ISSN 1007-7626 CN 11-3870 / Q http / / cjbmb bjmu edu cn Chinese Journal of Biochemistry and Molecular Biology 2012 2 28 2 99 ~ 107 G BALOUCOUNE Guillaume A 430074 * G G-protein-coupled receptors GPCRs S- S-palmitoylation GPCRs GPCRs GPCRs protein acly transferases PATs thioesterases GPCRs C 4 / 5 GPCRs GPCRs GPCRs GPCRs GPCRs G Q25 Q291 Palmitoylation Modification Regulates G-protein-coupled Receptors Effects LIU JieBALOUCOUNE Guillaume A CHUN Lei * Key Laboratory of Molecular Biophysics of Ministry of EducationSchool of Life Science and Technology Huazhong University of Science and TechnologyWuhan 430074China Abstract G-protein-coupled receptors GPCRs are transmembrane proteinshence a number of their structural and functional features are modulated by both proteins and lipids S-palmitoylationas a classical lipid modificationregulates diverse aspects of GPCRs by affecting the interaction between GPCRs and signal proteins or lipid molecules It is defined as the addition of saturated 16-carbon palmitate acid to specific cysteine residues through the formation of a liable thioester bond The palmitoylation / depalmitoylation dynamics is regulated reversibly by both the palmitoyl acyl transferases PATs and palmitoyl protein thioesterases under various physiological status Many GPCRs are palmitoylated on cysteine residues present in their cytoplasmic termini The insertion of palmitate into the cytoplasmic leaflet of the plasma membrane can create the fouth and / or the fifth intracellular loopthus profoundly affecting GPCRs structuretraffickingsortingsignalingdesensitisationinternalization and oligomerisation Furthermorethe interplay between palmitoylation and other posttranslational modificationssuch as phosphorylationubiquitination and nitrosylationcan regulate the function of GPCRs coordinatively It is expected that the identification of enzymes involved in GPCRs palmitoylation dynamics will be a key to delineate the role of palmitoylation in regulating GPCRs functions Key words G-protein-coupled receptors palmitoylation dynamics signaling 2011-11-09 2011-12-21 973 No 2012CB518006 * Tel 027-65516629 E-mail lchuncn@ gamil com Received November 92011 Accepted December 212011 Supported by Major State Basic Research Development Program of China 973 Program No 2012CB518006 * Corresponding author Tel 027-65516629 E-mail lchuncn@ gamil com
100 28 G G-protein-coupled receptors GPCRs C GPCRs 7 1 α H8 4 A H8 C 1 GPCRs GPCRs A Table 1 A C 1 ~ 2 myristoylation prenylation 5-5- 3 hydroxytryptamine receptor 5-HT 5-HT 5 4 a 5-HT 6 7 a A C H8 C GPCRs 1984 4 metabotropic GPCRs glutamate receptor 4 mglur4 C GPCRs 7 10 GPCRs 7 3 - μ- acyl-biotinyl exchange ABE opioid receptor μ-or 8 C 2 2 C170 C GPCRs V 9 1a V 10 2 vasopressin receptor VR C 2 GPCRs GPCRs G 2 1 1 GPCRs 1 1 DHHC Asp-His-His-Cys 2 DHHC 28 1 ABE 2 23 7 PAT 3 H click 3 ABE 1 2 3 2011 5 somatostatin receptor 5SSTR5 1 GPCRs 1 2 GPCRs ZDHHC5 N H8 16 29 GPCRs S-
2 G 101 Table 1 Partial list of GPCR palmitoylation Cysteine Receptor Flanking sequences C-termini H8-Helix Bovine rhodopsin 11 QFRNCMVTTLCCGKNPLGDDE Human β 2 -adrenergic receptor 12 DFRIAFQELLCLRRSSLKAYG Porcine α 2A -adrenergic receptor 13 HDFRRAFKKILCRGDRKRIV Rat LH / CG receptor 14 DFLLLLSRFGCCKRRAELYRRK Human ET B endothelin receptor 15 RFKNCFKSCLCCWCQSFEEKQ Human muscarinic acetylcholine receptor m2 16 KKTFKHLLMCHYKNIGATR Human thyrotropin receptor 17 VFILLSKFGICKRQAQAYRGQ Human A 1 adenosine receptor 18 FLKIWNDHFRCQPAPPIDEDL Human D 1 dopamine receptor 19 RKAFSTLLGCYRLCPATNNAIE Rat bradykinin B 2 receptor 20 KKSREVYQAICRKGGCMGESV Human chemokine 5 receptor 21 FFQKHIAKRFCKCCSIFQQEAP Canine H 2 histamine receptor 22 FRTAYQQLFRCRPASHNAQET Metabotropic glutamate receptor 4 7 Human prostaglandin receptor 23 VFQRLKLWVCCLCLGPAHGDS Distal 5-hydroxytryptamine receptor 4a 24 CCDDERYKRPPILGQTVPCSTTTINGSTHLRYTVLRYTVL HSGHHQELEKLPIHNDPESLESCF 5-hydroxytryptamine receptor 7a 6 CQYRNINRKLSAAGMHEALKLAERPERPELVLQKSDYC CNLRLPGSSDSRASASRAAGITGVSHCARPCMLF CYEMQAQIYRTETSSTVHNTHPRNGHC Thromboxane A 2 receptor TPβ 25 LLCCARRAARRRHATHGDRPRASGCLA Follicle-stimulating hormone receptor 26 β 1 -Adrenergic receptor 27 i-loop μ-opioid receptor 8 DRYIAVCHPVKALDFRTPRNAK 9 Rat vasopressin receptor V 1a LLQDCVQSFPCCHSMAQKFAK 10 Human vasopressin receptor V 2 SVSSELRSLLCCARGRTPPSLG * C is the cysteine modified by palmitoylation 2 2 2 GPCRs 1 protein palmitoyl thioesterase 1 PPT1-1 acyl protein thioesterase 1 APT1 GPCRs β 2-30 β 2 -adrenergic receptor β 2 -AR GPCRs 3 H 32 2 1 RNA 2 2-3 H 2-bromopalmitate 2-BP 3 H β 2 -AR 33 1 31 dopamine D 1 receptor1 D 1 R 34 α 1B FD196 α 1B -adrenergic receptorα 1B -AR 35 FD253 α 2A α 2A -adrenergic receptorα 2A - AR 36 δ- δ-opioid receptor δ-or 8 GPCRs 1A serotonin 1A receptor 37
102 28 GPCRs receptor C 308 311 4-16 C383 5 β 1 - β 1-23 adrenergic receptor β 1 -AR / C 27 β 1 -AR C392 / C393 C414 Fig 1 2 90 min 15 min 27 3 GPCRs Fig 1 The model of C-terminal palmitoylation of GPCRs family A For the member of family A there is a short amphipathic α helix H8 helix at the juxtamembranous - C-termini and the seventh transmenbrance regionwhich can form the forth loop by palmitoylation some of GPCRs also can form the fifth loop by palmitoylation or isoprenylation at GPCRs the distal site s located in C-termini GPCRs G 3 2 GPCRs 3 1 GPCRs GPCRs GPCRs rhodopsin 2 GPCRs X- - H8 GPCRs 4 GPCRs 38 β 2 -AR X- 39 H8 GPCRs CXCR4 chemokine GPCRs CXCR4 receptor CXCR4 H8 C β H8 1 -AR 40 C392 / C393 GPCRs C 27 5 prostaglandin
2 G 103 49 41 GPCRs Gα GPCRs Gα 3 3 GPCRs D 1 R GPCRs A GPCRs rndothelin receptor A Gαo Gαi Gαq GPCRs C402 C403 C405 4 1 Gαq Gαi 42 2 Gαo C 402 caveolin Gαi 15 43 3 A Gαq 402 44 4 Gαi 45 3 Gαo 46 1 V 2 cannabinoid receptor 1 CB 1 R C415 β- β-arrestin C415 CB 1 R MAPK Gαs 1 50 CRAC cholesterol interaction / recognition 3 5 GPCRs amino acid sequence consensus CRAC GPCRs PKA G G-protein- CB 1 R 47 coupled receptor kinases GRKs β-arrestin GPCRs PKA GRKs β 2 -AR β-arrestin 32 G 48 GPCRs G 3 4 GPCRs G GPCRs GPCRs A G 2 3 Gα C C GPCRs H8 Gα β-arrestin GPCRs H8 C GPCRs β 2 -AR C341 PKA Gα M 2 V 1a R 9 CCR5 muscarinic acetylcholine receptor 2 M 2 R chemokine CCR5 receptor CCR5 51 Gαo Gαi2 16 GPCRs V 2 R 10 β-arrestin Gα β 2 -AR 341 C341G GPCRs V 2 R 50 33 thyroid stimulating hormone receptor β 2 - HSTR 52 CCR5 51 GPCRs AR Gαs 12 A protein kinase A PKA β-arrestin
104 28 5-HT 7 a R 24 C328 / Y352 C329 C328 / C329 β-arrestin2 4 2 C386 β 2 -AR 341 Wnt Wnt 3 6 GPCRs GPCR LRP6 GPCRs β 2 - LRP6 AR LRP6 39 2 GPCRs LRP6-57 GPCRs N1E-115 GPCRs 1A fluorescence resonance energy transfer FRET 53 4 3 FRET 1 FRET FRET synthetase NOS L- nitric oxideno S- S- 1A nitrosylation FRET NO 3-53 - 3-morpholinosydnonimine SIN-1 4 58 NO 4 1 GPCRs NO G β 2 -AR 54 A3 NOS adenosine receptor 3 55 5 V 1a R 9 CCR5 51 GPCRs GPCRs M 2 R 16 1 Gα V 2 R 10 B 2 bradykininb 2 6 lipoprotein receptor-related proteins 6 LRP6 nitric oxide β 2 -AR GPCRs receptor 56 C356
2 G 105 GPCRs 1 21-29 GPCRs G - rhodopsin are palmitylated J G 1-5 GPCRs receptor J J Biol Chem1989264 13 7564-7569 References 1 el-husseini Ael DBredt D S Protein palmitoylation a regulator of neuronal development and function J Nat Rev Neurosci 20023 10 791-802 2 Wan JRoth AFBailey A Oet al Palmitoylated proteins purification and identification J Nat Protoc20072 7 1573-1584 3 Martin B RCravatt B F Large-scale profiling of protein palmitoylation in mammalian cells J Nat Methods20096 2 135-138 4 Pin J PJoly CHeinemann S F Domains involved in the specificity of G protein activation in phospholipase C-coupled metabotropic glutamate receptors J EMBO J199413 2 342-348 5 Ponimaskin E GHeine MJoubert Let al The 5- hydroxytryptamine 4a receptor is palmitoylated at two different sitesand acylation is critically involved in regulation of receptor constitutive activity J J Biol Chem2002277 4 2534-2546 6 Kvachnina EDumuis AWlodarczyk Jet al Constitutive Gsmediatedbut not G12-mediatedactivity of the 5- hydroxytryptamine 5-HT7 a receptor is modulated by the palmitoylation of its C-terminal domain J Biochim Biophys Acta20091793 11 1646-1655 7 Alaluf SMulvihill E RMcIlhinney R A The metabotropic glutamate receptor mglur4but not mglur1 alphais palmitoylated when expressed in BHK cells J J Neurochem 199564 4 1548-1555 8 Petaja-Repo U EHogue MLeskela T Tet al Distinct subcellular localization for constitutive and agonist-modulated palmitoylation of the human delta opioid receptorj J Biol Chem2006281 23 15780-15789 9 Hawtin S RTobin A BPatel Set al Palmitoylation of the vasopressin V1a receptor reveals different conformational requirements for signaling agonist-induced receptor phosphorylationand sequestration J J Biol Chem2001 276 41 38139-38146 10Sadeghi H MInnamorati GDagarag Met al Palmitoylation of the V2 vasopressin receptor J Mol Pharmacol199752 11Ovchinnikov Yu AAbdulaev N GBogachuk A S Two adjacent cysteine residues in the C-terminal cytoplasmic fragment of bovine FEBS Lett1988230 1-2 12O'Dowd B FHnatowich MCaron M Get al Palmitoylation of the human beta 2-adrenergic receptor Mutation of Cys341 in the carboxyl tail leads to an uncoupled nonpalmitoylated form of the 13Kennedy M ELimbird L E Mutations of the alpha 2Aadrenergic receptor that eliminate detectable palmitoylation do not perturb receptor-g-protein coupling J J Biol Chem1993 268 11 8003-8011 14Kawate NMenon K M Palmitoylation of luteinizing hormone / human choriogonadotropin receptors in transfected cells Abolition of palmitoylation by mutation of Cys-621 and Cys-622 residues in the cytoplasmic tail increases ligand-induced internalization of the receptor J J Biol Chem1994269 48 30651-30658 15Okamoto YNinomiya HTanioka Met al Palmitoylation of human endothelinb Its critical role in G protein coupling and a differential requirement for the cytoplasmic tail by G protein subtypes J J Biol Chem1997272 34 21589-21596 16Hayashi M KHaga T Palmitoylation of muscarinic acetylcholine receptor m2 subtypes reduction in their ability to activate G proteins by mutation of a putative palmitoylation sitecysteine 457in the carboxyl-terminal tail J Arch Biochem Biophys 1997340 2 376-382 17Tanaka KNagayama YNishihara Eet al Palmitoylation of human thyrotropin receptor slower intracellular trafficking of the palmitoylation-defective mutant J Endocrinology1998139 2 803-806 18Gao ZNi YSzabo Get al Palmitoylation of the recombinant human A1 adenosine receptor enhanced proteolysis of palmitoylation-deficient mutant receptors J Biochem J1999 342 Pt 2 387-395 19Jin HXie ZGeorge S Ret al Palmitoylation occurs at cysteine 347 and cysteine 351 of the dopamine D 1 receptor J Eur J Pharmacol1999386 2-3 305-312 20Soskic VNyakatura ERoos Met al Correlations in palmitoylation and multiple phosphorylation of rat bradykinin B2 receptor in Chinese hamster ovary cells J J Biol Chem1999 274 13 8539-8545 21Percherancier YPlanchenault TValenzuela-Fernandez Aet al Palmitoylation-dependent control of degradationlife span and membrane expression of the CCR5 receptor J J Biol Chem2001276 34 31936-31944 22Fukushima YSaitoh TAnai Met al Palmitoylation of the canine histamine H2 receptor occurs at Cys305 and is important for cell surface targeting J Biochim Biophys Acta2001 1539 3 181-191 23Miggin S MLawler O AKinsella B T Palmitoylation of the
106 28 human prostacyclin receptor Functional implications of palmitoylation and isoprenylation J J Biol Chem2003278 9 6947-6958 24Ponimaskin EGSchmidt MFHeine Met al 5- Hydroxytryptamine 4 a receptor expressed in Sf9 cells is palmitoylated in an agonist-dependent manner J Biochem J 2001353 Pt 3 627-634 25Reid H MKinsella B T Palmitoylation of the TPbeta isoform of the human thromboxane A2 receptor Modulation of G protein effector coupling and modes of receptor internalization J Cell Signal200719 5 1056-1070 26Uribe AZarinan TPerez-Solis M Aet al Functional and structural roles of conserved cysteine residues in the carboxylterminal domain of the follicle-stimulating hormone receptor in human embryonic kidney 293 cells J Biol Reprod200878 5 869-882 27Zuckerman D MHicks S WCharron Get al Differential regulation of two palmitoylation sites in the cytoplasmic tail of the beta1-adrenergic receptor J J Biol Chem2011286 21 19014-19023 28Mitchell D AVasudevan ALinder M Eet al Protein palmitoylation by a family of DHHC protein S-acyltransferases J J Lipid Res200647 6 1118-1127 29Kokkola TKruse CRoy-Pogodzik E Met al Somatostatin receptor 5 is palmitoylated by the interacting ZDHHC5 palmitoyltransferase J FEBS Lett2011585 17 2665-2670 30Yalovsky SRodr Guez-Concepcion MGruissem W Lipid modifications of proteins-slipping in and out of membranes J Trends Plant Sci19994 11 439-445 31Webb YHermida-Matsumoto LResh M D Inhibition of protein palmitoylationraft localizationand T cell signaling by 2-bromopalmitate and polyunsaturated fatty acids J J Biol Chem2000275 1 261-270 32Mouillac BCaron MBonin Het al Agonist-modulated palmitoylation of beta 2-adrenergic receptor in Sf9 cells J J Biol Chem1992267 30 21733-21737 33Loisel T PAnsanay HAdam Let al Activation of the beta 2 -adrenergic receptor-galpha s complex leads to rapid depalmitoylation and inhibition of repalmitoylation of both the receptor and Galpha s J J Biol Chem1999274 43 31014-31019 34Ng G YMouillac BGeorge S Ret al Desensitization phosphorylation and palmitoylation of the human dopamine D1 receptor J Eur J Pharmacol1994267 1 7-19 35Stevens P APediani JCarrillo J Jet al Coordinated agonist regulation of receptor and G protein palmitoylation and functional rescue of palmitoylation-deficient mutants of the G protein G11α following fusion to the α1b-adrenoreceptor J J Biol Chem 2001276 38 35883-35890 36Kennedy M ELimbird L E Palmitoylation of the alpha 2Aadrenergic receptor Analysis of the sequence requirements for and the dynamic properties of alpha 2A-adrenergic receptor palmitoylation J J Biol Chem1994269 50 31915-31922 37Papoucheva EDumuis ASebben Met al The 5- hydroxytryptamine 1A receptor is stably palmitoylatedand acylation is critical for communication of receptor with Gi protein J J Biol Chem2004279 5 3280-3291 38Palczewski KKumasaka THori Tet al Crystal structure of rhodopsin A G protein-coupled receptor J Science2000 289 5480 739-745 39Cherezov VRosenbaum D MHanson M Aet al Highresolution crystal structure of an engineered human beta2- adrenergic G protein-coupled receptor J Science2007318 5854 1258-1265 40Wu BChien E YMol C Det al Structures of the CXCR4 chemokine GPCR with small-molecule and cyclic peptide antagonists J Science2010 330 6007 1066-1071 41Maeda AOkano KPark P Set al Palmitoylation stabilizes unliganded rod opsin J Proc Natl Acad Sci U S A2010107 18 8428-8433 42Pucadyil T JChattopadhyay A Cholesterol modulates ligand binding and G-protein coupling to serotonin 1A receptors from bovine hippocampus J Biochim Biophys Acta20041663 1-2 188-200 43Okamoto TSchlegel AScherer P Eet al Caveolinsa family of scaffolding proteins for organizing " preassembled signaling complexes" at the plasma membrane J J Biol Chem1998 273 10 5419-5422 44Anderson R GJacobson K A role for lipid shells in targeting proteins to caveolaeraftsand other lipid domains J Science2002296 5574 1821-1825 45Zacharias D AViolin J DNewton A Cet al Partitioning of lipid-modified monomeric GFPs into membrane microdomains of live cells J Science2002296 5569 913-916 46Greaves JPrescott G RGorleku OAet al The fat controller roles of palmitoylation in intracellular protein trafficking and targeting to membrane microdomains Review J Mol Membr Biol200926 1 67-79 47Oddi SDainese ESandiford Set al Palmitoylation of cysteine 415 of helix 8 effect on membrane localisation and signalling of the CB 1 cannabinoid receptor J Br J Pharmacol2011 Epub ahead of print 48Allen J AYu J ZDonati R Jet al Beta-adrenergic receptor stimulation promotes G alpha s internalization through lipid rafts a study in living cells J Mol Pharmacol200567 5 1493-1504 49Moffett SAdam LBonin Het al Palmitoylated cysteine 341 modulates phosphorylation of the beta2-adrenergic receptor by the camp-dependent protein kinase J J Biol Chem1996271 35 21490-21497 50Charest P GBouvier M Palmitoylation of the V2 vasopressin receptor carboxyl tail enhances beta-arrestn recruitment leading to
2 G 107 efficient receptor endocytosis and ERK1 /2 activation J J Biol Chem2003278 42 41541-41551 51Kraft KOlbrich HMajoul Iet al Characterization of sequence determinants within the carboxyl-terminal domain of chemokine receptor CCR5 that regulate signaling and receptor internalization J J Biol Chem2001276 37 34408-34418 52Groarke D ADrmota TBahia D Set al Analysis of the C- terminal tail of the rat thyrotropin-releasing hormone receptor-1 in interactions and cointernalization with beta-arrestin 1-green fluorescent protein J Mol Pharmacol200159 2 375-385 53Kobe FRenner UWoehler Aet al Stimulation-and palmitoylation-dependent changes in oligomeric conformation of serotonin 5-HT1A receptors J Biochim Biophys Acta2008 1783 8 1503-1516 54Moffett SRousseau GLagace Met al The palmitoylation state of the beta 2 -adrenergic receptor regulates the synergistic action of cyclic AMP-dependent protein kinase and beta-adrenergic receptor kinase involved in its phosphorylation and desensitization J J Neurochem200176 1 269-279 55Oppermann M Chemokine receptor CCR5 insights into structurefunctionand regulation J Cell Signal200416 11 1201-1210 56Pizard ABlaukat AMichineau Set al Palmitoylation of the human bradykinin B2 receptor influences ligand efficacy J Biochemistry200140 51 15743-15751 57Abrami LKunz BIacovache Iet al Palmitoylation and ubiquitination regulate exit of the Wnt signaling protein LRP6 from the endoplasmic reticulum J Proc Natl Acad Sci U S A 2008105 14 5384-5389 58Adam LBouvier MJones T L Nitric oxide modulates beta 2 adrenergic receptor palmitoylation and signaling J J Biol Chem1999274 37 26337-26343 59Salaun CGreaves JChamberlain L H The intracellular dynamic of protein palmitoylation J J Cell Biol2010191 7 1229-1238