 < 4.4. < MGRM-D-8.9.8. >5 >5 >5 >5.85 >5 >5 >5 >5 >5 >5 >5 >5.7.77.8.4 8. 59. < 56. MGRM-D-9 >5 >5 >5 >5 >5 >5 >5 >5 >5.849 >5 >5.57.9..459..4.557 >5 < 9.4 < 87. MGRM-F-4.665.9.78.5.6.68.7..4. >5 4.4...6.5.6.5.58.75 6.7 874. 687.6 66. MGRM-F-6 5.8.66 6.894.6.78 7.7.76 >5 >5 >5 >5 >5 8.99.874.4.56.64.856 >5 7.49 < 47..8 487. MGRM-F-8 >5 >5 >5 >5 >5 >5 >5.65.74 >5 >5 >5.9.4.89.57.8.4. >5 < 4. < 8. MGRM-F-.6.4.6 >5 >5 >5 6.66 >5 >5 >5 >5 >5 >5 >5 >5 >5..97.84. 85. 4.4 < 564. MGRM-F-.97 >5. >5. >5.7 >5 >5. >5 >5 >5 >5 >5 >5..488.5. 57.. 99.8 66. MGRM-F-.8.5.8 >5 >5 >5.7 >5 >5.8 >5 >5.4...59.4.7.84.5 8.9 4.4 77.4 65. MGRM-F-4.8.95. >5 >5 >5.77.795 >5 >5 >5 >5....4.9.56.. 4. 694.5 < 58. MGRM-F-5 8.59.47 >5 >5 >5 >5 >5 >5 >5.4 >5 >5 >5 >5 >5 >5.764.87.79 >5 < 45.7 < 4. F MGRM-F-6.9 4.88 4.948 >5 >5 >5.9 >5 >5 >5 >5 >5 >5 >5 >5 >5 7.5.57.68.58.. < 47. MGRM-F-7 6.89 >5 >5 >5 >5 >5.659 >5 >5 7.788 >5 >5.89.465 6.79 >5.86.77.8 >5 < 79.4 < 8. MGRM-F-8.4.56.54 >5 4.94.586. >5 >5 >5 >5 >5.785.44.7 >5...7.9 77. 58.6 5. 9. MGRM-F-.67..5 >5 >5 >5.55 9.78 >5.68 9..9.5.84.98 8.99.86.89 5.987 6.96 5.4.8 < 6. MGRM-F-.99..7 >5 >5 >5 >5 >5 >5.65 >5 >5 >5 >5 >5 >5 8.8.9. >5 7.6 55.7 8.7 99. MGRM-F-.4.77.75 >5 >5 >5 4.545 >5 >5.964.48 6..4.4.8.8.9.55.7.8 5. 96.4. 68. MGRM-F-.97.54.5..9.9.7.5 >5.88 >5 >5.7.6.97.6 5.879.9.7 >5 6. 7. 674.5 77. IC5 (µg/ml) IC5 (/dil'n) b Isolte Subtype PGT- PGT- PGT- PGT-5 PGT-6 PGT-7 PGT-8 PGT- PGT- PGT-5 PGT-6 PGT-7 PGT-4 PGT-4 PGT-4 PGT-44 PGT-45 VRC PGV4 #7 #84 #6 #9 MGRM-G-.4.5.9..8..9.98.44.9 8. 4.7.9.6.4 >5.8.7 >5.66 596. 557.6 65.9 69. MGRM-G-4.5.46.8 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 6.5 57.8 7. 574. MGRM-G-6 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5.4.9..84.86.55.8.98 < 548. < < MGRM-G-9..54.546 >5 >5 >5 >5 >5 >5 >5 >5 >5.89.8.968 >5.98.7.4.74 6. 6. < 45. MGRM-G-.67.99 4.9 >5 7.8 >5 8. >5 >5 >5 >5 >5.86.46.74.577.8.65.78.5 < 64. < 89. MGRM-G-.99.448.969 >5 48.845 7.699.995 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5.55.68 >5.5 56.4 48. 69. MGRM-G-4.9.8.5.7.9.9.4.6 4. >5 >5 >5..76.7.56.44.56.56 6.478 59.5 89.5 58. 95. MGRM-G-5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5.465.548. 6.599 < < < 66. G MGRM-G-6 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 4.69 8.7 7.6 >5.8.6.9.6 < 68.8 6. 44. MGRM-G-7.4..6 >5 >5 >5.9 >5 >5.7 >5 4.95.64.5.7 9.97.5.4.65.4 58. 7.7 8.9 4. MGRM-G-9..6.8 >5.8.49. 7.98 >5.45 44.85.6. 5.949 4.77 >5.4.6.7 4.559 46.7 5. 54.8 54. MGRM-G-4.4.. >5 >5 >5.95 5.88.7.6.5.5.5.54.48 7.9.6.5..6 77.4 88..5 56. MGRM-G-5.6.79.46 >5 7.54 9.79.7 8.45 7.75.59 >5 >5 >5 >5 >5 >5 >5.9.68 >5 96. 9.5 64.. MGRM-G-7.4.66.8 4.44.875 >5. 4.7.94.6 45..8 >5 >5 >5 >5.4.6.5.7 89. 4.8 4.4 676. MGRM-G-8.4..8....8.74.466 >5 >5 >5 4.888.9 4.988 >5.46.64.5.89 769.4 5.4.4 6. MLV negtive >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 >5 < < < < 4 WWW.NATURE.COM/NATURE

SUPPLEMENTARY INFORMATION RESEARCH Supplementry Tble 5. Binding ctivity of PGT mabs. Donor mab #7 5 6 7 #6 8 5 #9 6 7 EC5 (µg/ml) WT JR-FL gp JR-FL gp V/ V JR-FL gp V Endo H treted JR-FL gp.. > >.. > >.. > >..6 > >.. > >..7 > >.. 7.8 >. > > >.4 > > >... >... >... > Binding ws evluted by ELISA. EC5 vlues were derived by nonliner regression nlysis. Experiments were performed in duplicte, nd dt represent n verge of t lest two independent experiments. Supplementry Tble 6. Neutrlizing ctivity of PGT mabs ginst pnel of JR-CSF lnine mutnts. Fold IC5 increse reltive to wild-type c Muttion gp domin b PGT- PGT- PGT- PGT-5 PGT-6 PGT-7 PGT-8 PGT- PGT- PGT-5 DA.......5.8 ND.8 VA.8...5.7.5.4.8.7.4 C L5A.9.4.5.6..4.9.5.5.9 V7A.7...9..5..8.6.4 N4A V...4.5.6...6.5. N56A.9. 6..6.8.6.4.5.. N6K....5.5.8..4.4 7.7 T6A..6.7.5.6...6.6.9 I65A.....5.7...4 4. R66A.4.9.9.5..6.7..6.9 D67A....7.6.6....7 K68A V.5.8.8.9.7.9...7.4 E7A.4...8.7..5.4 ND. Y77A.4.4.4..9.9.4.6 5.. L79A.9....6.5.8.4 4.8. V8A...8..4.6....5 D85A..8.9.6...5.9.7. N88A.8...7.8.8...9.4 N97A..4.4...6.... S99A C (V/V stem).8...7.8...9.6. TA..5..8.8.8...7.8 FA.5.6.8.4.5.8.8.7.. N4A.5.4.8.5.6.6.7.6.7. C N6A...5.9..4.6.7.4. N76A.8.4..9.9.6.6..8.5 WWW.NATURE.COM/NATURE 5

RESEARCH SUPPLEMENTARY INFORMATION Fold IC5 increse reltive to wild-type c Muttion gp domin b PGT- PGT- PGT- PGT-5 PGT-6 PGT-7 PGT-8 PGT- PGT- PGT-5 V9A.7..7. 5..9..9.4. N95A.6.7..8.9...7. >8 T97A.7.6..9.8.7..9. > P99A..5.7.....8..6 NA.4.4. 4 >5.7 > >7.5 NA.7...7.9..5...8 TA.7.5. >5 >5 >5 >5 >5 >7. R4A.7.7.7.9.8.4.7.5.5.7 K5A.9..9.9..6.8 6.9 ND. S6A.7.5.5..7.6..5.7.4 I7A.7.8 5.9 5..8..7. >7. I9A...6.. 6..8 >77.9 8.8. PA.5.4...4....5.5 V R5A.9.5.7.9...4.6.7.8 F7A.7.4..8...8 7. 96.5 T9A..5.4..8..5.6.9.4 TA..7.7.8.6.8..9 4.5.5 EA..4.6..6.9..7.8.8 IA.9...9.9 4...8 8..5 G4A 6.6.5 4.5.7. ND ND >5 ND.4 D5A. 44. 64..4.5.9.5 > >7.5 I6A.7.6.4.9.8.5.6..7. R7A.5.7.7...8.5.4 9..67 HA.8.5..7.5.5..9.5 >5 NA > > >. 8 >.4.6.5 >5 S4A >5 >5 >5.8 > >5.4.5.4 > Q7A..5.5.8.4.5.7... N9A.5.4.8.9.6..8... T4A.5....5.7..8..6 K4A.6...7...... R5A C.8.6.5.6.7...5..9 N55A.4.8.5...4.7...8 N86A...4.8.9.6.... S87A.5.9.9.6.6...7..6 T88A.9...6.6.5...6. Fold IC5 increse reltive to wild-type c Muttion gp domin b PGT- PGT- PGT- PGT-5 PGT-6 PGT-7 PGT-8 PGT- PGT- PGT-5 N9Q.9....6..9..4 >5 S9A.6.5.6.5.5..4.7..9 T94A..6.4.6.6.6...9 >75 W95A.5.4.4.9.6.6.8.6.5.6 N96A....6.7.4.9..9 N4A V4.4.7.5.5.7.8.7.6.6. T4A.5.8.4.5.7.8..6.6. I44A.5.5...4..4.7.. Amino I45Acid numbering is bsed on the.6 sequence of HIV-HxB..4.4....7.6.6 5 b C L46A refers to constnt domins nd V refers.6to vrible. loops..9.8.8..... c D47A.7.5.7.5..4.5.. 5. Neutrliztion ctivity is reported s fold increse in IC5 vlue reltive to WT JR-CSF nd ws clculted using the eqution ( IC5 mutnt / IC5 WT). R49A.8.8.7...5.5.6.7.9 Gry: substitutions which hd negligible effect on neutrliztion ctivity, yellow: -4 fold IC5 increse, red: >4 fold IC5 I4A..5...6.8.8 increse. Experiments 9.8 were 5.4 performed K4Ain duplicte nd vlues represent. n verge. of t lest two.9independent. experiments..7.5..9.. C4 Q4A...8......9.8 I4A..8.5 5...5.6 > >8. I44A.9.8.5.7.4...9 4.8. E466A..9.6.6.4.9.6.7.7.5 F468A.8..5..7..5.4.6. P47A.9..8.6.7..6.4..8 G47A.8.8.....9.8. D474A V5..8..4..5.8..6. R476A..9..9.5..7...8 D477A.9.9..4..7.7...5 N478A.8.9.6.5...8.8..7 R48A.8.4.7..9....5.4 Amino cid numbering is bsed on the sequence of HIV-HxB. b C refers to constnt domins nd V refers to vrible loops. c Neutrliztion ctivity is reported s fold increse in IC5 vlue reltive to WT JR-CSF nd ws clculted using the eqution ( IC5 mutnt / IC5 WT). Experiments were performed in duplicte nd vlues represent n verge of t lest two independent experiments. 6 WWW.NATURE.COM/NATURE

SUPPLEMENTARY INFORMATION RESEARCH 5 6 7 8 OD 45........................ 4 4 4 44 45 OD 45 nm............... OD 45 OD 45........ 5 6............ 7.... dsdna ssdna gp4 histone ORI disilognglioside GD BL gp trnsferrin OVA potrnsferrin b 4E OD 45...... Supplementry Figure. Polyrectivity ELISA ssy. PGT mabs were tested for ELISA rectivity ginst pnel of ntigens. The bnabs b nd 4E were lso included for comprison. d.s, double-strnded; s.s, single-strnded. WWW.NATURE.COM/NATURE 7

RESEARCH SUPPLEMENTARY INFORMATION A bredth (%) 8 6 4 IC 5 clde A... 5 IC 5 cut-off (μg/ml) b G 4E PGT PGT8 PGT5 PGT45 PGV4 VRC F bredth (%) 8 6 4 IC 5 clde F... 5 IC 5 cut-off (μg/ml) b G 4E PGT PGT8 PGT5 PGT45 PGV4 VRC B bredth (%) 8 6 4 IC 5 clde B... IC 5 cut-off (μg/ml) b G 4E PGT PGT8 PGT5 PGT45 PGV4 VRC G bredth (%) 8 6 4 IC 5 clde G... 5 IC 5 cut-off (μg/ml) b G 4E PGT PGT8 PGT5 PGT45 PGV4 VRC C bredth (%) 8 6 4 IC 5 clde C... IC 5 cut-off (μg/ml) b G 4E PGT PGT8 PGT5 PGT45 PGV4 VRC AE bredth (%) 8 6 4 IC 5 clde AE... 5 IC 5 cut-off (μg/ml) b G 4E PGT PGT8 PGT5 PGT45 PGV4 VRC D bredth (%) 8 6 4 IC 5 clde D... 5 IC 5 cut-off (μg/ml) b G 4E PGT PGT8 PGT5 PGT45 PGV4 VRC AG bredth (%) 8 6 4 IC 5 clde AG... 5 IC 5 cut-off (μg/ml) b G 4E PGT PGT8 PGT5 PGT45 PGV4 VRC Supplementry Figure. Anlysis of neutrliztion ctivity by virus cldes. Cumultive frequency distribution of IC 5 vlues of brodly neutrlizing MAbs tested ginst 6 virus pnel seprted by cldes A, B, C, D, F, G, AE nd AG. 8 WWW.NATURE.COM/NATURE

SUPPLEMENTARY INFORMATION RESEARCH donor 7 IC5 (μg/ml) PGT PGT PGT r = -.9 r = -.89 r = -.89 P <. n = 9 P <. n = 7 P <. n = 6 PGT5 PGT6 PGT7 PGT8 PGT PGT r = -.7 r = -.7 r = -.66 r = -.7 r = -.67 r = -.6 P <. P <. P <. P <. P <. P <. n = 5 n = 7 n = n = 5 n = 9 n = 4 PGT5 r = -.46 PGT6 r = -.7 PGT7 r = -.48 P <. P <. P <. n = 54 n = 54 n = 54 PGT4 PGT4 PGT4 PGT44 PGT45 P <. P <. P <. P <. P <. n = 45 n = 45 n = 45 n = 45 n = 5... NT5 (dilution) b donor 6 IC5 (μg/ml)... NT5 (dilution) c donor 9 IC5 (ug/ml)... NT5 (dilution) d donor 84 IC5 (μg/ml). r = -.59 r = -.58 r = -.59 r = -.4 r = -.49.. NT5 (dilution) Supplementry Figure. MAb neutrliztion correltes strongly with serum neutrliztion. Correltion of IC5s of the MAbs nd serum NT5s of the corresponding donors 7 (), 6 (b), 9 (c) nd 84 (d) is shown. Spermn correltion ws used for sttisticl nlyses. Only viruses neutrlized by either the MAb (IC5 < 5 μg/ml) or the serum (NT5 > ) were included. W W W. N A T U R E. C O M / N A T U R E 9

RESEARCH SUPPLEMENTARY INFORMATION A) Recombinnt gp OD 45 JR-CSF gp... Hxb gp 4... SF6 gp... ADA gp 4... YU gp... 4 4 4 44 45 b G YU gp4 (Foldon) KNH44 gp4 (SOSIP) Trimerized gp4 OD 45...... JR-CSF KNH44 JR-FL E68K B) Cell surfce Env MFI 4... 5 5.... 5 4... Supplementry Figure 4. PGT 4-45 bind preferentilly to cell-surfce expressed trimers. A) Binding of PGTs 4-45 to monomeric gp nd rtificilly trimerized gp4 constructs s determined by ELISA. The bnabs b nd re included for comprison. OD, opticl density (bsorbnce t 45 nm). B) Binding of PGTs 4-45 to Env expressed on the surfce of 9T cells s determined by flow cytometry. The bnabs G nd re included for comprison. WWW.NATURE.COM/NATURE

SUPPLEMENTARY INFORMATION RESEARCH A) percent neutrliztion 8 6 4 JR-CSF 8 6 4 JR-CSF N6K 8 6 4 JR-CSF + kifunensine 4 4 4 44 45 G............ ntibody concentrtion (ug/ml) B).5 JR-FL E68K Normlized MFI..5.... concentrtion (μg/ml) Supplementry Figure 5. PGT mabs 4-45 bind to epitopes overlpping those of nd PG6. A) PGTs 4-45 re sensitive to the N6K muttion nd PGTs 4-44 fil to neutrlize pseudoviruses produced in the presence of kifunensine. The bnab G ws lso included for comprison. B) competes with PGTs 4-45 for binding to cell-surfce trimers. The bnab G ws included s negtive control. WWW.NATURE.COM/NATURE

RESEARCH SUPPLEMENTARY INFORMATION A) B) percent inhibition 8 6 4-8 6 4 - G -4 Mn 4 Dendron concentrtion (μm) -4 Mn 9 Dendron concentrtion (μm) Supplementry Figure 6. PGTs, nd competition with oligodendrons. Unlike PGTs 5, 6, 7, 8 nd, the binding of PGTs, nd to gp could not be competed by A) Mn4 or B) Mn9 dendrons. WWW.NATURE.COM/NATURE

SUPPLEMENTARY INFORMATION RESEARCH percent neutrliztion 8 6 4 5 8 6 4 6 8 6 4 7 IgG Fb...... 8 percent neutrliztion 8 6 4 8 6 4 8 6 4.. Ab Concentrtion (nm).. Ab Concentrtion (nm).. Ab Concentrtion (nm) Supplementry Figure 7. Neutrliztion ctivity of Fb frgments. Fb frgments of PGTs-5, 6, 7, 8, nd were generted by Lys-C digestion nd the neutrlizing ctivity tested ginst HIV-JR-CSF using single round of repliction pseudovirus ssy. WWW.NATURE.COM/NATURE

RESEARCH SUPPLEMENTARY INFORMATION 8 PGT or PGT8 PGT PGT8 8 PGT or PGT45 PGT PGT45 8 PGT or PGT 6 4 6 4 6 4... 5... 5... 5 8 PGT or PGV4 PGT PGV4 8 PGT 8 or PGV4 PGT8 PGV4 8 PGT8 or PGT8 6 4 6 4 6 4... 5... 5... 5 8 PGT45 or PGV4 PGT45 PGV4 8 PGT45 or PGT45 8 PGV4 or PGV4 6 4 6 4 6 4... 5... 5... 5 8 PGT or VRC PGT VRC 8 PGT8 or VRC PGT8 VRC 8 PGT45 or VRC PGT45 VRC 6 4 6 4 6 4... 5... 5... 5 8 6 4 or VRC VRC... 5 Supplementry Figure 8. Percent viruses covered by single MAbs (solid lines) or by t lest one of the MAbs in dul combintions (dshed blck lines) dependent on individul concentrtions. The grey re in ll pnels is the coverge of 6 MAbs tested on the 6-virus pnel (PGT-, PGT5-8, PGT-, PGT5-7, PGT4-45,, PG6, PGC4, VRC, PGV4, b, G, 4E, F5) nd depicts the theoreticl mximl chievble coverge known to dte. 4 WWW.NATURE.COM/NATURE

SUPPLEMENTARY INFORMATION RESEARCH Supporting Notes Protocol G Principl Investigtors nd Institutions: G. Miiro nd J. Serwng (MRC/UVRI Ugnd Reserch Unit on AIDS, Ugnd Virus Reserch Institute, Entebbe, Ugnd), A. Poznik (St Stephens AIDS Trust, Chelse nd Westminster NHS Foundtion Trust, London UK), D. McPhee (NRL, St Vincent's Institute, Melbourne, Victori, Austrli), O. Mnigrt nd L. Mwnnynd (Zmbi Emory HIV Reserch Project, Lusk, Zmbi nd the Rwnd-Zmbi HIV Reserch Group, Emory University, Atlnt, GA, USA), E. Krit (Projet Sn Frncisco, Kigli, Rwnd nd the Rwnd-Zmbi HIV Reserch Group, Emory University, Atlnt, GA, USA), A. Inwoley (CeDReS/CHU Treichville, Abidjn, Côte d'ivoire), W. Joko (Keny AIDS Vccine Inititive, College of Helth Sciences, University of Nirobi, Nirobi, Keny), J. DeHovitz (SUNY Downstte Medicl Center, Brooklyn, NY, USA), L.G. Bekker (Desmond Tutu HIV Centre, University of Cpe Town, Cpe Town, South Afric), P. Pitisuttithum (Fculty of Tropicl Medicine, Mhidol University, Bngkok, Thilnd), R. Pris (Dept. of Retrovirology, Armed Forces Reserch Institute of Medicl Sciences, Bngkok, Thilnd), nd S. Allen (Rwnd- Zmbi HIV Reserch Group, Emory University, Atlnt, GA, USA). WWW.NATURE.COM/NATURE 5

2025 © DocPlayer.gr Πολιτική Απορρήτου | Όροι Χρήσης | Σχόλια