1181 (real-timespeechdriven) 1 1 ( ) D FAP FAP (voiceactivationdetectionvad) D FaceGen 3- D XfaceEd MPEG-4 1 FAP 66 FAP ( ) FAP 84
|
|
- Βηθζαθά Λαμπρόπουλος
- 6 χρόνια πριν
- Προβολές:
Transcript
1 ISSN CN /N ( ) JTsinghuaUniv(Sci& Tech) 2011Vol.51 No.9 5/ ( ) [1-2] 2 [1] MPEG-4 3-D MOS MOS TP (2011) A Real-timespeechdriventalkingavatar LIBingfengXIELeiZHOUXiangzengFUZhonghuaZHANGYanning (ShaanxiProvincialKeyLaboratoryofSpeechandImageInformation ProcessingSchoolofComputerScienceNorthwesternPolytechnical UniversityXi an710129china) AbstractThispaperpresentsareal-timespeechdriventalkingavatar. Unlikemosttalkingavatarsinwhichthespeech-synchronizedfacial animationisgeneratedoflinethistalkingavatarisabletospeak withlive speech input. Thislife-like talking avatar has many potentialapplicationsinvideophonesvirtualconferencesaudio/video chatsandentertainment.sincephonemesarethesmalestunitsof pronunciationa real-time phoneme recognizer was built. The synchronizationbetweentheinputlivespeechandthefacialmotion usedaphonemerecognitionandoutputalgorithm.thecoarticulation efectsareincludedinadynamicvisemegenerationalgorithm to coordinatethefacialanimationparameters (FAPs)fromtheinput phonemes.the MPEG-4compliantavatar modelisdrivenbythe generatedfaps.testsshowthattheavatarmotionissynchronized andnaturalwith MOSvaluesof3.42and3.5. Keywordsvisualspeechsynthesistalkingavatarfacialanimation (motiondriven) (textdriven) (speechdriven) (textto speechtts) [3] MPEG-4 (facialani- mationparameterfap [4] ) [5] 2 Mathew [6] Markov (hidden markovmodelhmm) [7] Bayes ( ) ( ) (2011KJXX29) (2011JM8009) (1988 )( ) lxie@nwpu.edu.cn
2 1181 (real-timespeechdriven) 1 1 ( ) D FAP FAP (voiceactivationdetectionvad) D FaceGen 3- D XfaceEd MPEG-4 1 FAP 66 FAP ( ) FAP 84
3 1182 ( ) (9) ^w last(t) XfaceEd FaceGen t+1 t+n-1 o t+1 18 o t+n-1 (1) N -1 ^Wt+1 = (^w 1 ^w 2 last(t+1) t+1 t+1 ^w t+1 ) 烄 2.2 (3) 烅 ^Wt+N-1 = (^w 1 ^w 2 last(t+n-1) 烆 t+n-1 t+n-1 ^w t+n-1 ). O=(o 1 o I )(I 1) W =(w 1 w n )(n 1) N L O ^w ^W ^w pre ^w ^W =argmax P(W O). (1) W L HMM Veterbi ^Wt = (^w 1^w 2 last(t) t t ^w t )= argmax P(W (o 1 o t )). (2) W L t t t+n-1 ^w last(t) t = ^w t+1 last(t+1) = ^w t+n-1 last(t+n-1) = ^w (4) t o t (1) { ^w ^w pre. ^w ^w pre 3 3 N 2 N N N 3 3-D FAP ( p b ) (viseme) MPEG-4
4 1183 [4] ( 59 ) F sp (t)= Dsp( t) T sp + (D lp (t)+d rp (t)) T 0p. 1 D sp (t)+d lp (t)+d rp (t) (8) [3] 1 T 0p p T sp ( ) s p bpm gkh aang ou i 4 f jqx aian eeng u dtn zhchshr ao eien v(/yu/) l zcs o er SIL 13 iao=i+ao MPEG-4 FAP FAP FAP FAP( ) FAP 1 2 p s FAP p s D sp (5) (7) D sp = αsp e -θsp(-) τ c 烄 τ 0 (5) 烅 αspe -θ sp(+) 烆 τ c τ<0. αsp θsp(-) θsp(+) c τ 2 τ=t so-tt so t 2 ( ) (5) 2 D lp =αlpe sgn( σ)θ lp σ c. (6) D sp (-) =αspe -θ sp(-) τ c τ 0 D sp (+) =αspe -θ sp(+) τ c τ<0. (9) (10) σ=t lo-tt lo 5 ( ) j D rp =αrpe -sgn( υ)θ rp υ c. (7) i p i j υ=t ro-tt ro
5 1184 ( ) (9) 5 6b j i j T 1 T 2 D ip (+) D jp (-) 6e L 2 F p (t)= D jp(-)(t) T jp +D ip (+)(t) T ip. D jp (-)(t)+d ip (+)(t) (11) D jp (+) D kp (-) 6e L 3 6d k t io t t jo t io i T 3 D kp (-) D rp t jo j T ip T jp 6e L 4 i j p (11) t io t jo i j k 3 6 6a i i 0 T 1 D ip (-) D lp 6e L 1 6c k j k T 2 T HMM Gauss (sil) 60 HMM 90h HMM HTK [9] 16kHz 16bit 12 Mel (MFCC) 39 25ms 10ms Veterbi (meanopinionscoremos) - 4 1) 1 HTK (forcedalignment) (upperbound)
6 1185 2) 2 2 MOS MOS MOS /ms 3) ) (5 5 ) s % ( 45ms 4 80 htp// aslp.org/talkingavatar.html) ms [10] (interquar- 2 tilerangeiqr) 7 8 (outlier) MOS MOS ( 1 2) MOS MOS MOS
7 1186 ( ) (9) FAP FAP 3-D MOS MOS (References) [1] CosatoEOstermannJGrafH Petal.Lifeliketalking facesforinteractiveservices[j].proceedingsoftheieee (9) [2] TANG Hao FU Yun TU Jilin et al. Humanoid audio-visualavatarwithemotivetext-to-speechsynthesis[j]. IEEE Transactionson Multimedia200810(6) [3] WU Zhiyong ZHANG Shen CAI Lianhong et al. Real-time Synthesis of Chinese Visual Speech and Facial Expressions using MPEG-4 FAP Features in a Three-dimensionalAvatar[C]//TheInternationalConferenceon SpokenLanguageProcessingPitsburgh [4] PandzicI SForchheimer R. MPEG-4 Facial Animation [M].New YorkWiley2002. [5] HUANG FujieCosatoEGraf H.Triphonebasedunits electionforconcatenativevisualspeechsynthesis[c]//ieee internationalconference on acousticsspeechand signal processing.njieeepress [6] Brand M. Voice puppetry [C]// Proceedings of the SIGGRAPH 99.NYACM Press [7] XIE Lei LIU Zhiqiang. Realistic mouth-synching for speech-driventalkingfaceusingarticulatory modeling [J]. IEEE Transactionson Multimedia20079(3) [J] (3) WANGZhimingCAILianhong.A dynamicviseme model andparameterestimation [J].Journalof Software (3) (inChinese) [9] YoungSEvermannGKershaw Detal.TheHTK Book [M].CambridgeUniversityEngineeringDepartment2009. [10]. [M] WANG LijiaLIN Tao.Phonetics Course [M].Peking UniversityPress1992.(inChinese) ( 1179 ) 3 SNR 3 ITD ID (References) [1] CherryEC.Someexperimentsontherecognitionofspeech with one and with two ears [J]. J of ASA [2] Bregman A S.AuditoryScene Analysis [M].Cambridge MITPress1990. [3] HanslerESchmidtG.Topicsin AcousticEchoand Noise Control[M].BerlinSpringer2006. [4] RomanNWangDLBrownGJ.Speechsegregationbased on sound localization [J]. J of ASA (4) [5] MeddisR.Simulationofmechanicaltoneuraltransductionin the auditory receptor [J]. J of ASA (3) [6] BeroutiMSchwartzMMakhoulJ.Enhancementofspeech corrupted by acoustic noise [J]. Proc IEEE Int Conf AcoustSpeechSignal Process [7] ScalartPFilhoJ.Speechenhancementbasedonapriori signaltonoiseestimation [J].ProcIEEE IntConf Acoust SpeechSignal Process Ephraim YMalahD.Speechenhancementusingaminimum mean-square error log-spectral amplitude estimator [J]. IEEE Trans Acoust Speech Signal Process (2)
Συνδυασμένη Οπτική-Ακουστική Ανάλυση Ομιλίας
Ομάδα Όρασης Υπολογιστών, Επικοινωνίας Λόγου και Επεξεργασίας Σήματος Εθνικό Μετσόβιο Πολυτεχνείο Σχολή Ηλεκτρολόγων Μηχαν. και Μηχαν. Υπολ. http://cvsp.cs.ntua.gr Συνδυασμένη Οπτική-Ακουστική ή Ανάλυση
Buried Markov Model Pairwise
Buried Markov Model 1 2 2 HMM Buried Markov Model J. Bilmes Buried Markov Model Pairwise 0.6 0.6 1.3 Structuring Model for Speech Recognition using Buried Markov Model Takayuki Yamamoto, 1 Tetsuya Takiguchi
Vol.4-DCC-8 No.8 Vol.4-MUS-5 No.8 4// 3 3 Hanning (T ) 3 Hanning 3T (y(t)w(t)) dt =.5 T y (t)dt. () STRAIGHT F 3 TANDEM-STRAIGHT[] 3 F F 3 [] F []. :
Vol.4-DCC-8 No.8 Vol.4-MUS-5 No.8 4//,a) Vocoder (F) F F. PSOLA [] sinusoidal model [] phase vocoder Vocoder [3] (F) F 3 [4], [5], [6], [7], [8], [9] [], [], [], [3], [4] [5], [6] [7], [8], University
Fourier transform, STFT 5. Continuous wavelet transform, CWT STFT STFT STFT STFT [1] CWT CWT CWT STFT [2 5] CWT STFT STFT CWT CWT. Griffin [8] CWT CWT
1,a) 1,2,b) Continuous wavelet transform, CWT CWT CWT CWT CWT 100 1. Continuous wavelet transform, CWT [1] CWT CWT CWT [2 5] CWT CWT CWT CWT CWT Irino [6] CWT CWT CWT CWT CWT 1, 7-3-1, 113-0033 2 NTT,
MIDI [8] MIDI. [9] Hsu [1], [2] [10] Salamon [11] [5] Song [6] Sony, Minato, Tokyo , Japan a) b)
1,a) 1,b) 1,c) 1. MIDI [1], [2] U/D/S 3 [3], [4] 1 [5] Song [6] 1 Sony, Minato, Tokyo 108 0075, Japan a) Emiru.Tsunoo@jp.sony.com b) AkiraB.Inoue@jp.sony.com c) Masayuki.Nishiguchi@jp.sony.com MIDI [7]
[5] F 16.1% MFCC NMF D-CASE 17 [5] NMF NMF 3. [5] 1 NMF Deep Neural Network(DNN) FUSION 3.1 NMF NMF [12] S W H 1 Fig. 1 Our aoustic event detect
NMF 1 1,a) 1 AED NMF DNN IEEE D-CASE 2012 20% DNN NMF 1. Computational Auditory Scene Analysis: CASA [1] [2] [3] [4] [5] Non-negative Matrxi Factorization (NMF) NMF 2. CASA IEEE 1 Dept. Computer Science
Study on the Strengthen Method of Masonry Structure by Steel Truss for Collapse Prevention
33 2 2011 4 Vol. 33 No. 2 Apr. 2011 1002-8412 2011 02-0096-08 1 1 1 2 3 1. 361005 3. 361004 361005 2. 30 TU746. 3 A Study on the Strengthen Method of Masonry Structure by Steel Truss for Collapse Prevention
40 3 Journal of South China University of Technology Vol. 40 No Natural Science Edition March
40 3 Journal of South China University of Technology Vol 40 No 3 2012 3 Natural Science Edition March 2012 1000-565X 2012 03-0106-06 * 510640 MFCC K-L K-L MFCC K-L 46 61% 42 25% 39 68% 36 36% K-L TN912
[2] REVERB 8 [3], [4] [5] [20] [6], [7], [8], [9], [10] [11] REVERB 8 *1 [9] LDA *2 MLLT (SAT) [8] (basis fmllr) [12] (DNN) [10] DNN [11] [13] [14] Ka
: REVERB 1,a) 1 2 REVERB 8 REVERB REVERB 6.76% 18.60% 68.8% 61.5% REVERB Effectiveness of dereverberation techniques and system combination approach for various reverberant environments: REVERB challenge
Analysis of prosodic features in native and non-native Japanese using generation process model of fundamental frequency contours
THE INSTITUTE O ELECTRONICS, INORMATION AND COMMUNICATION ENGINEERS TECHNICAL REPORT O IEICE. 277 8562 5 1 5 113 3 7 3 1 6 817 17 8 E-mail: {hiran,wtgu,hirose,mine}@gavo.t.u-tokyo.ac.jp, goh@kawai.com
FENXI HUAXUE Chinese Journal of Analytical Chemistry. Savitzky-Golay. n = SG SG. Savitzky-Golay mmol /L 5700.
38 2010 3 FENXI HUAXUE Chinese Journal of Analytical Chemistry 3 342 ~ 346 DOI 10. 3724 /SP. J. 1096. 2010. 00342 Savitzky-Golay 1 * 1 2 1 3 1 1 510632 2 510632 3 200444 PLS Savitzky-Golay SG 10000 ~ 5300
SNR F0 [2], [3], [4] F0 F0 F0 F0 F0 TUSK F0 TUSK F0 6 TUSK 6 F0 2. F0 F0 [5] [6] [7] p[8] Cepstrum [9], [10] [11] [12] [13] F0 [14] F0 [15] DIO[16] [1
1,a) 2 F0 TUSK F0 F0 F0 F0 TUSK TUSK F0 Prototype of a framework for overviewing the performance of F0 estimators Morise Masanori 1,a) Kawahara Hideki 2 Abstract: This article represents a framework for
1.8 Paul Mother Wavelet Real Part Imaginary Part Magnitude.6.4 Amplitude.2.2.4.6.8 1 8 6 4 2 2 4 6 8 1 t .8.6 Real Part of Three Scaled Wavelets a = 1 a = 5 a = 1 1.2 1 Imaginary Part of Three Scaled Wavelets
Quick algorithm f or computing core attribute
24 5 Vol. 24 No. 5 Cont rol an d Decision 2009 5 May 2009 : 100120920 (2009) 0520738205 1a, 2, 1b (1. a., b., 239012 ; 2., 230039) :,,.,.,. : ; ; ; : TP181 : A Quick algorithm f or computing core attribute
(hidden Markov model: HMM) FUNDAMENTALS OF SPEECH SYNTHESIS BASED ON HMM. Keiichi Tokuda. Department of Computer Science
HMM 466-8555 (hidden Markov model: HMM) HMM HMM HMM HMM FUNDAMENTALS OF SPEECH SYNTHESIS BASED ON HMM Keiichi Tokuda Department of Computer Science Nagoya Institute of Technology Gokiso-cho, Shouwa-ku,
E-mail: {kameoka,sagayama}@hil.t.u-tokyo.ac.jp, m.goto@aist.go.jp GUI
E-mail: {kameoka,sagayama}@hil.t.u-tokyo.ac.jp, m.goto@aist.go.jp GUI Selective Amplifier of Periodic and Non-periodic Components in Concurrent Audio Signals with Spectral Control Envelopes Hirokazu Kameoka
Speech Recognition using Phase Information based on Long-Term Analysis
THE INSTITUTE OF ELECTRONICS, INFORMATION AND COMMUNICATION ENGINEERS TECHNICAL REPORT OF IEICE. 441 8580 1 1 E-mail: {kyama,sueyoshi,nakagawa}@slp.cs.tut.ac.jp MFCC Liu 2 1 1 90% MFCC 20% Abstract Speech
3: A convolution-pooling layer in PS-CNN 1: Partially Shared Deep Neural Network 2.2 Partially Shared Convolutional Neural Network 2: A hidden layer o
Sound Source Identification based on Deep Learning with Partially-Shared Architecture 1 2 1 1,3 Takayuki MORITO 1, Osamu SUGIYAMA 2, Ryosuke KOJIMA 1, Kazuhiro NAKADAI 1,3 1 2 ( ) 3 Tokyo Institute of
1,a) 1,b) 2 3 Sakriani Sakti 1 Graham Neubig 1 1. A Study on HMM-Based Speech Synthesis Using Rich Context Models
HMM 1,a 1,b 3 Sakriani Sakti 1 Graham Neubig 1 1 Hidden Markov Model HMM HMM HMM HMM HMM A Study on HMM-Based Speech Synthesis Using Rich Context Models Shinnosuke Takamichi 1,a Toda Tomoki 1,b Shiga Yoshinori
A ne w method for spectral analysis of the potential field and conversion of derivative of gravity-anomalies : cosine transform
49 1 006 1 CHINESE JOURNAL OF EOPHYSICS Vol. 49, No. 1 Jan., 006,,..,006,49 (1) :4448 Zhang F X, Meng L S, Zhang F Q, et al. A new method for spectral analysis of the potential field and conversion of
EM Baum-Welch. Step by Step the Baum-Welch Algorithm and its Application 2. HMM Baum-Welch. Baum-Welch. Baum-Welch Baum-Welch.
Baum-Welch Step by Step the Baum-Welch Algorithm and its Application Jin ichi MURAKAMI EM EM EM Baum-Welch Baum-Welch Baum-Welch Baum-Welch, EM 1. EM 2. HMM EM (Expectationmaximization algorithm) 1 3.
Bayesian statistics. DS GA 1002 Probability and Statistics for Data Science.
Bayesian statistics DS GA 1002 Probability and Statistics for Data Science http://www.cims.nyu.edu/~cfgranda/pages/dsga1002_fall17 Carlos Fernandez-Granda Frequentist vs Bayesian statistics In frequentist
Application of Wavelet Transform in Fundamental Study of Measurement of Blood Glucose Concentration with Near2Infrared Spectroscopy
37 6 2004 6 Journal of Tianjin University Vol. 37 No. 6 Jun. 2004 Ξ 1,2, 1,2, 3 (1., 300072 ; 2. 2, 300072 ; 3., 300072) :,,,.,,(RMSEP) 53 %58 %.. : ; ; : O657. 33 : A : 04932 2137 (2004) 062 05352 05
35 10 : 3387 [12] [9] [13] [13] 2.2 PULL PUSH (1)PUSH PUSH 3 1 [14] NAS SAN VPN PUSH 2 2 PUSH 1 2 / PULL 3 [10] [11] 2.1 (2)PULL PULL [14] 3 PULL (3)
2014 10 Oct.2014 35 10 COMPUTERENGINEERING AND DESIGN Vol.35 No.10 ( 710077) : : ; ; ; ; :TP391.8 :A :1000-7024 (2014)10-3386-06 Heartbeatdetectionandfaultassessmentforclouddatacenter ZHANGShui-pingLIYou-fengTONG
Non-negative Matrix Factorization, NMF [5] NMF. [1 3] Bregman [4] Harmonic-Temporal Clustering, HTC [2,3] 1,2,b) NTT
1,a) 1,2,b) 1. [1 3] Bregman [4] Harmonic-Temporal Clustering, HTC [2,3] 1 7-3-1 113-0033 2 NTT 3-1 243-0198 a) Tomohio Naamura@ipc.i.u-toyo.ac.jp b) ameoa@hil.t.u-toyo.ac.jp/ameoa.hiroazu@lab.ntt.co.jp
CSJ. Speaker clustering based on non-negative matrix factorization using i-vector-based speaker similarity
i-vector 1 1 1 1 i-vector CSJ i-vector Speaker clustering based on non-negative matrix factorization using i-vector-based speaker similarity Fukuchi Yusuke 1 Tawara Naohiro 1 Ogawa Tetsuji 1 Kobayashi
A method of seeking eigen-rays in shallow water with an irregular seabed
32 2 Vol 32 2 20 2 Journal of Harbin Engineering University Dec 20 doi 0 3969 /j issn 006-7043 20 2 004 5000 2 TB566 A 006-7043 20 2-544-05 A method of seeking eigen-rays in shallow water with an irregular
Estimation, Evaluation and Guarantee of the Reverberant Speech Recognition Performance based on Room Acoustic Parameters
Vol.21-SLP-83 No.9 21/1/29 1 Estimation, Evaluation and Guarantee of the Reverberant Speech Recognition Performance based on Room Acoustic Parameters Takanobu Nishiura 1 We study on estimation, evaluation
1530 ( ) 2014,54(12),, E (, 1, X ) [4],,, α, T α, β,, T β, c, P(T β 1 T α,α, β,c) 1 1,,X X F, X E F X E X F X F E X E 1 [1-2] , 2 : X X 1 X 2 ;
ISSN1000-0054 CN11-2223/N ( ) 2014 54 12 JTsinghuaUniv(Sci& Technol), 2014,Vol.54, No.12 4/20 1529-1533,, (,, (), 100084) [1-2] :,,,,,,,, :, 0.3~ [3] 0.8BLEU,, : ; ; [4], ; :TP391.2 :A, :1000-0054(2014)12-1529-05,
Query by Phrase (QBP) (Music Information Retrieval, MIR) QBH QBP / [1, 2] [3, 4] Query-by-Humming (QBH) QBP MIDI [5, 6] [8 10] [7]
Query by Phrase: a 2 2 Query by Phrase QBP QBP GaP-NMF GaP-NMF GaP-NMF QBP. Music Information Retrieval MIR [ 2] [3 4]Query-by-Humming QBH MIDI [5 6] [7] Waseda University 2 National Institute of Advanced
Signal processing for handling singing voice texture
1 TANDEM-STRAIGHT Signal processing for handling singing voice texture Hideki Kawahara 1 Singers explore vocal expressions to the limit. Conventional speech processing algorithms, which were designed to
ER-Tree (Extended R*-Tree)
1-9825/22/13(4)768-6 22 Journal of Software Vol13, No4 1, 1, 2, 1 1, 1 (, 2327) 2 (, 3127) E-mail xhzhou@ustceducn,,,,,,, 1, TP311 A,,,, Elias s Rivest,Cleary Arya Mount [1] O(2 d ) Arya Mount [1] Friedman,Bentley
Επικοινωνία Ανθρώπου Υπολογιστή. Β2. Αναγνώριση ομιλίας
Επικοινωνία Ανθρώπου Υπολογιστή Β2. Αναγνώριση ομιλίας (2016-17) Ίων Ανδρουτσόπουλος http://www.aueb.gr/users/ion/ Οι διαφάνειες αυτές βασίζονται στην ύλη του βιβλίου Speech and Language Processing των
Echo path identification for stereophonic acoustic echo cancellation without pre-processing
Echo path identification for stereophonic acoustic echo cancellation without pre-processing Yuusuke MIZUNO Takuya NUNOME Akihiro HIRANO Kenji NAKAYAMA Division of Electronics and Computer Science Graduate
Περιεχόµενα. ΕΠΛ 422: Συστήµατα Πολυµέσων. Μέθοδοι συµπίεσης ηχητικών. Βιβλιογραφία. Κωδικοποίηση µε βάση την αντίληψη.
Περιεχόµενα ΕΠΛ 422: Συστήµατα Πολυµέσων Συµπίεση Ήχου Μέθοδοι συµπίεσης ηχητικών σηµάτων DPCM Συµπίεση σηµάτων οµιλίας Κωδικοποίηση µε βάση την αντίληψη Χαρακτηριστικά και εφαρµογές Ψυχοακουστική (psychoacoustics)
(Υπογραϕή) (Υπογραϕή) (Υπογραϕή)
(Υπογραϕή) (Υπογραϕή) (Υπογραϕή) (Υπογραϕή) F 1 F 1 RGB ECR RGB ECR δ w a d λ σ δ δ λ w λ w λ λ λ σ σ + F 1 ( ) V 1 V 2 V 3 V 4 V 5 V 6 V 7 V 8 V 9 V 10 M 1 M 2 M 3 F 1 F 1 F 1 10 M 1
C F E E E F FF E F B F F A EA C AEC
Proceedings of the International Multiconference on Computer Science and Information Technology pp. 767 774 ISBN 978-83-60810-27-9 ISSN 1896-7094 CFEEEFFFEFBFFAEAC AEC EEEDB DACDB DEEE EDBCD BACE FE DD
Spectrum Representation (5A) Young Won Lim 11/3/16
Spectrum (5A) Copyright (c) 2009-2016 Young W. Lim. Permission is granted to copy, distribute and/or modify this document under the terms of the GNU Free Documentation License, Version 1.2 or any later
Motion analysis and simulation of a stratospheric airship
32 11 Vol 32 11 2011 11 Journal of Harbin Engineering University Nov 2011 doi 10 3969 /j issn 1006-7043 2011 11 019 410073 3 2 V274 A 1006-7043 2011 11-1501-08 Motion analysis and simulation of a stratospheric
Q π (/) ^ ^ ^ Η φ. <f) c>o. ^ ο. ö ê ω Q. Ο. o 'c. _o _) o U 03. ,,, ω ^ ^ -g'^ ο 0) f ο. Ε. ιη ο Φ. ο 0) κ. ο 03.,Ο. g 2< οο"" ο φ.
II 4»» «i p û»7'' s V -Ζ G -7 y 1 X s? ' (/) Ζ L. - =! i- Ζ ) Η f) " i L. Û - 1 1 Ι û ( - " - ' t - ' t/î " ι-8. Ι -. : wî ' j 1 Τ J en " il-' - - ö ê., t= ' -; '9 ',,, ) Τ '.,/,. - ϊζ L - (- - s.1 ai
IL - 13 /IL - 18 ELISA PCR RT - PCR. IL - 13 IL - 18 mrna. 13 IL - 18 mrna IL - 13 /IL Th1 /Th2
344 IL - 13 /IL - 18 1 2 1 2 1 2 1 2 1 2 3 1 2 13 18 IL - 13 /IL - 18 10% / OVA /AL OH 3 5% 16 ~ 43 d 44 d ELISA BALF IL - 13 IL - 18 PCR RT - PCR IL - 13 IL - 18 mrna IL - 13 mrna 0. 01 IL - 18 mrna 0.
ITU-R BT.1908 (2012/01) !" # $ %& '( ) * +, - ( )
(2012/01)!" # $ %& '( ) * +, - 0 1 "'./ ( ) BT ii.. (IPR) (ITU-T/ITU-R/ISO/IEC).ITU-R 1 1 http://www.itu.int/itu-r/go/patents/en. (http://www.itu.int/publ/r-rec/en ) () ( ) BO BR BS BT F M P RA RS S SA
Acoustic Signal Adjustment by Considering Musical Expressive Intention Using a Performance Intension Function
1,a) 2 MOS Acoustic Signal Adjustment by Considering Musical Expressive Intention Using a Performance Intension Function Yuma Koizumi 1,a) Katunobu Itou 2 Abstract: We propose an estimation method for
[1] DNA ATM [2] c 2013 Information Processing Society of Japan. Gait motion descriptors. Osaka University 2. Drexel University a)
1,a) 1,b) 2,c) 1,d) Gait motion descriptors 1. 12 1 Osaka University 2 Drexel University a) higashiyama@am.sanken.osaka-u.ac.jp b) makihara@am.sanken.osaka-u.ac.jp c) kon@drexel.edu d) yagi@am.sanken.osaka-u.ac.jp
VSC STEADY2STATE MOD EL AND ITS NONL INEAR CONTROL OF VSC2HVDC SYSTEM VSC (1. , ; 2. , )
22 1 2002 1 Vol. 22 No. 1 Jan. 2002 Proceedings of the CSEE ν 2002 Chin. Soc. for Elec. Eng. :025828013 (2002) 0120017206 VSC 1, 1 2, (1., 310027 ; 2., 250061) STEADY2STATE MOD EL AND ITS NONL INEAR CONTROL
v.connect 2 v.connect : A Singing Synthesis System Enabling Users to Control Vocal Tones Makoto Ogawa, 1 Syunji Yazaki 1 and Kôki Abe 1 VOCALOID
v.connect 1 1 1 VOCALOID UTAU WORLD Vorbis v.connect 2 1.7 2.2 v.connect : A Singing Synthesis System Enabling Users to Control Vocal Tones Makoto Ogawa, 1 Syunji Yazaki 1 and Kôki Abe 1 Since the release
GPU [16] ( ) GPU [17] GPU GPU Stam [1] 2 [2] Wang [18] Thürey [19] Zhang [20] 2 (smoothed Kim [21] particlehydrodynamicssph) [3] SPH [4] SPH M
25 8 2013 8 Vol25No8 JournalofComputer-AidedDesign & ComputerGraphics Aug2013 1) 1)* 2) 3) 2) 1) ( 100190) 2) ( 100190) 3) ( 100190) (xpzhang@nlpriaaccn) SPH TP391 InteractiveSimulationforWaterDropEffects
Πτυχιακή Εργασι α «Εκτι μήσή τής ποιο τήτας εικο νων με τήν χρή σή τεχνήτων νευρωνικων δικτυ ων»
Ανώτατο Τεχνολογικό Εκπαιδευτικό Ίδρυμα Ανατολικής Μακεδονίας και Θράκης Σχολή Τεχνολογικών Εφαρμογών Τμήμα Μηχανικών Πληροφορικής Πτυχιακή Εργασι α «Εκτι μήσή τής ποιο τήτας εικο νων με τήν χρή σή τεχνήτων
934 Ν. 9<Π)/94. Ε.Ε. Παρ. 1(H) Αρ. 2863,43.94
Ε.Ε. Παρ. 1(H) Αρ. 286,4.94 94 Ν. 9
Research on mode-locked optical fiber laser
2003 6 20 Research on mode-locked optical fiber laser 1 36303 Abstract- For future ultrahigh-speed optical communications, an ultrashort optical pulse train at a high repetitionrate will be indispensable.
Research on model of early2warning of enterprise crisis based on entropy
24 1 Vol. 24 No. 1 ont rol an d Decision 2009 1 Jan. 2009 : 100120920 (2009) 0120113205 1, 1, 2 (1., 100083 ; 2., 100846) :. ;,,. 2.,,. : ; ; ; : F270. 5 : A Research on model of early2warning of enterprise
Probability and Random Processes (Part II)
Probability and Random Processes (Part II) 1. If the variance σ x of d(n) = x(n) x(n 1) is one-tenth the variance σ x of a stationary zero-mean discrete-time signal x(n), then the normalized autocorrelation
J. of Math. (PRC) 6 n (nt ) + n V = 0, (1.1) n t + div. div(n T ) = n τ (T L(x) T ), (1.2) n)xx (nt ) x + nv x = J 0, (1.4) n. 6 n
Vol. 35 ( 215 ) No. 5 J. of Math. (PRC) a, b, a ( a. ; b., 4515) :., [3]. : ; ; MR(21) : 35Q4 : O175. : A : 255-7797(215)5-15-7 1 [1] : [ ( ) ] ε 2 n n t + div 6 n (nt ) + n V =, (1.1) n div(n T ) = n
Zigbee. Zigbee. Zigbee Zigbee ZigBee. ZigBee. ZigBee
Zigbee 150m 1000m Zigbee Zigbee Zigbee ZigBee ZigBee ZigBee 1 Zigbee Zigbee PC PC PC Zigbee 65536 256 20 30 2011.06 Signal Process & System 1 DS18B20 ACS712 TI CC2430 CC2430 Zigbee PC LED 1 1 DS18B20 9~12-55
Approximation Expressions for the Temperature Integral
20 7Π8 2008 8 PROGRSS IN CHMISRY Vol. 20 No. 7Π8 Aug., 2008 3 3 3 3 3 ( 230026),,,, : O64311 ; O64213 : A : 10052281X(2008) 07Π821015206 Approimation pressions for the emperature Integral Chen Haiiang
MachineDancing: MikuMikuDance (MMD) *1 MMD MMD. Kinect. MachineDancing. 3 MachineDancing. 1 MachineDancing :
MachineDancing: 1 1 3 MachineDancing GP 1. 33DCG 3D CG MikuMikuDance (MMD) *1 MMD MMD ( ) () 3D 1 National Institute of Advanced Industrial Science and Technology (AIST) *1 http://www.geocities.jp/higuchuu4
Research on divergence correction method in 3D numerical modeling of 3D controlled source electromagnetic fields
33 4 04 GLOBAL GEOLOGY Vol. 33 No. 4 Dec. 04 004 5589 04 04 096 09. 3006. 30070 P63. 35 A doi 0. 3969 /j. issn. 0045589. 04. 04. 0 Research on divergence correction method in 3D numerical modeling of 3D
: Monte Carlo EM 313, Louis (1982) EM, EM Newton-Raphson, /. EM, 2 Monte Carlo EM Newton-Raphson, Monte Carlo EM, Monte Carlo EM, /. 3, Monte Carlo EM
2008 6 Chinese Journal of Applied Probability and Statistics Vol.24 No.3 Jun. 2008 Monte Carlo EM 1,2 ( 1,, 200241; 2,, 310018) EM, E,,. Monte Carlo EM, EM E Monte Carlo,. EM, Monte Carlo EM,,,,. Newton-Raphson.
High order interpolation function for surface contact problem
3 016 5 Journal of East China Normal University Natural Science No 3 May 016 : 1000-564101603-0009-1 1 1 1 00444; E- 00030 : Lagrange Lobatto Matlab : ; Lagrange; : O41 : A DOI: 103969/jissn1000-56410160300
ΔΗΜΟΤΙΚΕΣ ΕΚΛΟΓΕΣ 18/5/2014 ΑΚΥΡΑ
ΔΗΜΟΤΙΚΕΣ ΕΚΛΟΓΕΣ 18/5/2014 ΑΚΥΡΑ ΑΔΑΜΗΣ Δ.Κ. / Τ.Κ. E.T. ΕΓΓ/ΝΟΙ ΨΗΦΙΣΑΝ ΕΓΚΥΡΑ ΓΙΟΒΑΣ ΙΩΑΝΝΗΣ ΛΕΥΚΑ ΠΑΝΑΓΙΩΤΗΣ ΜΑΝΤΑΣ ΠΑΝΑΓΙΩΤΗΣ ΔΑΛΙΑΝΗΣ ΓΕΩΡΓΙΟΣ ΑΣΤΡΟΣ 5 2.728 1.860 36 1.825 69 3,8% 152 8,3% 739 40,5%
Electronic Supplementary Information
Electronic Supplementary Information Unprecedented Carbon-Carbon Bond Cleavage in Nucleophilic Aziridine Ring Opening Reaction, Efficient Ring Transformation of Aziridines to Imidazolidin-4-ones Jin-Yuan
[2] y π π ( )π j πj i πi πj i 2. U = {1 K N} y p(s) S i j k I k yij wi = 1 πi πj i I k = 1 k S ^tπ = { i j wiyij 0k S y S πk k πk = Pr(k S)=Pr(I k =1)
26 10 Vol.26 No.10 Statistics&InformationForum 2011 10 Oct.2011 ab b ( a. ;b. 100872) ; ; ; C811 A 1007-3116(2011)10-0003-06 1934 Neyman Neyman [1] 2011-05-23 (10JJD790036); (11BTJ009) ; 3 [2] y π π (
Sinsy: HMM. Sinsy An HMM-based singing voice synthesis system which can realize your wish I want this person to sing my song
. Sinsy: HMM 2 (hidden Markov model; HMM) 2009 2 HMM : Sinsy Sinsy 70 Sinsy Sinsy An HMM-based singing voice synthesis system which can realize your wish I want this person to sing my song Keiichiro Oura,
Ένα µοντέλο Ισοδύναµης Χωρητικότητας για IEEE Ασύρµατα Δίκτυα. Εµµανουήλ Καφετζάκης
Ένα µοντέλο Ισοδύναµης Χωρητικότητας για IEEE 802.11 Ασύρµατα Δίκτυα. Εµµανουήλ Καφετζάκης mkafetz@iit.demokritos.gr Το κίνητρο µας-συνεισφορά Η ασύρµατη δικτύωση λαµβάνει ευρείας αποδοχής. Το πρότυπο
Studies on the Binding Mechanism of Several Antibiotics and Human Serum Albumin
2005 63 Vol. 63, 2005 23, 2169 2173 ACTA CHIMICA SINICA No. 23, 2169 2173 a,b a a a *,a ( a 130012) ( b 133002), 26 K A 1.98 10 4, 1.01 10 3, 1.38 10 3, 5.97 10 4 7.15 10 4 L mol 1, n 1.16, 0.86, 1.19,
THE BEST AUDIO SOLUTIONS. Cmedia is Solutions. Cmedia Solutions: Applications: Worldwide Solutions That Touch People s Hearts!
THE BEST AUDIO SOLUTIONS Worldwide Solutions That Touch People s Hearts! Cmedia is Solutions Founded in 1991, Cmedia is the global leading IC/software solution provider. C-Media s goal has remained consistent
[15], [16], [17] [6] [2] [5] Jiang [6] 2.1 [6], [10] Score(x, y) y ( 1) ( 1 ) b e ( 1 ) b e. O(n 2 ) 2.3. 2.2 Jiang [6] (word lattice reranking)
1,a) 1 2 10 1. [6] [1], [6], [8], [10], [11] 2 n n+1 C 2 O(n 2 ) 1 153-8505 4-6-1 a) kaji@tkl.iis.u-tokyo.ac.jp [10] [19], [23] [6] [6] (3 ) 10 (1) (2) 3 c 2012 Information Processing Society of Japan
2002 Journal of Software
1000-9825/2002/13(12)2251-08 2002 Journal of Software Vol13 No12 ( 100080) E-mail lisa_qiao@sinacom htt//ieliscasaccn QoS(quality of service) P393 A [1] Internet [2] QoS [3] 1 11 m (m>1) 12 [4] 2001-03-09
ITU-R SM (2012/09)
(2012/09) SM ii.. (IPR) (ITU-T/ITU-R/ISO/IEC).ITU-R 1 1 http://www.itu.int/itu-r/go/patents/en. (http://www.itu.int/publ/r-rec/en ) ( ) () BO BR BS BT F M P RA RS S SA SF SM SNG TF V 2013 :.ITU-R 1 ITU
Διπλωματική Εργασία της φοιτήτριας του Τμήματος Ηλεκτρολόγων Μηχανικών και Τεχνολογίας Υπολογιστών της Πολυτεχνικής Σχολής του Πανεπιστημίου Πατρών
ΠΑΝΕΠΙΣΤΗΜΙΟ ΠΑΤΡΩΝ ΤΜΗΜΑ ΗΛΕΚΤΡΟΛΟΓΩΝ ΜΗΧΑΝΙΚΩΝ ΚΑΙ ΤΕΧΝΟΛΟΓΙΑΣ ΥΠΟΛΟΓΙΣΤΩΝ ΤΟΜΕΑΣ:ΤΗΛΕΠΙΚΟΙΝΩΝΙΩΝ ΚΑΙ ΤΕΧΝΟΛΟΓΙΑΣ ΠΛΗΡΟΦΟΡΙΑΣ ΕΡΓΑΣΤΗΡΙΟ:ΕΝΣΥΡΜΑΤΗΣ ΤΗΛΕΠΙΚΟΙΝΩΝΙΑΣ Διπλωματική Εργασία της φοιτήτριας
D-Glucosamine-derived copper catalyst for Ullmann-type C- N coupling reaction: theoretical and experimental study
Electronic Supplementary Material (ESI) for RSC Advances. This journal is The Royal Society of Chemistry 2016 D-Glucosamine-derived copper catalyst for Ullmann-type C- N coupling reaction: theoretical
ss rt çã r s t Pr r Pós r çã ê t çã st t t ê s 1 t s r s r s r s r q s t r r t çã r str ê t çã r t r r r t r s
P P P P ss rt çã r s t Pr r Pós r çã ê t çã st t t ê s 1 t s r s r s r s r q s t r r t çã r str ê t çã r t r r r t r s r t r 3 2 r r r 3 t r ér t r s s r t s r s r s ér t r r t t q s t s sã s s s ér t
: Ω F F 0 t T P F 0 t T F 0 P Q. Merton 1974 XT T X T XT. T t. V t t X d T = XT [V t/t ]. τ 0 < τ < X d T = XT I {V τ T } δt XT I {V τ<t } I A
2012 4 Chinese Journal of Applied Probability and Statistics Vol.28 No.2 Apr. 2012 730000. :. : O211.9. 1..... Johnson Stulz [3] 1987. Merton 1974 Johnson Stulz 1987. Hull White 1995 Klein 1996 2008 Klein
Area Location and Recognition of Video Text Based on Depth Learning Method
21 6 2016 12 Vol 21 No 6 JOURNAL OF HARBIN UNIVERSITY OF SCIENCE AND TECHNOLOGY Dec 2016 1 1 1 2 1 150080 2 130300 Gabor RBM OCR DOI 10 15938 /j jhust 2016 06 012 TP391 43 A 1007-2683 2016 06-0061- 06
Technical Research Report, Earthquake Research Institute, the University of Tokyo, No. +-, pp. 0 +3,,**1. No ,**1
No. +- 0 +3,**1 Technical Research Report, Earthquake Research Institute, the University of Tokyo, No. +-, pp. 0 +3,,**1. * Construction of the General Observation System for Strong Motion in Earthquake
Anomaly Detection with Neighborhood Preservation Principle
27 27 Workshop on Information-Based Induction Sciences (IBIS27) Tokyo, Japan, November 5-7, 27. Anomaly Detection with Neighborhood Preservation Principle Tsuyoshi Idé Abstract: We consider a task of anomaly
Protease-catalysed Direct Asymmetric Mannich Reaction in Organic Solvent
Supplementary information for the paper Protease-catalysed Direct Asymmetric Mannich Reaction in Organic Solvent Yang Xue, Ling-Po Li, Yan-Hong He * & Zhi Guan * School of Chemistry and Chemical Engineering,
Legal use of personal data to fight telecom fraud
Legal use of personal data to fight telecom fraud Dimitris Gritzalis May 2001 Ημερίδα Ελληνικού Φορέα Αντιμετώπισης Τηλεπικοινωνιακής Απάτης (ΕΦΤΑ) Tηλεπικοινωνιακή Απάτη: Μέθοδοι - Πρόληψη - Προεκτάσεις
Audio Engineering Society. Convention Paper. Presented at the 120th Convention 2006 May Paris, France
Audio Engineering Society Convention Paper Presented at the 1th Convention May 3 Paris, France! " ")*)+, A System for Head Related Impulse Responses Rapid Measurement and Direct Customization Simone Fontana
Συστήµατα Πολυµέσων Ενδιάµεση Εξέταση: Οκτώβριος 2004
Ενδιάµεση Εξέταση: Οκτώβριος 4 ΜΕΡΟΣ Β: ΑΣΚΗΣΕΙΣ Άσκηση (25 µονάδες): Μια εικόνα αποχρώσεων του γκρι και διαστάσεων 25 x pixel έχει κωδικοποιηθεί κατά PCM µε βάθος χρώµατος 3 bits /pixel. Οι τιµές φωτεινότητας
Higher-Order Correlation Analysis of Pitch Fluctuations in Sustained Normal Vowels by the Method of Surrogate Data
a) Higher-Order Correlation Analysis of Pitch Fluctuations in Sustained Normal Vowels by the Method of Surrogate Data Isao TOKUDA a), Takaya MIYANO, and Kazuyuki AIHARA 2 3 3 2 3 1. [1] [3] Department
ΓΗΣ ΕΠΙΣΗΜΟΥ ΕΦΗΜΕΡΙΔΟΣ ΤΗΣ ΔΗΜΟΚΡΑΤΙΑΣ ύττ* *Αρ. 870 της 23ης ΑΠΡΙΛΙΟΥ 1971 ΝΟΜΟΘΕΣΙΑ
ΠΑΡΑΡΤΗΜΑ ΠΡΩΤΝ ΓΗΣ ΕΠΙΣΗΜΥ ΕΦΗΜΕΡΙΔΣ ΤΗΣ ΔΗΜΚΡΑΤΙΑΣ ύττ* *Αρ. 87 της 2ης ΑΠΡΙΛΙΥ 1971 ΝΜΘΕΣΙΑ ΜΕΡΣ Ι Ό περί Τελνειακών Δασμών και Φόρν Καταναλώσες ('Επιβλή και Επιστρφή τύταιν) (Τρππιητικός) (Άρ. 2) Νόμς
Optimizing Microwave-assisted Extraction Process for Paprika Red Pigments Using Response Surface Methodology
2012 34 2 382-387 http / /xuebao. jxau. edu. cn Acta Agriculturae Universitatis Jiangxiensis E - mail ndxb7775@ sina. com 212018 105 W 42 2 min 0. 631 TS202. 3 A 1000-2286 2012 02-0382 - 06 Optimizing
ΔΙΠΛΩΜΑΤΙΚΕΣ ΕΡΓΑΣΙΕΣ
ΔΙΠΛΩΜΑΤΙΚΕΣ ΕΡΓΑΣΙΕΣ ΤΜ. ΜΗΧΑΝΙΚΩΝ ΠΛΗΡΟΦΟΡΙΚΗΣ & ΤΗΛΕΠΙΚΟΙΝΩΝΙΩΝ 2018-2019 Επιβλέπουσα: Μπίμπη Ματίνα Ανάλυση της πλατφόρμας ανοιχτού κώδικα Home Assistant Το Home Assistant είναι μία πλατφόρμα ανοιχτού
X g 1990 g PSRB
e-mail: shibata@provence.c.u-tokyo.ac.jp 2005 1. 40 % 1 4 1) 1 PSRB1913 16 30 2) 3) X g 1990 g 4) g g 2 g 2. 1990 2000 3) 10 1 Page 1 5) % 1 g g 3. 1 3 1 6) 3 S S S n m (1/a, b k /a) a b k 1 1 3 S n m,
Vol. 31,No JOURNAL OF CHINA UNIVERSITY OF SCIENCE AND TECHNOLOGY Feb
Ξ 31 Vol 31,No 1 2 0 0 1 2 JOURNAL OF CHINA UNIVERSITY OF SCIENCE AND TECHNOLOGY Feb 2 0 0 1 :025322778 (2001) 0120016205 (, 230026) : Q ( m 1, m 2,, m n ) k = m 1 + m 2 + + m n - n : Q ( m 1, m 2,, m
! : ;, - "9 <5 =*<
ITU-R M.473- (00/0)! (TDMA/FDMA) ""# $ %!& ' " ( ) 34 --./ 0, (MSS) * * )! +, 56 78 89 : ;, - "9
Διπλωματική Εργασία. του φοιτητή του Τμήματος Ηλεκτρολόγων Μηχανικών και Τεχνολογίας Υπολογιστών της Πολυτεχνικής Σχολής του Πανεπιστημίου Πατρών
ΠΑΝΕΠΙΣΤΗΜΙΟ ΠΑΤΡΩΝ ΤΜΗΜΑ ΗΛΕΚΤΡΟΛΟΓΩΝ ΜΗΧΑΝΙΚΩΝ ΚΑΙ ΤΕΧΝΟΛΟΓΙΑΣ ΥΠΟΛΟΓΙΣΤΩΝ ΤΟΜΕΑΣ: ΤΗΛΕΠΙΚΟΙΝΩΝΙΩΝ ΚΑΙ ΤΕΧΝΟΛΟΓΙΑΣ ΠΛΗΡΟΦΟΡΙΑΣ ΕΡΓΑΣΤΗΡΙΟ ΕΝΣΥΡΜΑΤΗΣ ΤΗΛΕΠΙΚΟΙΝΩΝΙΑΣ Διπλωματική Εργασία του φοιτητή του
Schedulability Analysis Algorithm for Timing Constraint Workflow Models
CIMS Vol.8No.72002pp.527-532 ( 100084) Petri Petri F270.7 A Schedulability Analysis Algorithm for Timing Constraint Workflow Models Li Huifang and Fan Yushun (Department of Automation, Tsinghua University,
LUO, Hong2Qun LIU, Shao2Pu Ξ LI, Nian2Bing
2003 61 3, 435 439 ACTA CHIMICA SINICA Vol 61, 2003 No 3, 435 439 2 ΞΞ ( 400715), 2, 2, 2, 3/ 2 2,, 2,, Ne w Methods for the Determination of the Inclusion Constant between Procaine Hydrochloride and 2Cyclodextrin
Yesenia Lacouture-Parodi, PhD. AudioLabs, Fraunhofer IIS Prof. Dr. Emanuël Habets, AudioLabs, Fraunhofer IIS
ΑΡΙΣΤΟΤΕΛΕΙΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΘΕΣΣΑΛΟΝΙΚΗΣ Η Επιρροή των Πρώιμων Ανακλάσεων στην Interaural Time Difference σε Συστήματα Crosstalk Cancellation Δημήτριος Κοσμίδης Διπλωματική Εργασία Πολυτεχνική Σχολή Τμήμα
An Automatic Modulation Classifier using a Frequency Discriminator for Intelligent Software Defined Radio
C IEEJ Transactions on Electronics, Information and Systems Vol.133 No.5 pp.910 915 DOI: 10.1541/ieejeiss.133.910 a) An Automatic Modulation Classifier using a Frequency Discriminator for Intelligent Software
N8-0 (1 *.0 ' :7 ' _H $ (G0 )-: + $ B1+ N (+:- A+1 5.
! *1 19/08/ :! $%&' (&) 19/10/08 :! 01 (&) 0 (1 * 0 #$ %& '$ () *+, - #./ (NAMO) ( - (8 - $ NP-Complete NAMO. ( ( *+, #$ )+, ( #$ > - *.+) =+ );< :( 9 #$ *. *F '- $ % ( #F, F % F ( $ BC+ ) BD 'EA)?+@ NAMO?+@
Evolution of Novel Studies on Thermofluid Dynamics with Combustion
MEMOIRS OF SHONAN INSTITUTE OF TECHNOLOGY Vol. 42, No. 1, 2008 * Evolution of Novel Studies on Thermofluid Dynamics with Combustion Hiroyuki SATO* This paper mentions the recent development of combustion
Γλωσσική Τεχνολογία. 7 η Ενότητα: Αναγνώριση ομιλίας και συστήματα προφορικών διαλόγων. Ίων Ανδρουτσόπουλος.
Γλωσσική Τεχνολογία 7 η Ενότητα: Αναγνώριση ομιλίας και συστήματα προφορικών διαλόγων 2015 16 Ίων Ανδρουτσόπουλος http://www.aueb.gr/users/ion/ 1 Οι διαφάνειες αυτές βασίζονται εν μέρει στην ύλη του βιβλίου
Χρήστος Ξενάκης. Πανεπιστήμιο Πειραιώς, Τμήμα Ψηφιακών Συστημάτων
ΘΕΩΡΙΑ ΠΛΗΡΟΦΟΡΙΑΣ Κεφάλαιο 5 : Θόρυβος Χρήστος Ξενάκης Πανεπιστήμιο Πειραιώς, Τμήμα Ψηφιακών Συστημάτων Περιεχόμενα Ομιλίας Είδη θορύβου Περιγραφή θορύβου Θεώρημα Shannon Hartley Απόδοση ισχύος και εύρους
Estimation of stability region for a class of switched linear systems with multiple equilibrium points
29 4 2012 4 1000 8152(2012)04 0409 06 Control Theory & Applications Vol 29 No 4 Apr 2012 12 1 (1 250061; 2 250353) ; ; ; TP273 A Estimation of stability region for a class of switched linear systems with
GF GF 3 1,2) KP PP KP Photo 1 GF PP GF PP 3) KP ULultra-light 2.KP 2.1KP KP Fig. 1 PET GF PP 4) 2.2KP KP GF 2 3 KP Olefin film Stampable sheet
JFE No. 4 20045 p 82 Composite Material for Automotive Headliners Expandable Stampable Sheet with Light Weight and High Stiffness A JFE SUZU JFE HA KP 50 mass 30 UL 800 g/m 2 7.2 N/mm Abstract: KP-Sheet
The Greek Data Protection Act: The IT Professional s Perspective
The Greek Data Protection Act: The IT Professional s Perspective Dimitris Gritzalis June 2001 Διημερίδα για την Ασφάλεια στις Τεχνολογίες των Πληροφοριών Λευκωσία, 15-16 Ιουνίου 2001 Ο Ελληνικός νόμος
THE BEST AUDIO SOLUTIONS. Cmedia is Solutions. Cmedia Solutions: Applications: Worldwide Solutions That Touch People s Hearts!
THE BEST AUDIO SOLUTIONS Worldwide Solutions That Touch People s Hearts! Cmedia is Solutions Founded in 1991, Cmedia is the global leading IC/software solution provider. C-Media s goal has remained consistent