Bioinformatics Programming in Python. LOGO Βικάτος Παντελεήμων

Save this PDF as:

Μέγεθος: px
Εμφάνιση ξεκινά από τη σελίδα:

Download "Bioinformatics Programming in Python. LOGO Βικάτος Παντελεήμων"


1 Bioinformatics Programming in Python LOGO Βικάτος Παντελεήμων

2 Σύνοψη 1. Γιατί να χρησιμοποιούμε python ; 2. Python modules 3. Biopython 4. Παραδείγματα

3 Python Χαρακτηριστικά Διερμηνευόμενη,υψηλού επιπέδου Γ.Π. Ανοιχτού κώδικα Εύκολη Εκμάθηση Αναγνωσιμότητα Συντήρηση Εύπλαστη Παίζει παντού (Cross Platform) Συνεργάσιμη Ώριμη Όχι πια segmentation fault

4 Γιατί python? Ερώτημα : Διευκολύνει τους μηχανικούς που ασχολούνται με Bioinformatics ;

5 Γιατί python? Ερώτημα : Διευκολύνει τους μηχανικούς που ασχολούνται με Bioinformatics ; Απάντηση : Με βεβαιότητα ΝΑΙ!!!!

6 Γιατί python? Ερώτημα : Διευκολύνει τους μηχανικούς που ασχολούνται με Bioinformatics ; Απάντηση : Με βεβαιότητα ΝΑΙ!!!! Λόγος : Δεν ανησυχείς για τα παρακάτω : Παράξενα σύμβολα (~=, <>, eq, '\n', {}...) Εναλλακτική σύνταξη για να κάνει την ίδια λειτουργία Ορισμός τύπος μεταβλητών Διαχείριση μνήμης IO, call by reference/value κτλ

7 Ποια γλώσσα χρησιμοποιείται ;

8 Τι είναι η Biopython? BioPython : μια συλλογή τυποποιημένων libraries σε python για τη βιοπληροφορική. Ανοιχτού κώδικα (Open Source,) Cross platform: Linux, Windows, Mac OS X, Συναφή projects BioPerl, BioRuby, BioJava,

9 Τι είναι η Biopython? Πλεονεκτήματα χρήσης open source libraries : Αναπαραγωγιμότητα Ευκολία σύγκρισης αποτελεσμάτων Λιγότερα λάθη Λιγότερος χρόνος υλοποίησης

10 Εφαρμογές της Biopython Διαχείριση και επεξεργασία ακολουθιών BLAST (τοπική και online) Web databases ( NCBI s EUtils) Επιλογή command line διεπαφών (e.g. clustalw) Ομαδοποίηση (Bio.Cluster) Φυλογενετική (Bio.Nexus) Δομή Πρωτεϊνών (Bio.PDB) Υποστήριξη βάσεων (Bio.SQL) Γενετική Πληθυσμού (Bio.PopGen)

11 Επιπλέον modules NumPy SciPy N-dimensional μητρώα Συναρτήσεις γραμμικής άλγεβρας Μετασχηματισμούς Fourier Γεννήτορες τυχαίων αριθμών Στατιστικά πακέτα Αριθμητική ολοκλήρωση Γραμμική άλγεβρα Επεξεργασία σημάτων Επεξεργασία εικόνας Γενετικούς αλγόριθμους Επιλυτές Διαφορικών εξισώσεων

12 Επιπλέον modules Matplotlib Βιβλιοθήκη για το σχεδιασμό 2D και 3D διαγραμμάτων. Πλεονεκτήματα Ευκολία χρήσης Documentation και tutorials Αποδοτικό visualization.

13 Επιπλέον modules NLTK(Natural Language Toolkit)

14 Άλλες εφαρμογές και βιβλιοθήκες Django ( Web frameworks ) Plone ( Content Management System ) ReportLab ( PDF generation ) MPI for Python ( Παράλληλος Προγραμματισμός ) SymPy ( Συμβολικά Μαθηματικά ) Python/R interface ( στατιστική ανάλυση) SWIG ( Simplified Wrapper and Interface Generator) Pygr (βάση δεδομένων γραφικών ) PysCeS ( Προσομοίωση των κυτταρικών συστημάτων ) SloppyCell ( Προσομοίωση βιομοριακών δικτύων )...

15 Biopython Sequence objects >>> from Bio.Seq import Seq >>> my_seq = Seq("AGTACACTGGT") >>> my_seq Seq( AGTACACTGGT, Alphabet()) >>> print my_seq AGTACACTGGT >>> my_seq.alphabet Alphabet() Λειτουργούν ως strings αλλά έχουν περισσότερες ιδιότητες

16 Biopython - Alphabet

17 Biopython Seq Functions Βασικές συναρτήσεις complement() reverse_complement() transcribe() ) back_transcribe() ) translate() :συμπληρωματική : αντίστροφη συμπληρωματική : DNA to RNA : RNA to DNA : DNA to protein

18 Biopython Seq Functions Transcription

19 Biopython Seq Functions Transcription >>> from Bio.Seq import Seq >>> from Bio.Alphabet import IUPAC >>> coding_dna = Seq("ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG", IUPAC.unambiguous_dna) >>> coding_dna Seq( ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG, IUPACUnambiguousDNA()) >>> messenger_rna = coding_dna.transcribe() >>> messenger_rna Seq( AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG, IUPACUnambiguousRNA())

20 Biopython Seq Functions Translation

21 Biopython Seq Functions Translation >>> from Bio.Seq import Seq >>> from Bio.Alphabet import IUPAC >>> messenger_rna = Seq("AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG", IUPAC.unambiguous_rna) >>> messenger_rna Seq( AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG, IUPACUnambiguousRNA()) >>> messenger_rna.translate() Seq( MAIVMGR*KGAR*, HasStopCodon(IUPACProtein(), * ))

22 Biopython Seq Functions Translation Tables >>> from Bio.Data import CodonTable >>> standard_table = CodonTable.unambiguous_dna_by_name["Standard"]

23 Biopython SeqIO Βασικές λειτουργίες : parse read write convert : όλων των στοιχείων ενός βιολογικού αρχείου : διάβασμα ενός στοιχείου : εγγραφή στοιχείων στο αρχείο : μετατροπή αρχείου από την μια μορφή στην άλλη

24 Biopython SeqIO Βασικές λειτουργίες : parse read write convert : όλων των στοιχείων ενός βιολογικού αρχείου : διάβασμα ενός στοιχείου : εγγραφή στοιχείων στο αρχείο : μετατροπή αρχείου από την μια μορφή στην άλλη File Formats : ace gb (genbank) pir clustal ig stockholm Embl nexus swiss fasta phd tab fastq phylip qual και για 3D δομές : pdb

25 Biopython SeqIO Parsing & read από αρχείο from Bio import SeqIO handle = open("ls_orchid.fasta") for seq_record in SeqIO.parse(handle, "fasta"): print print repr(seq_record.seq) print len(seq_record) handle.close()

26 Biopython SeqIO Parsing & read από αρχείο from Bio import SeqIO handle = open("ls_orchid.fasta") for seq_record in SeqIO.parse(handle, "fasta"): print print repr(seq_record.seq) print len(seq_record) handle.close() gi emb Z CIZ78533 Seq( CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGATGAGACCGTGG...CGC, SingleLetterAlphabet()) gi emb Z PBZ78439 Seq( CATTGTTGAGATCACATAATAATTGATCGAGTTAATCTGGAGGATCTGTTTACT...GCC, SingleLetterAlphabet()) 592

27 Biopython SeqIO Parsing & read από αρχείο με iterator from Bio import SeqIO handle = open( ls_orchid.fasta") record_iterator = SeqIO.parse(handle, "fasta") first_record = print print first_record.description second_record = print print second_record.description

28 Biopython SeqIO Parsing & read από αρχείο με iterator from Bio import SeqIO handle = open( ls_orchid.fasta") record_iterator = SeqIO.parse(handle, "fasta") first_record = print print first_record.description second_record = print print second_record.description gi emb Z CIZ78533 gi emb Z CIZ78533 C.irapeanum 5.8S rrna gene and ITS1 and ITS2 DNA gi emb Z CCZ78532 gi emb Z CCZ78532 C.californicum 5.8S rrna gene and ITS1 and ITS2 DNA

29 Biopython SeqIO Parsing & read από το διαδίκτυο from Bio import Entrez from Bio import SeqIO Entrez. = handle = Entrez.efetch(db="nucleotide", rettype="fasta", id=" ") seq_record =, "fasta") handle.close() print "%s with %i features" % (, len(seq_record.features))

30 Biopython SeqIO Parsing & read από το διαδίκτυο from Bio import Entrez from Bio import SeqIO Entrez. = handle = Entrez.efetch(db="nucleotide", rettype="fasta", id=" ") seq_record =, "fasta") handle.close() print "%s with %i features" % (, len(seq_record.features)) gi gb AF AF with 0 features

31 Biopython SeqIO Μετατροπή αρχείων διαφορετικό format from Bio import SeqIO from StringIO import StringIO handle1 =open( my_example.fasta") handle2 =open( ls_orchid.gbk") count = SeqIO.convert(handle2, "genbank", handle1, "fasta") handle1.close() handle2.close()

32 Biopython SeqRecord Εγγραφές βιολογικών κειμένων SeqRecord = Seq object + metadata metadata : id name description annotations features dbxrefs

33 Biopython SeqRecord Επιλογή στοιχείων ενός Record >>> from Bio import SeqIO >>> record ="NC_ fna", "fasta") >>> record SeqRecord(seq=Seq( TGTAACGAACGGTGCAATAGTGATCCACACCCAACGCCTGAAATCAGATCCAGG...CTG, SingleLetterAlphabet()), id= gi ref NC_ , name= gi ref NC_ , description= gi ref NC_ Yersinia pestis biovar Microtus... sequence, dbxrefs=[])

34 Biopython SeqRecord Επιλογή στοιχείων ενός Record >>> from Bio import SeqIO >>> record ="NC_ fna", "fasta") >>> record SeqRecord(seq=Seq( TGTAACGAACGGTGCAATAGTGATCCACACCCAACGCCTGAAATCAGATCCAGG...CTG, SingleLetterAlphabet()), id= gi ref NC_ , name= gi ref NC_ , description= gi ref NC_ Yersinia pestis biovar Microtus... sequence, dbxrefs=[]) >>> gi ref NC_ >>> gi ref NC_ >>> record.description gi ref NC_ Yersinia pestis biovar Microtus... ppcp1, complete sequence

35 Biopython SeqRecord Δημιουργία Record και Format from Bio.Seq import Seq from Bio.SeqRecord import SeqRecord from Bio.Alphabet import generic_protein record = SeqRecord(Seq("MMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPSETHLDSMVGQA LFGD" \ +"GAGAVIVGSDPDLSVERPLYELVWTGATLLPDSEGAIDGHLREVGLTFHLLKDVPGLISK" \ +"NIEKSLKEAFTPLGISDWNSTFWIAHPGGPAILDQVEAKLGLKEEKMRATREVLSEYGNM" \ +"SSAC", generic_protein), id="gi gb AAK AF376133_1", description="chalcone synthase [Cucumis sativus]") print record.format("fasta")


37 Biopython SeqRecord Eγγραφή Record σε αρχείο from Bio import SeqIO handle = open( my_example.fasta") SeqIO.write(my_records, handle,"fasta") handle.close()

38 Biopython BLAST Basic Local Alignment Search Tool : Βάση δεδομένων και Web Service Online και τοπική Τρόπος χρήσης : 1. Αναζήτηση με την function qblast() 2. Επιλογή blast προγράμματος 3. Δήλωση βάσης δεδομένων 4. Αναζήτηση query Επιστρέφει ΧML αρχείο με πληροφορίες για το alignment.

39 Biopython BLAST Χρησιμοποίηση της online BLAST from Bio.Blast import NCBIWWW from Bio import SeqIO handle = open( m_cold.fasta") save_file = open( my_blast.xml", "w") record =, format="fasta") result_handle = NCBIWWW.qblast("blastn", "nr", record.seq) save_file.write( save_file.close() handle.close()

40 Biopython BLAST BLAST Record και Στοίχιση from Bio.Blast import NCBIXML save_file = open( my_blast.xml") blast_record = E_VALUE_THRESH = 0.04 for alignment in blast_record.alignments: for hsp in alignment.hsps: if hsp.expect < E_VALUE_THRESH: print "****Alignment****" print "sequence:", alignment.title print "length:", alignment.length print "e value:", hsp.expect print hsp.query[0:75] + "..." print hsp.match[0:75] + "..." print hsp.sbjct[0:75] + "..."

41 Biopython BLAST BLAST Record και Στοίχιση ****Alignment**** sequence: gi emb BX Arabidopsis thaliana Full-length cdna Complete sequence from clone GSLTPGH63ZH10 of Hormone Treated Callus of strain col-0 of Arabidopsis thaliana (thale cress) length: 910 e value: e-25 AAAATGGGGAGAGAAATGAAGTACTTGGCCATGAAAACTGATCAATTGGCCGTGGCTAATATGATCGATTCCGAT AAAATGGGAAGGGG--TGA-GTTTTTGGCCATGAAGACTGAGGA---GAACGCGGCTAACCTGATCAATTCCGAT...

42 Biopython NCBI s Entrez Entrez : Σύστημα ανάκτησης πληροφορίας από τις βάσεις δεδομένων της NCBI. from Bio import Entrez Entrez. = handle = Entrez.einfo() record = print record["dblist"]

43 Biopython NCBI s Entrez Entrez : Σύστημα ανάκτησης πληροφορίας από τις βάσεις δεδομένων της NCBI. from Bio import Entrez Entrez. = handle = Entrez.einfo() record = print record["dblist"] Περιεχόμενα βάσης : [ pubmed, protein, nucleotide, nuccore, nucgss, nucest, structure, genome, books, cancerchromosomes, cdd, gap, domains, gene, genomeprj, gensat, geo, gds, homologene, journals, mesh, ncbisearch, nlmcatalog, omia, omim, pmc, popset, probe, proteinclusters, pcassay, pccompound, pcsubstance, snp, taxonomy, toolkit, unigene, unists ]

44 Biopython NCBI s Entrez Αναζήτηση στην βάση from Bio import Entrez Entrez. = handle = Entrez.esearch(db="nucleotide",term="Cypripedioideae[Orgn] AND matk[gene]") record = print record["count"] print record["idlist"]

45 Biopython NCBI s Entrez Αναζήτηση στην βάση from Bio import Entrez Entrez. = handle = Entrez.esearch(db="nucleotide",term="Cypripedioideae[Orgn] AND matk[gene]") record = print record["count"] print record["idlist"] 25 [' ', ' ', ' ', ' ', ' ', ' ', ' ', ' ', ' ', ' ', ' ', ' ', ' ', ' ', ' ', ' ', ' ', ' ', ' ', ' ']

46 Biopython NCBI s Entrez Aνάκτηση στοιχείων από το Entrez from Bio import Entrez Entrez. = handle = Entrez.efetch(db="nucleotide", id=" ", rettype="gb") print Τυπώνει το ζητούμενο αρχείο σε μορφή genbank.

47 Biopython NCBI s Entrez Επιπλέον συναρτήσεις ELink EGQuery ESummary : αναζήτηση για σχετικά αντικείμενα στην NCBI Entrez : αναζήτηση σε όλες τις βάσεις(global search) : ανάκτηση περιλήψεων από τα primary IDs

48 Biopython PDBParser Διαχείριση αρχέιων PDB Περιγραφή της 3D αναπαράστασης μακρομορίων

49 Biopython κ.α. Population genetics Bio.PopGen Supervised learning methods LogisticRegression,kNN, NaiveBayes Bio.MarkovModel Genome Bio.Graphics, GenomeDiagram

50 Support & Tutorials Υποστήριξη Open Bioinformatics Foundation Διεθνής ομάδα από εθελοντές προγραμματιστές Πλήρης οδηγός Biopython Tutorial & Cookbook Εκτενείς λεπτομέρειες στο

51 Πηγές Βιβλιογραφία Bioinformatics Programming in Python: A Practical Course for Beginners Ruediger-Marcus Flaig Bioinformatics Programming Using Python, Mitcell L. Model Python for Bioinformatics, Sebastian Bassi Links:


Βιοπληροφορική Ι. Παντελής Μπάγκος. Παν/µιο Στερεάς Ελλάδας

Βιοπληροφορική Ι. Παντελής Μπάγκος. Παν/µιο Στερεάς Ελλάδας Βιοπληροφορική Ι Παντελής Μπάγκος Παν/µιο Στερεάς Ελλάδας Λαµία 2006 1 Βιοπληροφορική Ι Εισαγωγή: Ορισµός της Βιοπληροφορικής, Υποδιαιρέσεις της Βιοπληροφορικής, Τα είδη των δεδοµένων στη Βιοπληροφορική.

Διαβάστε περισσότερα

Βάσεις δεδομένων αλληλουχιών

Βάσεις δεδομένων αλληλουχιών Βάσεις δεδομένων αλληλουχιών Vasilis Promponas Bioinformatics Research Laboratory Department of Biological Sciences University of Cyprus ΣΥΝΟΨΗ Βάσεις δεδομένων νουκλεοτιδικών αλληλουχιών Λίγη ιστορία

Διαβάστε περισσότερα

ΟΜΑΔΑ Λ. Αναστασίου Κωνσταντίνος Δεληγιάννη Ισαβέλλα Ζωγοπούλου Άννα Κουκάκης Γιώργος Σταθάκη Αρετιάννα

ΟΜΑΔΑ Λ. Αναστασίου Κωνσταντίνος Δεληγιάννη Ισαβέλλα Ζωγοπούλου Άννα Κουκάκης Γιώργος Σταθάκη Αρετιάννα ΟΜΑΔΑ Λ Αναστασίου Κωνσταντίνος Δεληγιάννη Ισαβέλλα Ζωγοπούλου Άννα Κουκάκης Γιώργος Σταθάκη Αρετιάννα ΒΙΟΠΛΗΡΟΦΟΡΙΚΗ Τι είναι η βιοπληροφορική; Αποκαλείται ο επιστημονικός κλάδος ο οποίος προέκυψε από

Διαβάστε περισσότερα

Βιοπληροφορική. Βάσεις Δεδοµένων 1ο εργαστήριο. Γρηγόρης Αµούτζιας

Βιοπληροφορική. Βάσεις Δεδοµένων 1ο εργαστήριο. Γρηγόρης Αµούτζιας Βιοπληροφορική Βάσεις Δεδοµένων 1ο εργαστήριο Γρηγόρης Αµούτζιας Χρησιµοποιούνται για: Oργάνωση Αποθήκευση Επεξεργασία Αναζήτηση/επαναπόκτηση της βιολογικής πληροφορίας Βάσεις Δεδοµένων: Εισαγωγή Βάσεις

Διαβάστε περισσότερα

Chalkou I. C. [PROJECT] Ανάθεση εργασιών.

Chalkou I. C. [PROJECT] Ανάθεση εργασιών. Πληροφορική της Υγείας 2014 Chalkou I. C. [PROJECT] Ανάθεση εργασιών. Περιεχόμενα 1. Ομάδα ΣΤ... 3 1.1 ΜΑΡΚΟΠΟΥΛΟΥ- ΣΠΥΡΟΠΟΥΛΟΥ -ΚΩΝΣΤΑΝΤΟΠΟΥΛΟΥ... 3 1.2 ΜΑΡΚΟΣ- ΚΟΥΤΣΟΠΟΥΛΟΣ ΑΥΓΕΡΗ - ΜΠΟΥΖΑΛΑ... 3 1.3

Διαβάστε περισσότερα

ΑΣΚΗΣΗ 1η Αναζήτηση πληροφορίας σε Βιβλιογραφικές Βάσεις εδοµένων

ΑΣΚΗΣΗ 1η Αναζήτηση πληροφορίας σε Βιβλιογραφικές Βάσεις εδοµένων ΑΣΚΗΣΗ 1η Αναζήτηση πληροφορίας σε Βιβλιογραφικές Βάσεις εδοµένων ΕΙΣΑΓΩΓΗ Η αναζήτηση και µελέτη της επιστηµονικής βιβλιογραφίας αποτελεί βασική προϋπόθεση για την επίλυση ερευνητικών προβληµάτων. Η βιβλιογραφική

Διαβάστε περισσότερα

ΠΤΥΧΙΑΚΗ ΕΡΓΑΣΙΑ ΘΕΜΑ. Η γλ(άσσα πβ^γβαμματισμί^ Jaya για εφαρμογές Βιοίτληροφορικιίςκαι, Βιοιατρικής

ΠΤΥΧΙΑΚΗ ΕΡΓΑΣΙΑ ΘΕΜΑ. Η γλ(άσσα πβ^γβαμματισμί^ Jaya για εφαρμογές Βιοίτληροφορικιίςκαι, Βιοιατρικής ΠΤΥΧΙΑΚΗ ΕΡΓΑΣΙΑ ΘΕΜΑ Η γλ(άσσα πβ^γβαμματισμί^ Jaya για εφαρμογές Βιοίτληροφορικιίςκαι, Βιοιατρικής Περιεχόμενα Εισαγωγή...4 Παρελθόν και Ιστορία... 4 Διασυνδετικά στοιχεία και πρότυπα (Interfaces and

Διαβάστε περισσότερα

Πανεπιστήμιο Δυτικής Μακεδονίας. Τμήμα Μηχανικών Πληροφορικής & Τηλεπικοινωνιών. Βιοπληροφορική. Ενότητα 1: Εισαγωγή στη Βιοπληροφορική

Πανεπιστήμιο Δυτικής Μακεδονίας. Τμήμα Μηχανικών Πληροφορικής & Τηλεπικοινωνιών. Βιοπληροφορική. Ενότητα 1: Εισαγωγή στη Βιοπληροφορική Τμήμα Μηχανικών Πληροφορικής & Τηλεπικοινωνιών Βιοπληροφορική Ενότητα 1: Εισαγωγή στη Βιοπληροφορική Αν. καθηγητής Αγγελίδης Παντελής e-mail: ΕΕΔΙΠ Μπέλλου Σοφία e-mail:

Διαβάστε περισσότερα

Τυπικές χρήσεις της Matlab

Τυπικές χρήσεις της Matlab Matlab Μάθημα 1 Τι είναι η Matlab Ολοκληρωμένο Περιβάλλον Περιβάλλον ανάπτυξης Διερμηνευμένη γλώσσα Υψηλή επίδοση Ευρύτητα εφαρμογών Ευκολία διατύπωσης Cross platform (Wintel, Unix, Mac) Τυπικές χρήσεις

Διαβάστε περισσότερα

Εισαγωγικό Φροντιστήριο

Εισαγωγικό Φροντιστήριο Εισαγωγικό Φροντιστήριο Project του μαθήματος Εργασία 2 ατόμων Προφορική εξέταση για: Project 80% Θεωρία 20% Στο φροντιστήριο: Θα συζητάμε σχεδιαστικές επιλογές Θα λύνουμε ζητήματα υλοποίησης Θα παρουσιάζουμε

Διαβάστε περισσότερα

ΚΕΦΑΛΑΙΟ 1. Εισαγωγή στην Python. 1.1 Εισαγωγή

ΚΕΦΑΛΑΙΟ 1. Εισαγωγή στην Python. 1.1 Εισαγωγή ΚΕΦΑΛΑΙΟ 1 Εισαγωγή στην Python Σύνοψη Σε αυτό το κεφάλαιο κάνουμε μια σύντομη εισαγωγή στην Python και στα εργαλεία λογισμικού που θα χρησιμοποιήσουμε στη συνέχεια του συγγράμματος. Προαπαιτούμενη γνώση

Διαβάστε περισσότερα

Βιοπληροφορική και Πολυµέσα. Ειρήνη Αυδίκου Αθήνα

Βιοπληροφορική και Πολυµέσα. Ειρήνη Αυδίκου Αθήνα Βιοπληροφορική και Πολυµέσα Αθήνα 1.2.2009 ΠΕΡΙΕΧΟΜΕΝΑ 1. Πως σχετίζεται µε τα Πολυµέσα 2. Τι είναι η Βιοπληροφορική 3. Χρήσεις 4. Συµπεράσµατα 5. Βιβλιογραφία Βιοπληροφορική και Πολυµέσα 2 1. Τι είναι

Διαβάστε περισσότερα

Ευφυής Προγραμματισμός

Ευφυής Προγραμματισμός Ευφυής Προγραμματισμός Ενότητα 5: Ειδικές Μεταβλητές-Χειρισμός Αρχείων Ιωάννης Χατζηλυγερούδης Πολυτεχνική Σχολή Τμήμα Μηχανικών Η/Υ & Πληροφορικής Περιεχόμενα ενότητας Ειδικές Μεταβλητές-Χειρισμός Αρχείων

Διαβάστε περισσότερα

Ενότητα 3: Τα δεδομένα στο Web. (και η σημασιολογία τους semantics )

Ενότητα 3: Τα δεδομένα στο Web. (και η σημασιολογία τους semantics ) Ενότητα 3: Τα δεδομένα στο Web (και η σημασιολογία τους semantics ) Σημασιολογία semantics Τι σημαίνουν τα δεδομένα; Ποια η έννοιά τους; Μετάδοση έννοιας και ενσωμάτωση στη γνώση....έχοντας ως αποτέλεσμα

Διαβάστε περισσότερα

Chalkou I. C. [PROJECT] Ανάθεση εργασιών.

Chalkou I. C. [PROJECT] Ανάθεση εργασιών. Πληροφορική της Υγείας 2014 Chalkou I. C. [PROJECT] Ανάθεση εργασιών. Περιεχόμενα 1. Ομάδα Γ... 3 1.1 Σαψάκη Δ. - Σαψάκη Π.... 3 1.2 Βλάχου - Γεωργοπούλου... 3 1.3 Μπέρτσου - Τσάμη... 4 1.4 Καραγιάννη

Διαβάστε περισσότερα

Συγκριτική Γονιδιωματική

Συγκριτική Γονιδιωματική ΒΙΟΠΛΗΡΟΦΟΡΙΚΗ ΙΙ Συγκριτική Γονιδιωματική Παντελής Μπάγκος 1 2 Μέθοδοι Ανάλυσης Μέθοδοι βασισμένες στην ομοιότητα ακολουθιών Τοπική ομοιότητα Ολική ομοιότητα Προγνωστικές μέθοδοι Δευτεροταγής δομή Διαμεμβρανικά

Διαβάστε περισσότερα

Εργαστήριο Σημασιολογικού Ιστού

Εργαστήριο Σημασιολογικού Ιστού Εργαστήριο Σημασιολογικού Ιστού Ενότητα 2: Εισαγωγή στην Οργάνωση των Σημασιολογικών Δεδομένων Μ.Στεφανιδάκης 15-2-2015. Ποιο το κατάλληλο μοντέλο δεδομένων; Τα σημασιολογικά δεδομένα πρέπει να εκτεθούν

Διαβάστε περισσότερα

5ο Συνέδριο ΕΛΛΑΚ Εργαστήριο Octave

5ο Συνέδριο ΕΛΛΑΚ Εργαστήριο Octave 5ο Συνέδριο ΕΛΛΑΚ Εργαστήριο Octave ΕΜΠ, 15 Μαΐου 2010 Α. Λερός 1 & Α. Ανδρεάτος 2 1Τμήμα Αυτοματισμού, ΤΕΙ Χαλκίδας και Τομέας Πληροφορικής και Υπολογιστών, Σχολή Ικάρων 2 Τομέας

Διαβάστε περισσότερα



Διαβάστε περισσότερα


ΓΛΩΣΣΙΚΗ ΤΕΧΝΟΛΟΓΙΑ. Python & NLTK: Εισαγωγή ΓΛΩΣΣΙΚΗ ΤΕΧΝΟΛΟΓΙΑ Python & NLTK: Εισαγωγή Εισαγωγή Γιατί Python? Παρουσίαση NLTK Πηγές και χρήσιμα εργαλεία Φροντιστήριο σε Python Στο φροντιστήριο: Εισαγωγή στην Python Ζητήματα προγραμματισμού για

Διαβάστε περισσότερα

Βιοπληροφορική. Ενότητα 8: Αναζήτηση Ομοιοτήτων σε Βάσεις Δεδομένων Ακολουθιών, 2 ΔΩ. Τμήμα: Βιοτεχνολογίας Όνομα καθηγητή: Τ.

Βιοπληροφορική. Ενότητα 8: Αναζήτηση Ομοιοτήτων σε Βάσεις Δεδομένων Ακολουθιών, 2 ΔΩ. Τμήμα: Βιοτεχνολογίας Όνομα καθηγητή: Τ. Βιοπληροφορική Ενότητα 8: Αναζήτηση Ομοιοτήτων σε Βάσεις Δεδομένων Ακολουθιών, 2 ΔΩ Τμήμα: Βιοτεχνολογίας Όνομα καθηγητή: Τ. Θηραίου Μαθησιακοί Στόχοι Κατανόηση της αναγκαιότητας των ευριστικών αλγορίθμων

Διαβάστε περισσότερα


ΠΙΝΑΚΑΣ ΠΕΡΙΕΧΟΜΕΝΩΝ ΠΙΝΑΚΑΣ ΠΕΡΙΕΧΟΜΕΝΩΝ Πρόλογος... 11 Μέρος Α: Στοιχεία Αλγοριθμικής... 15 1 Επίλυση προβλημάτων με Η/Υ... 19 1.1 Εισαγωγή... 19 1.2 Αλγόριθμοι-αλγοριθμικά προβλήματα... 20 1.3 Το μαθηματικό μοντέλο... 26

Διαβάστε περισσότερα

Μελέτη και Υλοποίηση Αλγορίθμων για Βιολογικές Εφαρμογές σε MapReduce Περιβάλλον

Μελέτη και Υλοποίηση Αλγορίθμων για Βιολογικές Εφαρμογές σε MapReduce Περιβάλλον Μελέτη και Υλοποίηση Αλγορίθμων για Βιολογικές Εφαρμογές σε MapReduce Περιβάλλον Δανάη Κούτρα Eργαστήριο Συστημάτων Βάσεων Γνώσεων και Δεδομένων Εθνικό Μετσόβιο Πολυτεχνείο Θέματα Σκοπός της διπλωματικής

Διαβάστε περισσότερα


ΠΑΝΕΠΙΣΤΗΜΙΟ ΚΥΠΡΟΥ ΕΠΛ 450 ΥΠΟΛΟΓΙΣΤΙΚΗ ΒΙΟΛΟΓΙΑ. Παύλος Αντωνίου ΠΑΝΕΠΙΣΤΗΜΙΟ ΚΥΠΡΟΥ ΕΠΛ 450 ΥΠΟΛΟΓΙΣΤΙΚΗ ΒΙΟΛΟΓΙΑ Παύλος Αντωνίου Με μια ματιά: Εισαγωγή στη Βιολογία Ευθυγράμμιση Ακολουθιών Αναζήτηση ομοίων ακολουθιών από βάσεις δεδομενων Φυλογενετική πρόβλεψη Πρόβλεψη

Διαβάστε περισσότερα


ΑΝΟΙΧΤΑ ΑΚΑΔΗΜΑΙΚΑ ΜΑΘΗΜΑΤΑ ΑΡΙΣΤΟΤΕΛΕΙΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΘΕΣΣΑΛΟΝΙΚΗΣ ΒΙΟΠΛΗΡΟΦΟΡΙΚΗ. Ενότητα 1 η : Εισαγωγή. Ηλίας Καππάς Τμήμα Βιολογίας ΑΡΙΣΤΟΤΕΛΕΙΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΘΕΣΣΑΛΟΝΙΚΗΣ ΑΝΟΙΧΤΑ ΑΚΑΔΗΜΑΙΚΑ ΜΑΘΗΜΑΤΑ ΒΙΟΠΛΗΡΟΦΟΡΙΚΗ Ενότητα 1 η : Εισαγωγή Ηλίας Καππάς Άδειες Χρήσης Το παρόν εκπαιδευτικό υλικό υπόκειται σε άδειες χρήσης Creative Commons.

Διαβάστε περισσότερα


ΠΙΝΑΚΑΣ ΠΕΡΙΕΧΟΜΕΝΩΝ ii ΠΙΝΑΚΑΣ ΠΕΡΙΕΧΟΜΕΝΩΝ 1. Εισαγωγή - Βασικές έννοιες....1 1.1 Εσωτερική παράσταση δεδομένων....2 1.1.1 Παράσταση θέσης....3 1.1.2 Μετατροπές μεταξύ συστημάτων διαφορετικών βάσεων....5 1.1.3 Οι αριθμητικές

Διαβάστε περισσότερα

Πανεπιστήμιο Δυτικής Μακεδονίας. Τμήμα Μηχανικών Πληροφορικής & Τηλεπικοινωνιών. Βιοπληροφορική

Πανεπιστήμιο Δυτικής Μακεδονίας. Τμήμα Μηχανικών Πληροφορικής & Τηλεπικοινωνιών. Βιοπληροφορική Τμήμα Μηχανικών Πληροφορικής & Τηλεπικοινωνιών Βιοπληροφορική Ενότητα 12: Αναζήτηση ομοιοτήτων έναντι βάσεων δεδομένων με τη χρήση ευρετικών αλγορίθμων Αν. καθηγητής Αγγελίδης Παντελής e-mail:

Διαβάστε περισσότερα

Διάλεξη 2. Μεταβλητές - Δομές Δεδομένων - Eίσοδος δεδομένων - Έξοδος: Μορφοποίηση - Συναρτήσεις. Διοργάνωση : ΚΕΛ ΣΑΤΜ

Διάλεξη 2. Μεταβλητές - Δομές Δεδομένων - Eίσοδος δεδομένων - Έξοδος: Μορφοποίηση - Συναρτήσεις. Διοργάνωση : ΚΕΛ ΣΑΤΜ Διάλεξη 2 Μεταβλητές - Δομές Δεδομένων - Eίσοδος δεδομένων - Έξοδος: Μορφοποίηση - Συναρτήσεις Διοργάνωση : ΚΕΛ ΣΑΤΜ Διαφάνειες: Skaros, MadAGu Παρουσίαση: MadAGu Άδεια: Creative Commons 3.0 2 Internal

Διαβάστε περισσότερα

Βιοπληροφορική. Ενότητα 7: Στοίχιση ακολουθιών ανά ζεύγη Τεχνικές Στοίχισης Ακολουθιών, (1/2) 1ΔΩ. Τμήμα: Βιοτεχνολογίας Όνομα καθηγητή: Τ.

Βιοπληροφορική. Ενότητα 7: Στοίχιση ακολουθιών ανά ζεύγη Τεχνικές Στοίχισης Ακολουθιών, (1/2) 1ΔΩ. Τμήμα: Βιοτεχνολογίας Όνομα καθηγητή: Τ. Βιοπληροφορική Ενότητα 7: Στοίχιση ακολουθιών ανά ζεύγη Τεχνικές Στοίχισης Ακολουθιών, (1/2) 1ΔΩ Τμήμα: Βιοτεχνολογίας Όνομα καθηγητή: Τ. Θηραίου Μαθησιακοί Στόχοι Παρουσίαση της μεθόδου κατασκευής και

Διαβάστε περισσότερα


1 ο ΕΡΓΑΣΤΗΡΙΟ ΣΗΜΑΤΑ & ΣΥΣΤΗΜΑΤΑ ΕΛΛΗΝΙΚΗ ΔΗΜΟΚΡΑΤΙΑ Ανώτατο Εκπαιδευτικό Ίδρυμα Πειραιά Τεχνολογικού Τομέα 1 ο ΕΡΓΑΣΤΗΡΙΟ ΣΗΜΑΤΑ & ΣΥΣΤΗΜΑΤΑ Ενότητα: ΜΑΘΑΙΝΟΝΤΑΣ ΤΟ MATLAB, ΜΕΡΟΣ Α Aναστασία Βελώνη Τμήμα Η.Υ.Σ Άδειες Χρήσης Το παρόν

Διαβάστε περισσότερα



Διαβάστε περισσότερα

1 η ΕΝΟΤΗΤΑ ΕΙΣΑΓΩΓΗ (Προγραμματισμός & MATLAB)

1 η ΕΝΟΤΗΤΑ ΕΙΣΑΓΩΓΗ (Προγραμματισμός & MATLAB) ΣΧΟΛΗ ΠΟΛΙΤΙΚΩΝ ΜΗΧΑΝΙΚΩΝ ΕΜΠ ΜΕΘΟΔΟΙ ΕΠΙΛΥΣΗΣ ΜΕ Η/Υ 1 η ΕΝΟΤΗΤΑ ΕΙΣΑΓΩΓΗ (Προγραμματισμός & MATLAB) Ν.Δ. Λαγαρός Μ. Φραγκιαδάκης Α. Στάμος Άδεια Χρήσης Το παρόν εκπαιδευτικό υλικό υπόκειται σε άδειες

Διαβάστε περισσότερα

Αρχές Τεχνολογίας Λογισμικού

Αρχές Τεχνολογίας Λογισμικού Αρχές Τεχνολογίας Λογισμικού Επισκόπηση του μαθήματος 2 Διδάσκοντες ΘΕΩΡΙΑ Νίκος Παπαδάκης ΕΡΓΑΣΤΗΡΙΟ Αϊβαλής Κώστας Κονδυλάκης Χάρης 3 Το μάθημα στο πρόγραμμα σπουδών

Διαβάστε περισσότερα

Προγραµµατισµός Η/Υ. Μέρος2

Προγραµµατισµός Η/Υ. Μέρος2 Προγραµµατισµός Η/Υ Μέρος2 Περιεχόμενα Επανάληψη Βασικών Σύμβολων Διαγραμμάτων Ροής Αλγόριθμος Ψευδοκώδικας Παραδείγματα Αλγορίθμων Γλώσσες προγραμματισμού 2 Επανάληψη Βασικών Σύμβολων Διαγραμμάτων Ροής

Διαβάστε περισσότερα

4.1 Πράξεις με Πολυωνυμικές Εκφράσεις... 66

4.1 Πράξεις με Πολυωνυμικές Εκφράσεις... 66 Περιεχόμενα Ευρετήριο Πινάκων... 7 Ευρετήριο Εικόνων... 8 Εισαγωγή... 9 Κεφάλαιο 1-Περιβάλλον Εργασίας - Στοιχεία Εντολών... 13 1.1 Το Πρόγραμμα... 14 1.2.1 Εισαγωγή Εντολών... 22 1.2.2 Εισαγωγή Εντολών

Διαβάστε περισσότερα

Συμβολική γλώσσα Εκπαιδευτικού Υπολογιστή - Λογισμικό Υπολογιστών

Συμβολική γλώσσα Εκπαιδευτικού Υπολογιστή - Λογισμικό Υπολογιστών Συμβολική γλώσσα Εκπαιδευτικού Υπολογιστή - Λογισμικό Υπολογιστών Πρόγραμμα σε γλώσσα μηχανής του ΕΚΥ Θέση μνήμης Περιεχόμενα μνήμης Εντολή (assembly) 0 0001 000000000011 lda 3 1 0011 000000000100 ada

Διαβάστε περισσότερα

Κεφάλαιο 7: Υπορουτίνες

Κεφάλαιο 7: Υπορουτίνες Κεφάλαιο 7: Υπορουτίνες Αρχές Γλωσσών Προγραμματισμού και Μεταφραστών Ορισμός Αφαίρεση με χρήση υπορουτινών (subroutine abstraction) είναι η αντιστοίχιση ενός συνόλου εισόδων σε ένα σύνολο εξόδων που μπορεί

Διαβάστε περισσότερα

2. Εισαγωγή Δεδομένων σε Σχεσιακή Βάση Δεδομένων

2. Εισαγωγή Δεδομένων σε Σχεσιακή Βάση Δεδομένων 2. Εισαγωγή Δεδομένων σε Σχεσιακή Βάση Δεδομένων Μετά τον μετασχηματισμό των δεδομένων με τη χρήση του Excel, τα δεδομένα θα εισαχθούν σε μια σχεσιακή βάση δεδομένων (Microsoft SQL Sever 2005) ώστε να

Διαβάστε περισσότερα

ΕΛΛΗΝΙΚΗ ΔΗΜΟΚΡΑΤΙΑ Ανώτατο Εκπαιδευτικό Ίδρυμα Πειραιά Τεχνολογικού Τομέα. 4o Εργαστήριο Σ.Α.Ε

ΕΛΛΗΝΙΚΗ ΔΗΜΟΚΡΑΤΙΑ Ανώτατο Εκπαιδευτικό Ίδρυμα Πειραιά Τεχνολογικού Τομέα. 4o Εργαστήριο Σ.Α.Ε ΕΛΛΗΝΙΚΗ ΔΗΜΟΚΡΑΤΙΑ Ανώτατο Εκπαιδευτικό Ίδρυμα Πειραιά Τεχνολογικού Τομέα 4o Εργαστήριο Σ.Α.Ε Ενότητα : Μελέτη και Σχεδίαση Σ.Α.Ε Με χρήση του MATLAB Aναστασία Βελώνη Τμήμα Η.Υ.Σ Άδειες Χρήσης Το παρόν

Διαβάστε περισσότερα

Εισαγωγή στον Προγραμματισμό Python Μάθημα 4: Συναρτήσεις (functions) και δομοστοιχεία (modules) στην Python

Εισαγωγή στον Προγραμματισμό Python Μάθημα 4: Συναρτήσεις (functions) και δομοστοιχεία (modules) στην Python Εισαγωγή στον Προγραμματισμό Python Μάθημα 4: Συναρτήσεις (functions) και δομοστοιχεία (modules) στην Python Νοέμβριος 2014 Χ. Αλεξανδράκη, Γ. Δημητρακάκης Συναρτήσεις (Functions) Στον προγραμματισμό,

Διαβάστε περισσότερα

Πληροφορική ΙΙ Θεματική Ενότητα 13

Πληροφορική ΙΙ Θεματική Ενότητα 13 Ανοικτά Ακαδημαϊκά Μαθήματα στο ΤΕΙ Ιονίων Νήσων Πληροφορική ΙΙ Θεματική Ενότητα 13 Αρχεία Δεδομένων Το περιεχόμενο του μαθήματος διατίθεται με άδεια Creative Commons εκτός και αν αναφέρεται διαφορετικά

Διαβάστε περισσότερα

EPL 660: Lab 4 Introduction to Hadoop

EPL 660: Lab 4 Introduction to Hadoop EPL 660: Lab 4 Introduction to Hadoop Andreas Kamilaris Department of Computer Science MapReduce Πρόβλημα: Ανάγκη για επεξεργασία μεγάλου όγκου δεδομένων στα συστήματα ανάκτησης πληροφορίας. Λύση: κατανομή

Διαβάστε περισσότερα

Γλώσσες Προγραμματισμού Μεταγλωττιστές

Γλώσσες Προγραμματισμού Μεταγλωττιστές Γλώσσες Προγραμματισμού Μεταγλωττιστές Πανεπιστήμιο Μακεδονίας Τμήμα Εφαρμοσμένης Πληροφορικής Ηλίας Σακελλαρίου Δομή Γλώσσες Προγραμματισμού Εισαγωγικά Γλώσσα Μηχανής Γλώσσες υψηλού επιπέδου Μεταγλωττιστές

Διαβάστε περισσότερα


ΜΕΘΟΔΟΛΟΓΙΑ ΑΝΑΠΤΥΞΗΣ ΕΜΠΟΡΙΚΩΝ ΕΦΑΡΜΟΓΩΝ Μεθοδολογία Ανάπτυξης Εμπορικών Εφαρμογών 1 ΜΕΘΟΔΟΛΟΓΙΑ ΑΝΑΠΤΥΞΗΣ ΕΜΠΟΡΙΚΩΝ ΕΦΑΡΜΟΓΩΝ Η μεθοδολογία ανάπτυξης μιας εμπορικής εφαρμογής δίνει την δυνατότητα στην ομάδα εργασίας να έχει τον πλήρη έλεγχο

Διαβάστε περισσότερα

Αντικειμενοστραφής Προγραμματισμός I (5 ο εξ) Διάλεξη #1 η : Εισαγωγή: Λογισμικό, Γλώσσες Προγραμματισμού, Java

Αντικειμενοστραφής Προγραμματισμός I (5 ο εξ) Διάλεξη #1 η : Εισαγωγή: Λογισμικό, Γλώσσες Προγραμματισμού, Java Αντικειμενοστραφής Προγραμματισμός I (5 ο εξ) Διάλεξη #1 η : Εισαγωγή: Λογισμικό, Γλώσσες Προγραμματισμού, Java Γαβαλάς Δαμιανός Στόχοι μαθήματος Διάκριση και κατανόηση των υφιστάμενων

Διαβάστε περισσότερα


Βιβλιοθήκη&ΚέντροΠληροφόρησης,ΠανεπιστήμιοΠατρών Εγχειρίδιο Χρήσης Βιβλιοθήκη&ΚέντροΠληροφόρησης,ΠανεπιστήμιοΠατρών ΛογισμικόΔιαχείρισηςΒιβλιογραφικώνΑναφορών Εισαγωγήβιβλιογραφικώνεγγραφών απόβάσειςδεδομένων ΤοRefWorksπαρέχεταιαπότηνΚεντρικήΒιβλιοθήκητουΔημοκρίτειου

Διαβάστε περισσότερα

Εισαγωγή στον Προγραμματισμό

Εισαγωγή στον Προγραμματισμό Εισαγωγή στον Προγραμματισμό Εισαγωγή Δημήτρης Μιχαήλ Τμήμα Πληροφορικής και Τηλεματικής Χαροκόπειο Πανεπιστήμιο Ακ. Έτος 2012-2013 Βιβλιογραφία "C Προγραμματισμός", Deitel & Deitel, Πέμπτη Έκδοση, Εκδόσεις

Διαβάστε περισσότερα

Βασικά Στοιχεία Python 3

Βασικά Στοιχεία Python 3 Βασικά Στοιχεία Python 3 Compiler Lecture s 1.0 documentation Βασικά Στοιχεία Python 3 Στη συνέχεια παρουσιάζονται ορισμένα ενδιαφέροντα στοιχεία της Python 3. Αυτό που ακολουθεί δεν είναι tutorial, αν

Διαβάστε περισσότερα

Ανανέωση και ενημέρωση. Της ελληνικής μετάφρασης του. Bash Guide for Beginners. Ελένη Φραγκιαδάκη

Ανανέωση και ενημέρωση. Της ελληνικής μετάφρασης του. Bash Guide for Beginners. Ελένη Φραγκιαδάκη Ανανέωση και ενημέρωση Της ελληνικής μετάφρασης του Bash Guide for Beginners Ελένη Φραγκιαδάκη Λίγα λόγια για τον οδηγό Ο οδηγός διατίθεται μέσω του The Linux Documentation Project

Διαβάστε περισσότερα

Πανεπιστήμιο Δυτικής Μακεδονίας. Τμήμα Μηχανικών Πληροφορικής & Τηλεπικοινωνιών. Ηλεκτρονική Υγεία. Εργαστήριο 4 ο : MATLAB

Πανεπιστήμιο Δυτικής Μακεδονίας. Τμήμα Μηχανικών Πληροφορικής & Τηλεπικοινωνιών. Ηλεκτρονική Υγεία. Εργαστήριο 4 ο : MATLAB Τμήμα Μηχανικών Πληροφορικής & Τηλεπικοινωνιών Ηλεκτρονική Υγεία Εργαστήριο 4 ο : MATLAB Αν. καθηγητής Αγγελίδης Παντελής e-mail: Τμήμα Μηχανικών Πληροφορικής και Τηλεπικοινωνιών Άδειες

Διαβάστε περισσότερα

ΚΕΦΑΛΑΙΟ 2: Τύποι δεδομένων και εμφάνιση στοιχείων...33

ΚΕΦΑΛΑΙΟ 2: Τύποι δεδομένων και εμφάνιση στοιχείων...33 ΠΕΡΙΕΧΟΜΕΝΑ Πρόλογος του συγγραφέα... 13 Πρόλογος του καθηγητή Τιμολέοντα Σελλή... 15 ΚΕΦΑΛΑΙΟ 1: Εργαλεία γλωσσών προγραμματισμού...17 1.1 Γλώσσες προγραμματισμού τρίτης γεννεάς... 18 τι είναι η γλώσσα

Διαβάστε περισσότερα

Αγροτική Ανάπτυξη Περιβάλλον

Αγροτική Ανάπτυξη Περιβάλλον ΜΟΝΑΔΕΣ ΑΡΙΣΤΕΙΑΣ ΑΝΟΙΧΤΟΥ ΛΟΓΙΣΜΙΚΟΥ Αγροτική Ανάπτυξη Περιβάλλον 1 ος Κύκλος Εκπαίδευσης 3 ο σεμινάριο 27 Ιουνίου 2014 Για όσους θέλουν απλώς να δοκιμάσουν το GRASS Ο πιο εύκολος τρόπος για να δοκιμάσετε

Διαβάστε περισσότερα

Η Γλώσσα Προγραµµατισµού C++ (The C++ Programming Language) Ιστοσελίδα του µαθήµατος. Περιεχόµενα. ηµήτριος Κατσαρός, Ph.D. Κλάσεις.

Η Γλώσσα Προγραµµατισµού C++ (The C++ Programming Language) Ιστοσελίδα του µαθήµατος. Περιεχόµενα. ηµήτριος Κατσαρός, Ph.D. Κλάσεις. 1 Η Γλώσσα Προγραµµατισµού C++ (The C++ Programming Language) ηµήτριος Κατσαρός, Ph.D. Χειµώνας 2005 ιάλεξη 5η Ιστοσελίδα του µαθήµατος 2 Θα

Διαβάστε περισσότερα

Μια «ανώδυνη» εισαγωγή στο μάθημα (και στο MATLAB )

Μια «ανώδυνη» εισαγωγή στο μάθημα (και στο MATLAB ) Μια «ανώδυνη» εισαγωγή στο μάθημα (και στο MATLAB ) Μια πρώτη ιδέα για το μάθημα χωρίς καθόλου εξισώσεις!!! Περίγραμμα του μαθήματος χωρίς καθόλου εξισώσεις!!! Παραδείγματα από πραγματικές εφαρμογές ==

Διαβάστε περισσότερα

Κεφάλαιο 12: Είσοδος και έξοδος δεδομένων σε αρχεία

Κεφάλαιο 12: Είσοδος και έξοδος δεδομένων σε αρχεία Κεφάλαιο 12: Είσοδος και έξοδος δεδομένων σε αρχεία Τα δεδομένα που επεξεργαζόμαστε, καθώς και ο κώδικας που τρέχουμε, βρίσκονται αποθηκευμένα στη μνήμη RAM (Random Access Memory) του υπολογιστή. Τα δεδομένα

Διαβάστε περισσότερα

Περιοδικών και του Συλλογικού Καταλόγου Ελληνικών Ακαδηµαϊκών Βιβλιοθηκών. Αθήνα, Μάιος 2007

Περιοδικών και του Συλλογικού Καταλόγου Ελληνικών Ακαδηµαϊκών Βιβλιοθηκών. Αθήνα, Μάιος 2007 Κεντρική Μηχανή Μετααναζήτησης των Ηλεκτρονικών Περιοδικών και του Συλλογικού Καταλόγου Ελληνικών Ακαδηµαϊκών Βιβλιοθηκών Κλωντίνη Ξενίδου- έρβου Καλλιόπη Φλώρου Λεωνίδας Πισπιρίγγας HEAL-Link Search 1

Διαβάστε περισσότερα

Πρόβλημα 1: Αναζήτηση Ελάχιστης/Μέγιστης Τιμής

Πρόβλημα 1: Αναζήτηση Ελάχιστης/Μέγιστης Τιμής Πρόβλημα 1: Αναζήτηση Ελάχιστης/Μέγιστης Τιμής Να γραφεί πρόγραμμα το οποίο δέχεται ως είσοδο μια ακολουθία S από n (n 40) ακέραιους αριθμούς και επιστρέφει ως έξοδο δύο ακολουθίες από θετικούς ακέραιους

Διαβάστε περισσότερα


ΠΙΝΑΚΑΣ ΠΕΡΙΕΧΟΜΕΝΩΝ ΠΙΝΑΚΑΣ ΠΕΡΙΕΧΟΜΕΝΩΝ Πρόλογος... 11 Μέρος Α: Στοιχεία Αλγοριθμικής... 15 1 Επίλυση προβλημάτων με Η/Υ... 19 1.1 Εισαγωγή... 19 1.2 Αλγόριθμοι αλγοριθμικά προβλήματα... 20 1.3 Το μαθηματικό μοντέλο... 26

Διαβάστε περισσότερα

«Μηχανή Αναζήτησης Αρχείων» Ημερομηνία Παράδοσης: 30/04/2015, 09:00 π.μ.

«Μηχανή Αναζήτησης Αρχείων» Ημερομηνία Παράδοσης: 30/04/2015, 09:00 π.μ. ΕΡΓΑΣΙΑ 4 «Μηχανή Αναζήτησης Αρχείων» Ημερομηνία Παράδοσης: 30/04/2015, 09:00 π.μ. Στόχος Στόχος της Εργασίας 4 είναι να η εξοικείωση με την αντικειμενοστρέφεια (object oriented programming). Πιο συγκεκριμένα,

Διαβάστε περισσότερα

Περιεχόµενα. Ανασκόπηση - Ορισµοί. Ο κύκλος ανάπτυξης προγράµµατος. Γλώσσες Προγραµµατισµού Ασκήσεις

Περιεχόµενα. Ανασκόπηση - Ορισµοί. Ο κύκλος ανάπτυξης προγράµµατος. Γλώσσες Προγραµµατισµού Ασκήσεις Προγραµµατισµός Η/Υ Ανασκόπηση - Ορισµοί Περιεχόµενα Ο κύκλος ανάπτυξης προγράµµατος Περιγραφή προβλήµατος Ανάλυση προβλήµατος Λογικό ιάγραµµα Ψευδοκώδικας Κωδικοποίηση Συντήρηση Γλώσσες Προγραµµατισµού

Διαβάστε περισσότερα

Αλγόριθμοι Εύρεσης Ομοιοτήτων Ακολουθιών Μέρος ΙΙΙ: Έλεγχος στατιστικής σημαντικότητας

Αλγόριθμοι Εύρεσης Ομοιοτήτων Ακολουθιών Μέρος ΙΙΙ: Έλεγχος στατιστικής σημαντικότητας Αλγόριθμοι Εύρεσης Ομοιοτήτων Ακολουθιών Μέρος ΙΙΙ: Έλεγχος στατιστικής σημαντικότητας Βασίλης Προμπονάς, PhD Ερευνητικό Εργαστήριο Βιοπληροφορικής Τμήμα Βιολογικών Επιστημών Νέα Παν/πολη, Γραφείο B161

Διαβάστε περισσότερα

Γλωσσική Τεχνολογία. String Handling Regular Expressions

Γλωσσική Τεχνολογία. String Handling Regular Expressions Γλωσσική Τεχνολογία String Handling Regular Expressions Strings - Δήλωση Μπορείτε να γράψετε τα δικά σας string περικλείοντας απλά χαρακτήρες και αριθμούς μέσα σε μονά ('...') ή διπλά("...") αυτάκια. Strings

Διαβάστε περισσότερα

Σύντοµο Εγχειρίδιο Χρήσης. του Λογισµικού Στατιστικής Επεξεργασίας. SPSS for Windows v. 8.0

Σύντοµο Εγχειρίδιο Χρήσης. του Λογισµικού Στατιστικής Επεξεργασίας. SPSS for Windows v. 8.0 Εθνικό & Καποδιστριακό Πανεπιστήµιο Αθηνών Τµήµα Μεθοδολογίας, Ιστορίας & Θεωρίας της Επιστήµης ιαπανεπιστηµιακό Πρόγραµµα Μεταπτυχιακών Σπουδών «Βασική και Εφαρµοσµένη Γνωσιακή Επιστήµη» Σύντοµο Εγχειρίδιο

Διαβάστε περισσότερα

Πολλαπλές στοιχίσεις ακολουθιών (Προοδευτικές μέθοδοι)

Πολλαπλές στοιχίσεις ακολουθιών (Προοδευτικές μέθοδοι) Πολλαπλές στοιχίσεις ακολουθιών (Προοδευτικές μέθοδοι) Vasilis Promponas Bioinformatics Research Laboratory Department of Biological Sciences University of Cyprus Σύνοψη Εισαγωγή Πολλαπλή στοίχιση και

Διαβάστε περισσότερα

Ανάπτυξη Μεγάλων Εφαρµογών στη Γλώσσα C (Programming in the large)

Ανάπτυξη Μεγάλων Εφαρµογών στη Γλώσσα C (Programming in the large) Ανάπτυξη Μεγάλων Εφαρµογών στη Γλώσσα C (Programming in the large) Στην ενότητα αυτή θα µελετηθούν τα εξής επιµέρους θέµατα: Συναρτήσεις Εξωτερικές µεταβλητές Κανόνες εµβέλειας ιάρκεια µεταβλητών Αρχικοποίηση

Διαβάστε περισσότερα

Η γλώσσα προγραμματισμού C

Η γλώσσα προγραμματισμού C Η γλώσσα προγραμματισμού C Εισαγωγή στη C Λίγα λόγια για την C Γλώσσα προγραμματισμού υψηλού επιπέδου. Σχεδιάστηκε και υλοποιήθηκε από τον Dennis Richie στις αρχές της δεκαετίας του 1970 (Bell Labs). Η

Διαβάστε περισσότερα

Εισαγωγή στον προγραμματισμό

Εισαγωγή στον προγραμματισμό Ενότητες: Εισαγωγή στον προγραμματισμό Η έννοια του προγράμματος Ιστορική αναδρομή Φυσικές και τεχνητές γλώσσες Τεχνικές σχεδίασης προγραμμάτων Ιεραρχική Σχεδίαση Τμηματικός Προγραμματισμός Δομημένος προγραμματισμός

Διαβάστε περισσότερα

BibConvert μετατροπές LOM

BibConvert μετατροπές LOM BibConvert μετατροπές LOM Δημοσθένης Νικούδης Μονάδα Αριστείας ΕΛ/ΛΑΚ ΤΕΙ Αθήνας BibConvert 2 Μετατρέπει μεταδεδομένα από άλλες μορφές σε MARC21 (ή πιο σωστά MARCXML) Command-line tool Δεν έχει web interface

Διαβάστε περισσότερα

ΠΡΟΓΡΑΜΜΑΤΙΣΜΟΣ Η/Υ. Εισαγωγή στην FORTRAN. Δρ. Ιωάννης Λυχναρόπουλος 2014-2015

ΠΡΟΓΡΑΜΜΑΤΙΣΜΟΣ Η/Υ. Εισαγωγή στην FORTRAN. Δρ. Ιωάννης Λυχναρόπουλος 2014-2015 ΠΡΟΓΡΑΜΜΑΤΙΣΜΟΣ Η/Υ Εισαγωγή στην FORTRAN Δρ. Ιωάννης Λυχναρόπουλος 2014-2015 Fortran FORmula TRANslation: (Μία από τις πρώτες γλώσσες τρίτης γενιάς) Εκδόσεις FORTRAN (1957) FORTRAN II (1958) FORTRAN III

Διαβάστε περισσότερα

Δομές Δεδομένων. Λουκάς Γεωργιάδης. email:

Δομές Δεδομένων. Λουκάς Γεωργιάδης. email: Δομές Δεδομένων Λουκάς Γεωργιάδης email: Αλγόριθμος: Μέθοδος για την επίλυση ενός προβλήματος Δεδομένα: Σύνολο από πληροφορίες που

Διαβάστε περισσότερα

Βιοπληροφορική. Μαργαρίτα Θεοδωροπούλου. Πανεπιστήμιο Θεσσαλίας, Λαμία 2016

Βιοπληροφορική. Μαργαρίτα Θεοδωροπούλου. Πανεπιστήμιο Θεσσαλίας, Λαμία 2016 Βιοπληροφορική Μαργαρίτα Θεοδωροπούλου Πανεπιστήμιο Θεσσαλίας, Λαμία 2016 Βιοπληροφορική Εισαγωγή στη Μοριακή Βιολογία, Γενωμική και Βιοπληροφορική. Βάσεις Βιολογικών Δεδομένων. Ακολουθίες Πρωτεϊνών και

Διαβάστε περισσότερα

Αποθηκευμένες Διαδικασίες Stored Routines (Procedures & Functions)

Αποθηκευμένες Διαδικασίες Stored Routines (Procedures & Functions) Αποθηκευμένες Διαδικασίες Stored Routines (Procedures & Functions) Αυγερινός Αραμπατζής Βάσεις Δεδομένων Stored Procedures 1 Stored Routines (1/2) Τμήματα κώδικα τα

Διαβάστε περισσότερα

Μελέτη Περίπτωσης: Random Surfer

Μελέτη Περίπτωσης: Random Surfer Μελέτη Περίπτωσης: Random Surfer Introduction to Programming in Java: An Interdisciplinary Approach Robert Sedgewick and Kevin Wayne Copyright 2008 March 1, 2016 11:10 tt Memex Memex. [Vannevar Bush, 1936]

Διαβάστε περισσότερα


ΕΓΚΑΤΑΣΤΑΣΗ ΣΤΟΙΒΑΣ LAMP (Linux-Apache-MySQL-php) ΣΤO UBUNTU. ΑΑ, Ιαν. 2013 ΕΓΚΑΤΑΣΤΑΣΗ ΣΤΟΙΒΑΣ LAMP (Linux-Apache-MySQL-php) ΣΤO UBUNTU ΑΑ, Ιαν. 2013 Ορισμός LAMP Το LAMP είναι αρκτικόλεξο της στοίβας λογισμικού ανοικτού κώδικα Linux (λειτουργικό σύστημα), Apache (web Server),

Διαβάστε περισσότερα

Μαθησιακά Αντικείμενα

Μαθησιακά Αντικείμενα Μαθησιακά Αντικείμενα Κλειώ Σγουροπούλου Μονάδα Αριστείας ΕΛ/ΛΑΚ ΤΕΙ Αθήνας Περιεχόμενα 2 Μαθησιακά Αντικείμενα: Ανοικτοί Εκπαιδευτικοί Πόροι (ΑΕΠ) Open Educational Resources, δεδομένα, μεταδεδομένα, πρότυπα

Διαβάστε περισσότερα

Εφαρµογές WebGIS Open Source

Εφαρµογές WebGIS Open Source Εφαρµογές WebGIS Open Source Πάνος Βουδούρης Περιεχόµενα Βασικές Έννοιες Open Source Γιατί; Πως; WebGIS Αρχιτεκτονική Παραδείγµατα εφαρµογών GeoServer GeoMajas MapServer + OpenLayers MapServer + SLMapviewer

Διαβάστε περισσότερα



Διαβάστε περισσότερα

ΒΙΟΠΛΗΡΟΦΟΡΙΚΗ ΙΙ. Δυναμικός Προγραμματισμός. Παντελής Μπάγκος

ΒΙΟΠΛΗΡΟΦΟΡΙΚΗ ΙΙ. Δυναμικός Προγραμματισμός. Παντελής Μπάγκος ΒΙΟΠΛΗΡΟΦΟΡΙΚΗ ΙΙ Δυναμικός Προγραμματισμός Παντελής Μπάγκος Δυναμικός Προγραμματισμός Στοίχιση (τοπική-ολική) RNA secondary structure prediction Διαμεμβρανικά τμήματα Hidden Markov Models Άλλες εφαρμογές

Διαβάστε περισσότερα

Open ERP Lab. Μέρος Δεύτερο

Open ERP Lab. Μέρος Δεύτερο Μέρος Δεύτερο Open OBJECT Το Framework του OPEN ERP MVC addons/ Sample Module - med/ # The module directory - demo/ # Demo and unit test population data - i18n/ # Translation files - report/ # Report definitions

Διαβάστε περισσότερα

Ποσοτικές Μέθοδοι στη Διοίκηση Επιχειρήσεων ΙΙ Σύνολο- Περιεχόμενο Μαθήματος

Ποσοτικές Μέθοδοι στη Διοίκηση Επιχειρήσεων ΙΙ Σύνολο- Περιεχόμενο Μαθήματος Ποσοτικές Μέθοδοι στη Διοίκηση Επιχειρήσεων ΙΙ Σύνολο- Περιεχόμενο Μαθήματος Χιωτίδης Γεώργιος Τμήμα Λογιστικής και Χρηματοοικονομικής Άδειες Χρήσης Το παρόν εκπαιδευτικό υλικό υπόκειται σε άδειες χρήσης

Διαβάστε περισσότερα

Εισαγωγή στους Η/Υ και τις Εφαρμογές Ενότητα 5: Επεξεργασία δεδομένων με τη γλώσσα προγραμματισμού python Υπο-ενότητα 5.

Εισαγωγή στους Η/Υ και τις Εφαρμογές Ενότητα 5: Επεξεργασία δεδομένων με τη γλώσσα προγραμματισμού python Υπο-ενότητα 5. Εισαγωγή στους Η/Υ και τις Εφαρμογές Ενότητα 5: Επεξεργασία δεδομένων με τη γλώσσα προγραμματισμού python Υπο-ενότητα 5.1: Λίστες Μανώλης Τζαγκαράκης, Βικτωρία Δασκάλου Σχολή Οργάνωσης και Διοίκησης Επιχειρήσεων

Διαβάστε περισσότερα

Πολλαπλή στοίχιση Φυλογένεση

Πολλαπλή στοίχιση Φυλογένεση Πολλαπλή στοίχιση Φυλογένεση MSA: Τι είναι Στοίχιση για 3 ή περισσότερες ακολουθίες. Αποκαλύπτονται οι συντηρηµένες περιοχές µεταξύ των ακολουθιών µιας οικογένειας. Χρειάζεται για: Δηµιουργία profiles/motifs

Διαβάστε περισσότερα



Διαβάστε περισσότερα

Cloud Computing with Google and Microsoft. Despoina Trikomitou Andreas Diavastos Class: EPL425

Cloud Computing with Google and Microsoft. Despoina Trikomitou Andreas Diavastos Class: EPL425 Cloud Computing with Google and Microsoft Despoina Trikomitou Andreas Diavastos Class: EPL425 Σχεδιάγραμμα Εισαγωγή Τεχνολογίες Cloud Computing Περιγραφή Εργασίας Επιτεύγματα Εργασίας Συμπεράσματα Cloud

Διαβάστε περισσότερα

Εργαλεία Προγραμματισμού Ψηφιακής Επεξεργασίας Εικόνας: Το Matlab Image Processing Toolbox

Εργαλεία Προγραμματισμού Ψηφιακής Επεξεργασίας Εικόνας: Το Matlab Image Processing Toolbox ΚΕΣ 03 Αναγνώριση προτύπων και ανάλυση εικόνας Εργαλεία Προγραμματισμού Ψηφιακής Επεξεργασίας Εικόνας: Το Matlab Image Processing Toolbox Τμήμα Επιστήμης και Τεχνολογίας Τηλεπικοινωνιών Πανεπιστήμιο Πελοποννήσου

Διαβάστε περισσότερα

Ασκήσεις 1 & 2. Βάσεις Δεδομένων. Εργαλεία Αναζήτησης ClustalW & Blast

Ασκήσεις 1 & 2. Βάσεις Δεδομένων. Εργαλεία Αναζήτησης ClustalW & Blast Ασκήσεις 1 & 2 Βάσεις Δεδομένων Εργαλεία Αναζήτησης ClustalW & Blast Μοριακή Προσομοίωση Εισαγωγή: Δομική Βάση Βιολογικών Φαινομένων Η αξιοποίηση του πλήθους των δομικών στοιχείων για την εξαγωγή βιολογικά

Διαβάστε περισσότερα

Φορολογική Βιβλιοθήκη. Θανάσης Φώτης Προγραμματιστής Εφαρμογών

Φορολογική Βιβλιοθήκη. Θανάσης Φώτης Προγραμματιστής Εφαρμογών Φορολογική Βιβλιοθήκη Θανάσης Φώτης Προγραμματιστής Εφαρμογών Το έργο Η φορολογική βιβλιοθήκη πρόκειται για ένα έργο που φιλοδοξεί να αποτελέσει σημαντικό βοήθημα για τον επαγγελματία λογιστή και όχι μόνο.

Διαβάστε περισσότερα



Διαβάστε περισσότερα

ΑΛΓΟΡΙΘΜΟΙ. Τι είναι αλγόριθμος

ΑΛΓΟΡΙΘΜΟΙ. Τι είναι αλγόριθμος ΑΛΓΟΡΙΘΜΟΙ Στο σηµείωµα αυτό αρχικά εξηγείται η έννοια αλγόριθµος και παραθέτονται τα σπουδαιότερα κριτήρια που πρέπει να πληρεί κάθε αλγόριθµος. Στη συνέχεια, η σπουδαιότητα των αλγορίθµων συνδυάζεται

Διαβάστε περισσότερα

Δομές Δεδομένων. Λουκάς Γεωργιάδης.

Δομές Δεδομένων. Λουκάς Γεωργιάδης. Δομές Δεδομένων Λουκάς Γεωργιάδης email: Αλγόριθμος: Μέθοδος για την επίλυση ενός προβλήματος Δομή Δεδομένων: Μέθοδος αποθήκευσης

Διαβάστε περισσότερα

Πληροφοριακά Συστήµατα

Πληροφοριακά Συστήµατα Nell Dale John Lewis Chapter 12 Πληροφοριακά Συστήµατα Στόχοι Ενότητας Η κατανόηση της έννοιας «Πληροφοριακό Σύστηµα» Επεξήγηση της οργάνωσης λογιστικών φύλλων (spreadsheets) Επεξήγηση της ανάλυσης δεδοµένων

Διαβάστε περισσότερα

Εισαγωγή στον Προγραμματισμό Μάθημα 1: Βασική Πλοήγηση σε Linux CLI. Οκτώβριος 2016 Χ. Αλεξανδράκη

Εισαγωγή στον Προγραμματισμό Μάθημα 1: Βασική Πλοήγηση σε Linux CLI. Οκτώβριος 2016 Χ. Αλεξανδράκη Εισαγωγή στον Προγραμματισμό Μάθημα 1: Βασική Πλοήγηση σε Linux CLI Οκτώβριος 2016 Χ. Αλεξανδράκη Command Line Interface Τα περισσότερα λειτουργικά συστήματα είναι φτιαγμένα ώστε να παρέχουν δύο περιβάλλοντα

Διαβάστε περισσότερα

Εισαγωγή στους Ηλεκτρονικούς Υπολογιστές

Εισαγωγή στους Ηλεκτρονικούς Υπολογιστές Εισαγωγή στους Ηλεκτρονικούς Υπολογιστές 1 ο Εξάμηνο Σπουδών Χειμερινό Εξάμηνο 2012/13 Τμήμα Εφαρμοσμένων Μαθηματικών, Πανεπιστήμιο Κρήτης Διδάσκων: Χαρμανδάρης Ευάγγελος, email:, Ιστοσελίδα

Διαβάστε περισσότερα

Architecture οf Integrated Ιnformation Systems (ARIS)

Architecture οf Integrated Ιnformation Systems (ARIS) Architecture οf Integrated Ιnformation Systems (ARIS) Η αρχιτεκτονική ARIS (ARchitecture οf Integrated information Systems) έχει ως στόχο της την περιγρφή όλων των όψεων ή οπτικών ενός επιχειρηματικού

Διαβάστε περισσότερα


OpenCL. Προγραμματισμός GPU σε περιβάλλον OpenCL και ταύτιση αλφαριθμητικών Πυργιώτης Θεμιστοκλής ΠΜΣ Τμήματος Εφαρμοσμένης Πληροφορικής Συστήματα Υπολογιστών Πανεπιστημίο Μακεδονίας. Επιβλέπων

Διαβάστε περισσότερα


ΤΕΧΝΙΚΕΣ ΑΝΤΙΚΕΙΜΕΝΟΣΤΡΑΦΟΥΣ ΠΡΟΓΡΑΜΜΑΤΙΣΜΟΥ. Κλάσεις και Αντικείμενα Μέθοδοι ΤΕΧΝΙΚΕΣ ΑΝΤΙΚΕΙΜΕΝΟΣΤΡΑΦΟΥΣ ΠΡΟΓΡΑΜΜΑΤΙΣΜΟΥ Κλάσεις και Αντικείμενα Μέθοδοι Παράδειγμα Θέλουμε ένα πρόγραμμα που να προσομοιώνει την κίνηση ενός αυτοκινήτου, το οποίο κινείται και τυπώνει τη θέση του.

Διαβάστε περισσότερα

Εισαγωγή στους Υπολογιστές

Εισαγωγή στους Υπολογιστές Εισαγωγή στους Υπολογιστές Ενότητα 8: Ψηφιακή Αριθμητική Βασίλης Παλιουράς Πολυτεχνική Σχολή Τμήμα Ηλεκτρολόγων Μηχανικών και Τεχνολογίας Υπολογιστών Σκοποί ενότητας Γιατί μας ενδιαφέρει το δυαδικό Αριθμητικές

Διαβάστε περισσότερα

Μάθηµα 3. Τµήµα Αρχειονοµίας - Βιβλιοθηκονοµίας

Μάθηµα 3. Τµήµα Αρχειονοµίας - Βιβλιοθηκονοµίας Μάθηµα 3 45 Ολοκληρωµένα Συστήµατα Βιβλιοθηκών Η έννοια του «Ολοκληρωµένου» Συστατικά (modules)( Καταλογογράφηση Προσκτήσεις ανεισµός ιαχείριση Περιοδικών ηµόσιος Κατάλογος (OPAC( OPAC-On-line Public Access

Διαβάστε περισσότερα

Πληροφορική ΙΙ Θεματική Ενότητα 4

Πληροφορική ΙΙ Θεματική Ενότητα 4 Ανοικτά Ακαδημαϊκά Μαθήματα στο ΤΕΙ Ιονίων Νήσων Πληροφορική ΙΙ Θεματική Ενότητα 4 Μεταβλητές και Μαθηματικοί και λογικοί τελεστές Το περιεχόμενο του μαθήματος διατίθεται με άδεια Creative Commons εκτός

Διαβάστε περισσότερα

Εισαγωγή στους Ηλεκτρονικούς Υπολογιστές

Εισαγωγή στους Ηλεκτρονικούς Υπολογιστές Εισαγωγή στους Ηλεκτρονικούς Υπολογιστές Εισαγωγή στον επιστημονικό προγραμματισμό 1 ο Μάθημα Λεωνίδας Αλεξόπουλος Λέκτορας ΕΜΠ E-mail: URL: 1 Εισαγωγή στo MatLab

Διαβάστε περισσότερα