Bioinformatics Programming in Python. LOGO Βικάτος Παντελεήμων

Μέγεθος: px
Εμφάνιση ξεκινά από τη σελίδα:

Download "Bioinformatics Programming in Python. http://taspython.eu/ LOGO Βικάτος Παντελεήμων"

Transcript

1 Bioinformatics Programming in Python LOGO Βικάτος Παντελεήμων

2 Σύνοψη 1. Γιατί να χρησιμοποιούμε python ; 2. Python modules 3. Biopython 4. Παραδείγματα

3 Python Χαρακτηριστικά Διερμηνευόμενη,υψηλού επιπέδου Γ.Π. Ανοιχτού κώδικα Εύκολη Εκμάθηση Αναγνωσιμότητα Συντήρηση Εύπλαστη Παίζει παντού (Cross Platform) Συνεργάσιμη Ώριμη Όχι πια segmentation fault

4 Γιατί python? Ερώτημα : Διευκολύνει τους μηχανικούς που ασχολούνται με Bioinformatics ;

5 Γιατί python? Ερώτημα : Διευκολύνει τους μηχανικούς που ασχολούνται με Bioinformatics ; Απάντηση : Με βεβαιότητα ΝΑΙ!!!!

6 Γιατί python? Ερώτημα : Διευκολύνει τους μηχανικούς που ασχολούνται με Bioinformatics ; Απάντηση : Με βεβαιότητα ΝΑΙ!!!! Λόγος : Δεν ανησυχείς για τα παρακάτω : Παράξενα σύμβολα (~=, <>, eq, '\n', {}...) Εναλλακτική σύνταξη για να κάνει την ίδια λειτουργία Ορισμός τύπος μεταβλητών Διαχείριση μνήμης IO, call by reference/value κτλ

7 Ποια γλώσσα χρησιμοποιείται ;

8 Τι είναι η Biopython? BioPython : μια συλλογή τυποποιημένων libraries σε python για τη βιοπληροφορική. Ανοιχτού κώδικα (Open Source,) Cross platform: Linux, Windows, Mac OS X, Συναφή projects BioPerl, BioRuby, BioJava,

9 Τι είναι η Biopython? Πλεονεκτήματα χρήσης open source libraries : Αναπαραγωγιμότητα Ευκολία σύγκρισης αποτελεσμάτων Λιγότερα λάθη Λιγότερος χρόνος υλοποίησης

10 Εφαρμογές της Biopython Διαχείριση και επεξεργασία ακολουθιών BLAST (τοπική και online) Web databases ( NCBI s EUtils) Επιλογή command line διεπαφών (e.g. clustalw) Ομαδοποίηση (Bio.Cluster) Φυλογενετική (Bio.Nexus) Δομή Πρωτεϊνών (Bio.PDB) Υποστήριξη βάσεων (Bio.SQL) Γενετική Πληθυσμού (Bio.PopGen)

11 Επιπλέον modules NumPy SciPy N-dimensional μητρώα Συναρτήσεις γραμμικής άλγεβρας Μετασχηματισμούς Fourier Γεννήτορες τυχαίων αριθμών Στατιστικά πακέτα Αριθμητική ολοκλήρωση Γραμμική άλγεβρα Επεξεργασία σημάτων Επεξεργασία εικόνας Γενετικούς αλγόριθμους Επιλυτές Διαφορικών εξισώσεων

12 Επιπλέον modules Matplotlib Βιβλιοθήκη για το σχεδιασμό 2D και 3D διαγραμμάτων. Πλεονεκτήματα Ευκολία χρήσης Documentation και tutorials Αποδοτικό visualization.

13 Επιπλέον modules NLTK(Natural Language Toolkit)

14 Άλλες εφαρμογές και βιβλιοθήκες Django ( Web frameworks ) Plone ( Content Management System ) ReportLab ( PDF generation ) MPI for Python ( Παράλληλος Προγραμματισμός ) SymPy ( Συμβολικά Μαθηματικά ) Python/R interface ( στατιστική ανάλυση) SWIG ( Simplified Wrapper and Interface Generator) Pygr (βάση δεδομένων γραφικών ) PysCeS ( Προσομοίωση των κυτταρικών συστημάτων ) SloppyCell ( Προσομοίωση βιομοριακών δικτύων )...

15 Biopython Sequence objects >>> from Bio.Seq import Seq >>> my_seq = Seq("AGTACACTGGT") >>> my_seq Seq( AGTACACTGGT, Alphabet()) >>> print my_seq AGTACACTGGT >>> my_seq.alphabet Alphabet() Λειτουργούν ως strings αλλά έχουν περισσότερες ιδιότητες

16 Biopython - Alphabet

17 Biopython Seq Functions Βασικές συναρτήσεις complement() reverse_complement() transcribe() ) back_transcribe() ) translate() :συμπληρωματική : αντίστροφη συμπληρωματική : DNA to RNA : RNA to DNA : DNA to protein

18 Biopython Seq Functions Transcription

19 Biopython Seq Functions Transcription >>> from Bio.Seq import Seq >>> from Bio.Alphabet import IUPAC >>> coding_dna = Seq("ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG", IUPAC.unambiguous_dna) >>> coding_dna Seq( ATGGCCATTGTAATGGGCCGCTGAAAGGGTGCCCGATAG, IUPACUnambiguousDNA()) >>> messenger_rna = coding_dna.transcribe() >>> messenger_rna Seq( AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG, IUPACUnambiguousRNA())

20 Biopython Seq Functions Translation

21 Biopython Seq Functions Translation >>> from Bio.Seq import Seq >>> from Bio.Alphabet import IUPAC >>> messenger_rna = Seq("AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG", IUPAC.unambiguous_rna) >>> messenger_rna Seq( AUGGCCAUUGUAAUGGGCCGCUGAAAGGGUGCCCGAUAG, IUPACUnambiguousRNA()) >>> messenger_rna.translate() Seq( MAIVMGR*KGAR*, HasStopCodon(IUPACProtein(), * ))

22 Biopython Seq Functions Translation Tables >>> from Bio.Data import CodonTable >>> standard_table = CodonTable.unambiguous_dna_by_name["Standard"]

23 Biopython SeqIO Βασικές λειτουργίες : parse read write convert : όλων των στοιχείων ενός βιολογικού αρχείου : διάβασμα ενός στοιχείου : εγγραφή στοιχείων στο αρχείο : μετατροπή αρχείου από την μια μορφή στην άλλη

24 Biopython SeqIO Βασικές λειτουργίες : parse read write convert : όλων των στοιχείων ενός βιολογικού αρχείου : διάβασμα ενός στοιχείου : εγγραφή στοιχείων στο αρχείο : μετατροπή αρχείου από την μια μορφή στην άλλη File Formats : ace gb (genbank) pir clustal ig stockholm Embl nexus swiss fasta phd tab fastq phylip qual και για 3D δομές : pdb

25 Biopython SeqIO Parsing & read από αρχείο from Bio import SeqIO handle = open("ls_orchid.fasta") for seq_record in SeqIO.parse(handle, "fasta"): print seq_record.id print repr(seq_record.seq) print len(seq_record) handle.close()

26 Biopython SeqIO Parsing & read από αρχείο from Bio import SeqIO handle = open("ls_orchid.fasta") for seq_record in SeqIO.parse(handle, "fasta"): print seq_record.id print repr(seq_record.seq) print len(seq_record) handle.close() gi emb Z CIZ78533 Seq( CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGATGAGACCGTGG...CGC, SingleLetterAlphabet()) gi emb Z PBZ78439 Seq( CATTGTTGAGATCACATAATAATTGATCGAGTTAATCTGGAGGATCTGTTTACT...GCC, SingleLetterAlphabet()) 592

27 Biopython SeqIO Parsing & read από αρχείο με iterator from Bio import SeqIO handle = open( ls_orchid.fasta") record_iterator = SeqIO.parse(handle, "fasta") first_record = record_iterator.next() print first_record.id print first_record.description second_record = record_iterator.next() print second_record.id print second_record.description

28 Biopython SeqIO Parsing & read από αρχείο με iterator from Bio import SeqIO handle = open( ls_orchid.fasta") record_iterator = SeqIO.parse(handle, "fasta") first_record = record_iterator.next() print first_record.id print first_record.description second_record = record_iterator.next() print second_record.id print second_record.description gi emb Z CIZ78533 gi emb Z CIZ78533 C.irapeanum 5.8S rrna gene and ITS1 and ITS2 DNA gi emb Z CCZ78532 gi emb Z CCZ78532 C.californicum 5.8S rrna gene and ITS1 and ITS2 DNA

29 Biopython SeqIO Parsing & read από το διαδίκτυο from Bio import Entrez from Bio import SeqIO Entrez. = handle = Entrez.efetch(db="nucleotide", rettype="fasta", id=" ") seq_record = SeqIO.read(handle, "fasta") handle.close() print "%s with %i features" % (seq_record.id, len(seq_record.features))

30 Biopython SeqIO Parsing & read από το διαδίκτυο from Bio import Entrez from Bio import SeqIO Entrez. = handle = Entrez.efetch(db="nucleotide", rettype="fasta", id=" ") seq_record = SeqIO.read(handle, "fasta") handle.close() print "%s with %i features" % (seq_record.id, len(seq_record.features)) gi gb AF AF with 0 features

31 Biopython SeqIO Μετατροπή αρχείων διαφορετικό format from Bio import SeqIO from StringIO import StringIO handle1 =open( my_example.fasta") handle2 =open( ls_orchid.gbk") count = SeqIO.convert(handle2, "genbank", handle1, "fasta") handle1.close() handle2.close()

32 Biopython SeqRecord Εγγραφές βιολογικών κειμένων SeqRecord = Seq object + metadata metadata : id name description annotations features dbxrefs

33 Biopython SeqRecord Επιλογή στοιχείων ενός Record >>> from Bio import SeqIO >>> record = SeqIO.read("NC_ fna", "fasta") >>> record SeqRecord(seq=Seq( TGTAACGAACGGTGCAATAGTGATCCACACCCAACGCCTGAAATCAGATCCAGG...CTG, SingleLetterAlphabet()), id= gi ref NC_ , name= gi ref NC_ , description= gi ref NC_ Yersinia pestis biovar Microtus... sequence, dbxrefs=[])

34 Biopython SeqRecord Επιλογή στοιχείων ενός Record >>> from Bio import SeqIO >>> record = SeqIO.read("NC_ fna", "fasta") >>> record SeqRecord(seq=Seq( TGTAACGAACGGTGCAATAGTGATCCACACCCAACGCCTGAAATCAGATCCAGG...CTG, SingleLetterAlphabet()), id= gi ref NC_ , name= gi ref NC_ , description= gi ref NC_ Yersinia pestis biovar Microtus... sequence, dbxrefs=[]) >>> record.id gi ref NC_ >>> record.name gi ref NC_ >>> record.description gi ref NC_ Yersinia pestis biovar Microtus... ppcp1, complete sequence

35 Biopython SeqRecord Δημιουργία Record και Format from Bio.Seq import Seq from Bio.SeqRecord import SeqRecord from Bio.Alphabet import generic_protein record = SeqRecord(Seq("MMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPSETHLDSMVGQA LFGD" \ +"GAGAVIVGSDPDLSVERPLYELVWTGATLLPDSEGAIDGHLREVGLTFHLLKDVPGLISK" \ +"NIEKSLKEAFTPLGISDWNSTFWIAHPGGPAILDQVEAKLGLKEEKMRATREVLSEYGNM" \ +"SSAC", generic_protein), id="gi gb AAK AF376133_1", description="chalcone synthase [Cucumis sativus]") print record.format("fasta")

36 Biopython SeqRecord Δημιουργία Record και Format from Bio.Seq import Seq from Bio.SeqRecord import SeqRecord from Bio.Alphabet import generic_protein record = SeqRecord(Seq("MMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPSETHLDSMVGQA LFGD" \ +"GAGAVIVGSDPDLSVERPLYELVWTGATLLPDSEGAIDGHLREVGLTFHLLKDVPGLISK" \ +"NIEKSLKEAFTPLGISDWNSTFWIAHPGGPAILDQVEAKLGLKEEKMRATREVLSEYGNM" \ +"SSAC", generic_protein), id="gi gb AAK AF376133_1", description="chalcone synthase [Cucumis sativus]") print record.format("fasta") >gi gb AAK AF376133_1 chalcone synthase [Cucumis sativus] MMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPSETHLDSMVGQALFGD GAGAVIVGSDPDLSVERPLYELVWTGATLLPDSEGAIDGHLREVGLTFHLLKDVPGLISK NIEKSLKEAFTPLGISDWNSTFWIAHPGGPAILDQVEAKLGLKEEKMRATREVLSEYGNM SSAC

37 Biopython SeqRecord Eγγραφή Record σε αρχείο from Bio import SeqIO handle = open( my_example.fasta") SeqIO.write(my_records, handle,"fasta") handle.close()

38 Biopython BLAST Basic Local Alignment Search Tool : Βάση δεδομένων και Web Service Online και τοπική Τρόπος χρήσης : 1. Αναζήτηση με την function qblast() 2. Επιλογή blast προγράμματος 3. Δήλωση βάσης δεδομένων 4. Αναζήτηση query Επιστρέφει ΧML αρχείο με πληροφορίες για το alignment.

39 Biopython BLAST Χρησιμοποίηση της online BLAST from Bio.Blast import NCBIWWW from Bio import SeqIO handle = open( m_cold.fasta") save_file = open( my_blast.xml", "w") record = SeqIO.read(handle, format="fasta") result_handle = NCBIWWW.qblast("blastn", "nr", record.seq) save_file.write(result_handle.read()) save_file.close() handle.close()

40 Biopython BLAST BLAST Record και Στοίχιση from Bio.Blast import NCBIXML save_file = open( my_blast.xml") blast_record = NCBIXML.read(save_file) E_VALUE_THRESH = 0.04 for alignment in blast_record.alignments: for hsp in alignment.hsps: if hsp.expect < E_VALUE_THRESH: print "****Alignment****" print "sequence:", alignment.title print "length:", alignment.length print "e value:", hsp.expect print hsp.query[0:75] + "..." print hsp.match[0:75] + "..." print hsp.sbjct[0:75] + "..."

41 Biopython BLAST BLAST Record και Στοίχιση ****Alignment**** sequence: gi emb BX Arabidopsis thaliana Full-length cdna Complete sequence from clone GSLTPGH63ZH10 of Hormone Treated Callus of strain col-0 of Arabidopsis thaliana (thale cress) length: 910 e value: e-25 AAAATGGGGAGAGAAATGAAGTACTTGGCCATGAAAACTGATCAATTGGCCGTGGCTAATATGATCGATTCCGAT AAAATGGGAAGGGG--TGA-GTTTTTGGCCATGAAGACTGAGGA---GAACGCGGCTAACCTGATCAATTCCGAT...

42 Biopython NCBI s Entrez Entrez : Σύστημα ανάκτησης πληροφορίας από τις βάσεις δεδομένων της NCBI. from Bio import Entrez Entrez. = handle = Entrez.einfo() record = Entrez.read(handle) print record["dblist"]

43 Biopython NCBI s Entrez Entrez : Σύστημα ανάκτησης πληροφορίας από τις βάσεις δεδομένων της NCBI. from Bio import Entrez Entrez. = handle = Entrez.einfo() record = Entrez.read(handle) print record["dblist"] Περιεχόμενα βάσης : [ pubmed, protein, nucleotide, nuccore, nucgss, nucest, structure, genome, books, cancerchromosomes, cdd, gap, domains, gene, genomeprj, gensat, geo, gds, homologene, journals, mesh, ncbisearch, nlmcatalog, omia, omim, pmc, popset, probe, proteinclusters, pcassay, pccompound, pcsubstance, snp, taxonomy, toolkit, unigene, unists ]

44 Biopython NCBI s Entrez Αναζήτηση στην βάση from Bio import Entrez Entrez. = handle = Entrez.esearch(db="nucleotide",term="Cypripedioideae[Orgn] AND matk[gene]") record = Entrez.read(handle) print record["count"] print record["idlist"]

45 Biopython NCBI s Entrez Αναζήτηση στην βάση from Bio import Entrez Entrez. = handle = Entrez.esearch(db="nucleotide",term="Cypripedioideae[Orgn] AND matk[gene]") record = Entrez.read(handle) print record["count"] print record["idlist"] 25 [' ', ' ', ' ', ' ', ' ', ' ', ' ', ' ', ' ', ' ', ' ', ' ', ' ', ' ', ' ', ' ', ' ', ' ', ' ', ' ']

46 Biopython NCBI s Entrez Aνάκτηση στοιχείων από το Entrez from Bio import Entrez Entrez. = handle = Entrez.efetch(db="nucleotide", id=" ", rettype="gb") print handle.read() Τυπώνει το ζητούμενο αρχείο σε μορφή genbank.

47 Biopython NCBI s Entrez Επιπλέον συναρτήσεις ELink EGQuery ESummary : αναζήτηση για σχετικά αντικείμενα στην NCBI Entrez : αναζήτηση σε όλες τις βάσεις(global search) : ανάκτηση περιλήψεων από τα primary IDs

48 Biopython PDBParser Διαχείριση αρχέιων PDB Περιγραφή της 3D αναπαράστασης μακρομορίων

49 Biopython κ.α. Population genetics Bio.PopGen Supervised learning methods LogisticRegression,kNN, NaiveBayes Bio.MarkovModel Genome Bio.Graphics, GenomeDiagram

50 Support & Tutorials Υποστήριξη Open Bioinformatics Foundation Διεθνής ομάδα από εθελοντές προγραμματιστές Πλήρης οδηγός Biopython Tutorial & Cookbook Εκτενείς λεπτομέρειες στο

51 Πηγές Βιβλιογραφία Bioinformatics Programming in Python: A Practical Course for Beginners Ruediger-Marcus Flaig Bioinformatics Programming Using Python, Mitcell L. Model Python for Bioinformatics, Sebastian Bassi Links:

52 LOGO

Βιοπληροφορική Ι. Παντελής Μπάγκος. Παν/µιο Στερεάς Ελλάδας

Βιοπληροφορική Ι. Παντελής Μπάγκος. Παν/µιο Στερεάς Ελλάδας Βιοπληροφορική Ι Παντελής Μπάγκος Παν/µιο Στερεάς Ελλάδας Λαµία 2006 1 Βιοπληροφορική Ι Εισαγωγή: Ορισµός της Βιοπληροφορικής, Υποδιαιρέσεις της Βιοπληροφορικής, Τα είδη των δεδοµένων στη Βιοπληροφορική.

Διαβάστε περισσότερα

ΟΜΑΔΑ Λ. Αναστασίου Κωνσταντίνος Δεληγιάννη Ισαβέλλα Ζωγοπούλου Άννα Κουκάκης Γιώργος Σταθάκη Αρετιάννα

ΟΜΑΔΑ Λ. Αναστασίου Κωνσταντίνος Δεληγιάννη Ισαβέλλα Ζωγοπούλου Άννα Κουκάκης Γιώργος Σταθάκη Αρετιάννα ΟΜΑΔΑ Λ Αναστασίου Κωνσταντίνος Δεληγιάννη Ισαβέλλα Ζωγοπούλου Άννα Κουκάκης Γιώργος Σταθάκη Αρετιάννα ΒΙΟΠΛΗΡΟΦΟΡΙΚΗ Τι είναι η βιοπληροφορική; Αποκαλείται ο επιστημονικός κλάδος ο οποίος προέκυψε από

Διαβάστε περισσότερα

Πανεπιστήμιο Δυτικής Μακεδονίας. Τμήμα Μηχανικών Πληροφορικής & Τηλεπικοινωνιών. Βιοπληροφορική. Ενότητα 1: Εισαγωγή στη Βιοπληροφορική

Πανεπιστήμιο Δυτικής Μακεδονίας. Τμήμα Μηχανικών Πληροφορικής & Τηλεπικοινωνιών. Βιοπληροφορική. Ενότητα 1: Εισαγωγή στη Βιοπληροφορική Τμήμα Μηχανικών Πληροφορικής & Τηλεπικοινωνιών Βιοπληροφορική Ενότητα 1: Εισαγωγή στη Βιοπληροφορική Αν. καθηγητής Αγγελίδης Παντελής e-mail: paggelidis@uowm.gr ΕΕΔΙΠ Μπέλλου Σοφία e-mail: sbellou@uowm.gr

Διαβάστε περισσότερα

ΑΣΚΗΣΗ 1η Αναζήτηση πληροφορίας σε Βιβλιογραφικές Βάσεις εδοµένων

ΑΣΚΗΣΗ 1η Αναζήτηση πληροφορίας σε Βιβλιογραφικές Βάσεις εδοµένων ΑΣΚΗΣΗ 1η Αναζήτηση πληροφορίας σε Βιβλιογραφικές Βάσεις εδοµένων ΕΙΣΑΓΩΓΗ Η αναζήτηση και µελέτη της επιστηµονικής βιβλιογραφίας αποτελεί βασική προϋπόθεση για την επίλυση ερευνητικών προβληµάτων. Η βιβλιογραφική

Διαβάστε περισσότερα

Τυπικές χρήσεις της Matlab

Τυπικές χρήσεις της Matlab Matlab Μάθημα 1 Τι είναι η Matlab Ολοκληρωμένο Περιβάλλον Περιβάλλον ανάπτυξης Διερμηνευμένη γλώσσα Υψηλή επίδοση Ευρύτητα εφαρμογών Ευκολία διατύπωσης Cross platform (Wintel, Unix, Mac) Τυπικές χρήσεις

Διαβάστε περισσότερα

Chalkou I. C. [PROJECT] Ανάθεση εργασιών.

Chalkou I. C. [PROJECT] Ανάθεση εργασιών. Πληροφορική της Υγείας 2014 Chalkou I. C. [PROJECT] Ανάθεση εργασιών. Περιεχόμενα 1. Ομάδα Γ... 3 1.1 Σαψάκη Δ. - Σαψάκη Π.... 3 1.2 Βλάχου - Γεωργοπούλου... 3 1.3 Μπέρτσου - Τσάμη... 4 1.4 Καραγιάννη

Διαβάστε περισσότερα

Εργαστήριο Σημασιολογικού Ιστού

Εργαστήριο Σημασιολογικού Ιστού Εργαστήριο Σημασιολογικού Ιστού Ενότητα 2: Εισαγωγή στην Οργάνωση των Σημασιολογικών Δεδομένων Μ.Στεφανιδάκης 15-2-2015. Ποιο το κατάλληλο μοντέλο δεδομένων; Τα σημασιολογικά δεδομένα πρέπει να εκτεθούν

Διαβάστε περισσότερα

ΑΝΟΙΧΤΑ ΑΚΑΔΗΜΑΙΚΑ ΜΑΘΗΜΑΤΑ ΑΡΙΣΤΟΤΕΛΕΙΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΘΕΣΣΑΛΟΝΙΚΗΣ ΒΙΟΠΛΗΡΟΦΟΡΙΚΗ. Ενότητα 1 η : Εισαγωγή. Ηλίας Καππάς Τμήμα Βιολογίας

ΑΝΟΙΧΤΑ ΑΚΑΔΗΜΑΙΚΑ ΜΑΘΗΜΑΤΑ ΑΡΙΣΤΟΤΕΛΕΙΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΘΕΣΣΑΛΟΝΙΚΗΣ ΒΙΟΠΛΗΡΟΦΟΡΙΚΗ. Ενότητα 1 η : Εισαγωγή. Ηλίας Καππάς Τμήμα Βιολογίας ΑΡΙΣΤΟΤΕΛΕΙΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΘΕΣΣΑΛΟΝΙΚΗΣ ΑΝΟΙΧΤΑ ΑΚΑΔΗΜΑΙΚΑ ΜΑΘΗΜΑΤΑ ΒΙΟΠΛΗΡΟΦΟΡΙΚΗ Ενότητα 1 η : Εισαγωγή Ηλίας Καππάς Άδειες Χρήσης Το παρόν εκπαιδευτικό υλικό υπόκειται σε άδειες χρήσης Creative Commons.

Διαβάστε περισσότερα

Ενότητα 3: Τα δεδομένα στο Web. (και η σημασιολογία τους semantics )

Ενότητα 3: Τα δεδομένα στο Web. (και η σημασιολογία τους semantics ) Ενότητα 3: Τα δεδομένα στο Web (και η σημασιολογία τους semantics ) Σημασιολογία semantics Τι σημαίνουν τα δεδομένα; Ποια η έννοιά τους; Μετάδοση έννοιας και ενσωμάτωση στη γνώση....έχοντας ως αποτέλεσμα

Διαβάστε περισσότερα

ΓΛΩΣΣΙΚΗ ΤΕΧΝΟΛΟΓΙΑ. Python & NLTK: Εισαγωγή

ΓΛΩΣΣΙΚΗ ΤΕΧΝΟΛΟΓΙΑ. Python & NLTK: Εισαγωγή ΓΛΩΣΣΙΚΗ ΤΕΧΝΟΛΟΓΙΑ Python & NLTK: Εισαγωγή Εισαγωγή Γιατί Python? Παρουσίαση NLTK Πηγές και χρήσιμα εργαλεία Φροντιστήριο σε Python Στο φροντιστήριο: Εισαγωγή στην Python Ζητήματα προγραμματισμού για

Διαβάστε περισσότερα

Πανεπιστήμιο Δυτικής Μακεδονίας. Τμήμα Μηχανικών Πληροφορικής & Τηλεπικοινωνιών. Βιοπληροφορική

Πανεπιστήμιο Δυτικής Μακεδονίας. Τμήμα Μηχανικών Πληροφορικής & Τηλεπικοινωνιών. Βιοπληροφορική Τμήμα Μηχανικών Πληροφορικής & Τηλεπικοινωνιών Βιοπληροφορική Ενότητα 12: Αναζήτηση ομοιοτήτων έναντι βάσεων δεδομένων με τη χρήση ευρετικών αλγορίθμων Αν. καθηγητής Αγγελίδης Παντελής e-mail: paggelidis@uowm.gr

Διαβάστε περισσότερα

Διάλεξη 2. Μεταβλητές - Δομές Δεδομένων - Eίσοδος δεδομένων - Έξοδος: Μορφοποίηση - Συναρτήσεις. Διοργάνωση : ΚΕΛ ΣΑΤΜ

Διάλεξη 2. Μεταβλητές - Δομές Δεδομένων - Eίσοδος δεδομένων - Έξοδος: Μορφοποίηση - Συναρτήσεις. Διοργάνωση : ΚΕΛ ΣΑΤΜ Διάλεξη 2 Μεταβλητές - Δομές Δεδομένων - Eίσοδος δεδομένων - Έξοδος: Μορφοποίηση - Συναρτήσεις Διοργάνωση : ΚΕΛ ΣΑΤΜ Διαφάνειες: Skaros, MadAGu Παρουσίαση: MadAGu Άδεια: Creative Commons 3.0 2 Internal

Διαβάστε περισσότερα

ΠΑΝΕΠΙΣΤΗΜΙΟ ΚΥΠΡΟΥ ΕΠΛ 450 ΥΠΟΛΟΓΙΣΤΙΚΗ ΒΙΟΛΟΓΙΑ. Παύλος Αντωνίου

ΠΑΝΕΠΙΣΤΗΜΙΟ ΚΥΠΡΟΥ ΕΠΛ 450 ΥΠΟΛΟΓΙΣΤΙΚΗ ΒΙΟΛΟΓΙΑ. Παύλος Αντωνίου ΠΑΝΕΠΙΣΤΗΜΙΟ ΚΥΠΡΟΥ ΕΠΛ 450 ΥΠΟΛΟΓΙΣΤΙΚΗ ΒΙΟΛΟΓΙΑ Παύλος Αντωνίου Με μια ματιά: Εισαγωγή στη Βιολογία Ευθυγράμμιση Ακολουθιών Αναζήτηση ομοίων ακολουθιών από βάσεις δεδομενων Φυλογενετική πρόβλεψη Πρόβλεψη

Διαβάστε περισσότερα

2. Εισαγωγή Δεδομένων σε Σχεσιακή Βάση Δεδομένων

2. Εισαγωγή Δεδομένων σε Σχεσιακή Βάση Δεδομένων 2. Εισαγωγή Δεδομένων σε Σχεσιακή Βάση Δεδομένων Μετά τον μετασχηματισμό των δεδομένων με τη χρήση του Excel, τα δεδομένα θα εισαχθούν σε μια σχεσιακή βάση δεδομένων (Microsoft SQL Sever 2005) ώστε να

Διαβάστε περισσότερα

1 η ΕΝΟΤΗΤΑ ΕΙΣΑΓΩΓΗ (Προγραμματισμός & MATLAB)

1 η ΕΝΟΤΗΤΑ ΕΙΣΑΓΩΓΗ (Προγραμματισμός & MATLAB) ΣΧΟΛΗ ΠΟΛΙΤΙΚΩΝ ΜΗΧΑΝΙΚΩΝ ΕΜΠ ΜΕΘΟΔΟΙ ΕΠΙΛΥΣΗΣ ΜΕ Η/Υ 1 η ΕΝΟΤΗΤΑ ΕΙΣΑΓΩΓΗ (Προγραμματισμός & MATLAB) Ν.Δ. Λαγαρός Μ. Φραγκιαδάκης Α. Στάμος Άδεια Χρήσης Το παρόν εκπαιδευτικό υλικό υπόκειται σε άδειες

Διαβάστε περισσότερα

Προγραµµατισµός Η/Υ. Μέρος2

Προγραµµατισµός Η/Υ. Μέρος2 Προγραµµατισµός Η/Υ Μέρος2 Περιεχόμενα Επανάληψη Βασικών Σύμβολων Διαγραμμάτων Ροής Αλγόριθμος Ψευδοκώδικας Παραδείγματα Αλγορίθμων Γλώσσες προγραμματισμού 2 Επανάληψη Βασικών Σύμβολων Διαγραμμάτων Ροής

Διαβάστε περισσότερα

Συμβολική γλώσσα Εκπαιδευτικού Υπολογιστή - Λογισμικό Υπολογιστών

Συμβολική γλώσσα Εκπαιδευτικού Υπολογιστή - Λογισμικό Υπολογιστών Συμβολική γλώσσα Εκπαιδευτικού Υπολογιστή - Λογισμικό Υπολογιστών Πρόγραμμα σε γλώσσα μηχανής του ΕΚΥ Θέση μνήμης Περιεχόμενα μνήμης Εντολή (assembly) 0 0001 000000000011 lda 3 1 0011 000000000100 ada

Διαβάστε περισσότερα

Εισαγωγή στον Προγραμματισμό Python Μάθημα 4: Συναρτήσεις (functions) και δομοστοιχεία (modules) στην Python

Εισαγωγή στον Προγραμματισμό Python Μάθημα 4: Συναρτήσεις (functions) και δομοστοιχεία (modules) στην Python Εισαγωγή στον Προγραμματισμό Python Μάθημα 4: Συναρτήσεις (functions) και δομοστοιχεία (modules) στην Python Νοέμβριος 2014 Χ. Αλεξανδράκη, Γ. Δημητρακάκης Συναρτήσεις (Functions) Στον προγραμματισμό,

Διαβάστε περισσότερα

Γλώσσες Προγραμματισμού Μεταγλωττιστές

Γλώσσες Προγραμματισμού Μεταγλωττιστές Γλώσσες Προγραμματισμού Μεταγλωττιστές Πανεπιστήμιο Μακεδονίας Τμήμα Εφαρμοσμένης Πληροφορικής Ηλίας Σακελλαρίου Δομή Γλώσσες Προγραμματισμού Εισαγωγικά Γλώσσα Μηχανής Γλώσσες υψηλού επιπέδου Μεταγλωττιστές

Διαβάστε περισσότερα

Εισαγωγή στον Προγραμματισμό

Εισαγωγή στον Προγραμματισμό Εισαγωγή στον Προγραμματισμό Εισαγωγή Δημήτρης Μιχαήλ Τμήμα Πληροφορικής και Τηλεματικής Χαροκόπειο Πανεπιστήμιο Ακ. Έτος 2012-2013 Βιβλιογραφία "C Προγραμματισμός", Deitel & Deitel, Πέμπτη Έκδοση, Εκδόσεις

Διαβάστε περισσότερα

Βιβλιοθήκη&ΚέντροΠληροφόρησης,ΠανεπιστήμιοΠατρών

Βιβλιοθήκη&ΚέντροΠληροφόρησης,ΠανεπιστήμιοΠατρών Εγχειρίδιο Χρήσης Βιβλιοθήκη&ΚέντροΠληροφόρησης,ΠανεπιστήμιοΠατρών ΛογισμικόΔιαχείρισηςΒιβλιογραφικώνΑναφορών Εισαγωγήβιβλιογραφικώνεγγραφών απόβάσειςδεδομένων ΤοRefWorksπαρέχεταιαπότηνΚεντρικήΒιβλιοθήκητουΔημοκρίτειου

Διαβάστε περισσότερα

ΜΕΘΟΔΟΛΟΓΙΑ ΑΝΑΠΤΥΞΗΣ ΕΜΠΟΡΙΚΩΝ ΕΦΑΡΜΟΓΩΝ

ΜΕΘΟΔΟΛΟΓΙΑ ΑΝΑΠΤΥΞΗΣ ΕΜΠΟΡΙΚΩΝ ΕΦΑΡΜΟΓΩΝ Μεθοδολογία Ανάπτυξης Εμπορικών Εφαρμογών 1 ΜΕΘΟΔΟΛΟΓΙΑ ΑΝΑΠΤΥΞΗΣ ΕΜΠΟΡΙΚΩΝ ΕΦΑΡΜΟΓΩΝ Η μεθοδολογία ανάπτυξης μιας εμπορικής εφαρμογής δίνει την δυνατότητα στην ομάδα εργασίας να έχει τον πλήρη έλεγχο

Διαβάστε περισσότερα

Η Γλώσσα Προγραµµατισµού C++ (The C++ Programming Language) Ιστοσελίδα του µαθήµατος. Περιεχόµενα. ηµήτριος Κατσαρός, Ph.D. Κλάσεις.

Η Γλώσσα Προγραµµατισµού C++ (The C++ Programming Language) Ιστοσελίδα του µαθήµατος. Περιεχόµενα. ηµήτριος Κατσαρός, Ph.D. Κλάσεις. 1 Η Γλώσσα Προγραµµατισµού C++ (The C++ Programming Language) ηµήτριος Κατσαρός, Ph.D. Χειµώνας 2005 ιάλεξη 5η Ιστοσελίδα του µαθήµατος 2 http://skyblue.csd.auth.gr/~dimitris/courses/cpp_fall05.htm Θα

Διαβάστε περισσότερα

Μια «ανώδυνη» εισαγωγή στο μάθημα (και στο MATLAB )

Μια «ανώδυνη» εισαγωγή στο μάθημα (και στο MATLAB ) Μια «ανώδυνη» εισαγωγή στο μάθημα (και στο MATLAB ) Μια πρώτη ιδέα για το μάθημα χωρίς καθόλου εξισώσεις!!! Περίγραμμα του μαθήματος χωρίς καθόλου εξισώσεις!!! Παραδείγματα από πραγματικές εφαρμογές ==

Διαβάστε περισσότερα

ΕΡΓΑΣΤΗΡΙΑΚΗ ΑΣΚΗΣΗ 2 ΑΝΑΖΗΤΗΣΗ ΠΛΗΡΟΦΟΡΙΑΣ ΣΕ ΒΙΟΛΟΓΙΚΕΣ ΒΑΣΕΙΣ ΔΕΔΟΜΕΝΩΝ

ΕΡΓΑΣΤΗΡΙΑΚΗ ΑΣΚΗΣΗ 2 ΑΝΑΖΗΤΗΣΗ ΠΛΗΡΟΦΟΡΙΑΣ ΣΕ ΒΙΟΛΟΓΙΚΕΣ ΒΑΣΕΙΣ ΔΕΔΟΜΕΝΩΝ ΕΡΓΑΣΤΗΡΙΑΚΗ ΑΣΚΗΣΗ 2 ΑΝΑΖΗΤΗΣΗ ΠΛΗΡΟΦΟΡΙΑΣ ΣΕ ΒΙΟΛΟΓΙΚΕΣ ΒΑΣΕΙΣ ΔΕΔΟΜΕΝΩΝ Α. Εισαγωγικά Στοιχεία Βιολογίας 1. DNA (Δεοξυριβονουκλεϊκό Οξύ) Φορέας γενετικής πληροφορίας Το DNA είναι ένα επίμηκες μόριο

Διαβάστε περισσότερα

ΚΕΦΑΛΑΙΟ 2: Τύποι δεδομένων και εμφάνιση στοιχείων...33

ΚΕΦΑΛΑΙΟ 2: Τύποι δεδομένων και εμφάνιση στοιχείων...33 ΠΕΡΙΕΧΟΜΕΝΑ Πρόλογος του συγγραφέα... 13 Πρόλογος του καθηγητή Τιμολέοντα Σελλή... 15 ΚΕΦΑΛΑΙΟ 1: Εργαλεία γλωσσών προγραμματισμού...17 1.1 Γλώσσες προγραμματισμού τρίτης γεννεάς... 18 τι είναι η γλώσσα

Διαβάστε περισσότερα

Η γλώσσα προγραμματισμού C

Η γλώσσα προγραμματισμού C Η γλώσσα προγραμματισμού C Εισαγωγή στη C Λίγα λόγια για την C Γλώσσα προγραμματισμού υψηλού επιπέδου. Σχεδιάστηκε και υλοποιήθηκε από τον Dennis Richie στις αρχές της δεκαετίας του 1970 (Bell Labs). Η

Διαβάστε περισσότερα

ΠΡΟΓΡΑΜΜΑΤΙΣΜΟΣ Η/Υ. Εισαγωγή στην FORTRAN. Δρ. Ιωάννης Λυχναρόπουλος 2014-2015

ΠΡΟΓΡΑΜΜΑΤΙΣΜΟΣ Η/Υ. Εισαγωγή στην FORTRAN. Δρ. Ιωάννης Λυχναρόπουλος 2014-2015 ΠΡΟΓΡΑΜΜΑΤΙΣΜΟΣ Η/Υ Εισαγωγή στην FORTRAN Δρ. Ιωάννης Λυχναρόπουλος 2014-2015 Fortran FORmula TRANslation: (Μία από τις πρώτες γλώσσες τρίτης γενιάς) Εκδόσεις FORTRAN (1957) FORTRAN II (1958) FORTRAN III

Διαβάστε περισσότερα

«Μηχανή Αναζήτησης Αρχείων» Ημερομηνία Παράδοσης: 30/04/2015, 09:00 π.μ.

«Μηχανή Αναζήτησης Αρχείων» Ημερομηνία Παράδοσης: 30/04/2015, 09:00 π.μ. ΕΡΓΑΣΙΑ 4 «Μηχανή Αναζήτησης Αρχείων» Ημερομηνία Παράδοσης: 30/04/2015, 09:00 π.μ. Στόχος Στόχος της Εργασίας 4 είναι να η εξοικείωση με την αντικειμενοστρέφεια (object oriented programming). Πιο συγκεκριμένα,

Διαβάστε περισσότερα

Αποθηκευμένες Διαδικασίες Stored Routines (Procedures & Functions)

Αποθηκευμένες Διαδικασίες Stored Routines (Procedures & Functions) Αποθηκευμένες Διαδικασίες Stored Routines (Procedures & Functions) Αυγερινός Αραμπατζής avi@ee.duth.gr www.aviarampatzis.com Βάσεις Δεδομένων Stored Procedures 1 Stored Routines (1/2) Τμήματα κώδικα τα

Διαβάστε περισσότερα

Εισαγωγή στους Η/Υ και τις Εφαρμογές Ενότητα 5: Επεξεργασία δεδομένων με τη γλώσσα προγραμματισμού python Υπο-ενότητα 5.

Εισαγωγή στους Η/Υ και τις Εφαρμογές Ενότητα 5: Επεξεργασία δεδομένων με τη γλώσσα προγραμματισμού python Υπο-ενότητα 5. Εισαγωγή στους Η/Υ και τις Εφαρμογές Ενότητα 5: Επεξεργασία δεδομένων με τη γλώσσα προγραμματισμού python Υπο-ενότητα 5.1: Λίστες Μανώλης Τζαγκαράκης, Βικτωρία Δασκάλου Σχολή Οργάνωσης και Διοίκησης Επιχειρήσεων

Διαβάστε περισσότερα

ΑΛΓΟΡΙΘΜΟΙ. Τι είναι αλγόριθμος

ΑΛΓΟΡΙΘΜΟΙ. Τι είναι αλγόριθμος ΑΛΓΟΡΙΘΜΟΙ Στο σηµείωµα αυτό αρχικά εξηγείται η έννοια αλγόριθµος και παραθέτονται τα σπουδαιότερα κριτήρια που πρέπει να πληρεί κάθε αλγόριθµος. Στη συνέχεια, η σπουδαιότητα των αλγορίθµων συνδυάζεται

Διαβάστε περισσότερα

Πληροφοριακά Συστήµατα

Πληροφοριακά Συστήµατα Nell Dale John Lewis Chapter 12 Πληροφοριακά Συστήµατα Στόχοι Ενότητας Η κατανόηση της έννοιας «Πληροφοριακό Σύστηµα» Επεξήγηση της οργάνωσης λογιστικών φύλλων (spreadsheets) Επεξήγηση της ανάλυσης δεδοµένων

Διαβάστε περισσότερα

Cloud Computing with Google and Microsoft. Despoina Trikomitou Andreas Diavastos Class: EPL425

Cloud Computing with Google and Microsoft. Despoina Trikomitou Andreas Diavastos Class: EPL425 Cloud Computing with Google and Microsoft Despoina Trikomitou Andreas Diavastos Class: EPL425 Σχεδιάγραμμα Εισαγωγή Τεχνολογίες Cloud Computing Περιγραφή Εργασίας Επιτεύγματα Εργασίας Συμπεράσματα Cloud

Διαβάστε περισσότερα

ΔΙΔΑΚΤΙΚΗ της ΠΛΗΡΟΦΟΡΙΚΗΣ

ΔΙΔΑΚΤΙΚΗ της ΠΛΗΡΟΦΟΡΙΚΗΣ ΕΘΝΙΚΟ ΚΑΙ ΚΑΠΟΔΙΣΤΡΙΑΚΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΑΘΗΝΩΝ ΤΜΗΜΑ ΠΛΗΡΟΦΟΡΙΚΗΣ & ΤΗΛΕΠΙΚΟΙΝΩΝΙΩΝ ΔΙΔΑΚΤΙΚΗ της ΠΛΗΡΟΦΟΡΙΚΗΣ Μ. Γρηγοριάδου Ρ. Γόγουλου Ενότητα: Η Διδασκαλία του Προγραμματισμού Περιεχόμενα Παρουσίασης

Διαβάστε περισσότερα

Αρχές Τεχνολογίας Λογισμικού Εργαστήριο

Αρχές Τεχνολογίας Λογισμικού Εργαστήριο Αρχές Τεχνολογίας Λογισμικού Εργαστήριο Κωδικός Μαθήματος: TP323 Ώρες Εργαστηρίου: 2/εβδομάδα (Διαφάνειες Νίκου Βιδάκη) 1 JAVA Inheritance Εβδομάδα Νο. 3 2 Προηγούμενο μάθημα (1/2) Τι είναι αντικείμενο?

Διαβάστε περισσότερα

ΚΑΤΑΝΟΜΗ ΜΑΘΗΜΑΤΩΝ ΣΤΑ ΕΞΑΜΗΝΑ

ΚΑΤΑΝΟΜΗ ΜΑΘΗΜΑΤΩΝ ΣΤΑ ΕΞΑΜΗΝΑ ΚΑΤΑΝΟΜΗ ΜΑΘΗΜΑΤΩΝ ΣΤΑ ΕΞΑΜΗΝΑ Θ = ΘΕΩΡΙΑ Ε = ΕΡΓΑΣΤΗΡΙΟ Σ = ΣΥΝΟΛΟ ΔΜ = ΔΙΔΑΚΤΙΚΕΣ ΜΟΝΑΔΕΣ ECTS = ΠΙΣΤΩΤΙΚΕΣ ΜΟΝΑΔΕΣ 1 ο ΕΞΑΜΗΝΟ Α ΕΤΟΣ 1ΚΠ01 Μαθηματική Ανάλυση Ι 4 1 5 5 5 1ΚΠ02 Γραμμική Άλγεβρα 4 5

Διαβάστε περισσότερα

Μεταγλωττιστής. Μεταφραστές. Γλώσσες. Είδη Μεταγλωττιστών. Μεταγλωττιστής Τελικό πρόγραµµα (object program) Εισαγωγή Αρχικό πρόγραµµα (source program)

Μεταγλωττιστής. Μεταφραστές. Γλώσσες. Είδη Μεταγλωττιστών. Μεταγλωττιστής Τελικό πρόγραµµα (object program) Εισαγωγή Αρχικό πρόγραµµα (source program) Μεταφραστές Εισαγωγή (source program) Τελικό πρόγραµµα (object program) Γιώργος Μανής Γλώσσες Είδη Μεταγλωττιστών Αρχική γλώσσα Γλώσσα υλοποίησης Τελική γλώσσα Απλοί µεταγλωττιστές Αντίστροφοι µεταγλωττιστές

Διαβάστε περισσότερα

Χρησιμοποίηση Open Source προγραμμάτων σε εργασιακό περιβάλλον

Χρησιμοποίηση Open Source προγραμμάτων σε εργασιακό περιβάλλον Χρησιμοποίηση Open Source προγραμμάτων σε εργασιακό περιβάλλον (OpenOffice ver.3.0 & other freeware utilities) Τρόποι μείωσης κόστους αδειών χρήσης (licensing) Συμβατότητα με υπάρχουσες εφαρμογές Πλεονεκτήματα

Διαβάστε περισσότερα

Εισαγωγή στους Ηλεκτρονικούς Υπολογιστές

Εισαγωγή στους Ηλεκτρονικούς Υπολογιστές Εισαγωγή στους Ηλεκτρονικούς Υπολογιστές Εισαγωγή στον επιστημονικό προγραμματισμό 1 ο Μάθημα Λεωνίδας Αλεξόπουλος Λέκτορας ΕΜΠ E-mail: leo@mail.ntua.gr URL: http://users.ntua.gr/leo 1 Εισαγωγή στo MatLab

Διαβάστε περισσότερα

BibConvert μετατροπές LOM

BibConvert μετατροπές LOM BibConvert μετατροπές LOM Δημοσθένης Νικούδης Μονάδα Αριστείας ΕΛ/ΛΑΚ ΤΕΙ Αθήνας BibConvert 2 Μετατρέπει μεταδεδομένα από άλλες μορφές σε MARC21 (ή πιο σωστά MARCXML) Command-line tool Δεν έχει web interface

Διαβάστε περισσότερα

Μαθησιακά Αντικείμενα

Μαθησιακά Αντικείμενα Μαθησιακά Αντικείμενα Κλειώ Σγουροπούλου Μονάδα Αριστείας ΕΛ/ΛΑΚ ΤΕΙ Αθήνας Περιεχόμενα 2 Μαθησιακά Αντικείμενα: Ανοικτοί Εκπαιδευτικοί Πόροι (ΑΕΠ) Open Educational Resources, δεδομένα, μεταδεδομένα, πρότυπα

Διαβάστε περισσότερα

Εισαγωγή στο Περιβάλλον Επιστημονικού Προγραμματισμού MATLAB-Simulink. Δημήτριος Τζεράνης Λεωνίδας Αλεξόπουλος

Εισαγωγή στο Περιβάλλον Επιστημονικού Προγραμματισμού MATLAB-Simulink. Δημήτριος Τζεράνης Λεωνίδας Αλεξόπουλος Εισαγωγή στο Περιβάλλον Επιστημονικού Προγραμματισμού MATLAB-Simulink Δημήτριος Τζεράνης Λεωνίδας Αλεξόπουλος 1 Τι είναι τα Matlab και Simulink? Το Matlab (MATrix LABoratory) είναι ένα περιβάλλον επιστημονικού

Διαβάστε περισσότερα

ΔΕ10: Πληροφοριακά Συστήματα Διοίκησης IΙ Εργαστήριο # 2

ΔΕ10: Πληροφοριακά Συστήματα Διοίκησης IΙ Εργαστήριο # 2 ΔΕ10: Πληροφοριακά Συστήματα Διοίκησης IΙ Εργαστήριο # 2 Dreamweaver 1/7 Εισαγωγή Το Dreamweaver είναι ένας HTML editor που αναπτύχθηκε από την Macromedia. Είναι WYSIWYG (What You See Is What You Get),

Διαβάστε περισσότερα

Πανεπιστήμιο Δυτικής Μακεδονίας. Τμήμα Μηχανικών Πληροφορικής & Τηλεπικοινωνιών. Βιοπληροφορική

Πανεπιστήμιο Δυτικής Μακεδονίας. Τμήμα Μηχανικών Πληροφορικής & Τηλεπικοινωνιών. Βιοπληροφορική Τμήμα Μηχανικών Πληροφορικής & Τηλεπικοινωνιών Βιοπληροφορική Ενότητα 3: Ηλεκτρονική διαχείριση βιολογικών δεδομένων Αν. καθηγητής Αγγελίδης Παντελής e-mail: paggelidis@uowm.gr ΕΕΔΙΠ Μπέλλου Σοφία e-mail:

Διαβάστε περισσότερα

Εφαρµογές WebGIS Open Source

Εφαρµογές WebGIS Open Source Εφαρµογές WebGIS Open Source Πάνος Βουδούρης Περιεχόµενα Βασικές Έννοιες Open Source Γιατί; Πως; WebGIS Αρχιτεκτονική Παραδείγµατα εφαρµογών GeoServer GeoMajas MapServer + OpenLayers MapServer + SLMapviewer

Διαβάστε περισσότερα

ΕΙΣΑΓΩΓΗ ΣΤΟΥΣ ΑΛΓΟΡΙΘΜΟΥΣ ΚΑΙ ΣΤΟΝ ΠΡΟΓΡΑΜΜΑΤΙΣΜΟ

ΕΙΣΑΓΩΓΗ ΣΤΟΥΣ ΑΛΓΟΡΙΘΜΟΥΣ ΚΑΙ ΣΤΟΝ ΠΡΟΓΡΑΜΜΑΤΙΣΜΟ ΕΙΣΑΓΩΓΗ ΣΤΟΥΣ ΑΛΓΟΡΙΘΜΟΥΣ ΚΑΙ ΣΤΟΝ ΠΡΟΓΡΑΜΜΑΤΙΣΜΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΑΙΓΑΙΟΥ ΤΜΗΜΑ ΠΟΛΙΤΙΣΜΙΚΗΣ ΤΕΧΝΟΛΟΓΙΑΣ ΚΑΙ ΕΠΙΚΟΙΝΩΝΙΑΣ Διδάσκουσα Δρ Β Καβακλή Χειμερινό Εξάμηνο 2001 Στόχοι του Μαθήματος! Ανάπτυξη αναλυτικής

Διαβάστε περισσότερα

ΑΡΧΕΣ ΠΡΟΓΡΑΜΜΑΤΙΣΜΟΥ

ΑΡΧΕΣ ΠΡΟΓΡΑΜΜΑΤΙΣΜΟΥ ΑΡΧΕΣ ΠΡΟΓΡΑΜΜΑΤΙΣΜΟΥ Κεφάλαιο 2 Επιμέλεια: Βασίλης Παλιουράς, Αναπληρωτής Καθηγητής Ευάγγελος Δερματάς, Αναπληρωτής Καθηγητής Σταύρος Νούσιας, Βοηθός Ερευνητή Πολυτεχνική Σχολή Τμήμα Ηλεκτρολόγων Μηχανικών

Διαβάστε περισσότερα

Κεφάλαιο 2: Μεταφραστές

Κεφάλαιο 2: Μεταφραστές Κεφάλαιο 2: Μεταφραστές Αρχές Γλωσσών και Προγραμματισμού Λειτουργία Μετάφρασης ΑΡΧΙΚΗ ΓΛΩΣΣΑ (Source) L A ΓΛΩΣΣΑ ΥΛΟΠΟΙΗΣΗΣ ΜΕΤΑΦΡΑΣΤΗ (Implementation) L Y ΤΕΛΙΚΗ ΓΛΩΣΣΑ (Target) L T Αρχικό Πρόγραμμα

Διαβάστε περισσότερα

Εισαγωγή στους Ηλεκτρονικούς Υπολογιστές

Εισαγωγή στους Ηλεκτρονικούς Υπολογιστές Εισαγωγή στους Ηλεκτρονικούς Υπολογιστές 1 ο Εξάμηνο Σπουδών Χειμερινό Εξάμηνο 2012/13 Τμήμα Εφαρμοσμένων Μαθηματικών, Πανεπιστήμιο Κρήτης Διδάσκων: Χαρμανδάρης Ευάγγελος, email: vagelis@tem.uoc.gr, Ιστοσελίδα

Διαβάστε περισσότερα

1. ΕΙΣΑΓΩΓΗ ΣΤΟ MATLAB... 13

1. ΕΙΣΑΓΩΓΗ ΣΤΟ MATLAB... 13 ΠΙΝΑΚΑΣ ΠΕΡΙΕΧΟΜΕΝΩΝ 1. ΕΙΣΑΓΩΓΗ ΣΤΟ MATLAB... 13 1.1. Τι είναι το Matlab... 13 1.2. Περιβάλλον εργασίας... 14 1.3. Δουλεύοντας με το Matlab... 16 1.3.1. Απλές αριθμητικές πράξεις... 16 1.3.2. Σχόλια...

Διαβάστε περισσότερα

Κεφάλαιο 3.5-3.6, 3.2: Συναρτήσεις II. ( ιάλεξη 12) ιδάσκων: ηµήτρης Ζεϊναλιπούρ

Κεφάλαιο 3.5-3.6, 3.2: Συναρτήσεις II. ( ιάλεξη 12) ιδάσκων: ηµήτρης Ζεϊναλιπούρ Κεφάλαιο 3.5-3.6, 3.2: Συναρτήσεις II ( ιάλεξη 12) ιδάσκων: ηµήτρης Ζεϊναλιπούρ 12-1 Ανασκόπηση οµής Προγράµµατος µε Συναρτήσεις #include 1 void PrintMessage (); Πρότυπο ( ήλωση) Συνάρτησης (

Διαβάστε περισσότερα

Μεταγλωττιστές. Δημήτρης Μιχαήλ. Ακ. Έτος 2011-2012. Εισαγωγή. Τμήμα Πληροφορικής και Τηλεματικής Χαροκόπειο Πανεπιστήμιο

Μεταγλωττιστές. Δημήτρης Μιχαήλ. Ακ. Έτος 2011-2012. Εισαγωγή. Τμήμα Πληροφορικής και Τηλεματικής Χαροκόπειο Πανεπιστήμιο Μεταγλωττιστές Εισαγωγή Δημήτρης Μιχαήλ Τμήμα Πληροφορικής και Τηλεματικής Χαροκόπειο Πανεπιστήμιο Ακ. Έτος 2011-2012 Βιβλιογραφία Alfred V. Aho, Monica S. Lam, Ravi Sethi and Jeffrey D. Ullman. Compilers:

Διαβάστε περισσότερα

Εργαστήριο #10 (Ε10) 1

Εργαστήριο #10 (Ε10) 1 Εργαστήριο #10 Από τα προηγούμενα εργαστήρια......θα χρειαστείτε ορισμένες από τις οδηγίες μορφοποίησης CSS (ανατρέξτε στις εκφωνήσεις του 8 ου και 9 ου εργαστηρίου).! Οδηγίες Στη δυναμική δημιουργία ιστοσελίδων

Διαβάστε περισσότερα

Μάθηµα 3. Τµήµα Αρχειονοµίας - Βιβλιοθηκονοµίας

Μάθηµα 3. Τµήµα Αρχειονοµίας - Βιβλιοθηκονοµίας Μάθηµα 3 45 Ολοκληρωµένα Συστήµατα Βιβλιοθηκών Η έννοια του «Ολοκληρωµένου» Συστατικά (modules)( Καταλογογράφηση Προσκτήσεις ανεισµός ιαχείριση Περιοδικών ηµόσιος Κατάλογος (OPAC( OPAC-On-line Public Access

Διαβάστε περισσότερα

Εισαγωγή στην Python. Διάλεξη 0

Εισαγωγή στην Python. Διάλεξη 0 Εισαγωγή στην Python Διάλεξη 0 Διοργάνωση : ΚΕΛ ΣΑΤΜ Διαφάνειες: Skaros, MadAGu Παρουσίαση: MadAGu Άδεια: Creative Commons 3.0 Τι είναι ο προγραμματισμός : Αλγόριθμος γραμμένος σε γλώσσα που καταλαβαίνει

Διαβάστε περισσότερα

ΑΝΑΖΗΤΗΣΗ ΟΜΟΙΟΤΗΤΩΝ ΣΕ ΒΑΣΕΙΣ Ε ΟΜΕΝΩΝ ΑΚΟΛΟΥΘΙΩΝ

ΑΝΑΖΗΤΗΣΗ ΟΜΟΙΟΤΗΤΩΝ ΣΕ ΒΑΣΕΙΣ Ε ΟΜΕΝΩΝ ΑΚΟΛΟΥΘΙΩΝ Αναζήτηση οµοιοτήτων ΑΝΑΖΗΤΗΣΗ ΟΜΟΙΟΤΗΤΩΝ ΣΕ ΒΑΣΕΙΣ Ε ΟΜΕΝΩΝ ΑΚΟΛΟΥΘΙΩΝ Σελίδα 1 εδοµένα Ακολουθία επερώτησης (query sequence) Ακολουθίες στη Βάση εδοµένων (subject sequences) Αναζήτηση Μέθοδοι δυναµικού

Διαβάστε περισσότερα

ΠΕΡΙΕΧΟΜΕΝΑ. Κεφάλαιο 1. Κεφάλαιο 2. Κεφάλαιο 3

ΠΕΡΙΕΧΟΜΕΝΑ. Κεφάλαιο 1. Κεφάλαιο 2. Κεφάλαιο 3 ΠΕΡΙΕΧΟΜΕΝΑ Κεφάλαιο 1 ΕΙΣΑΓΩΓΗ... 17 ΓΕΝΙΚΑ... 19 ΠΕΡΙΓΡΑΦΗ ΣΥΣΤΗΜΑΤΟΣ ΠΑΡΑΓΩΓΗΣ... 19 ΕΙΔΗ ΕΠΙΧΕΙΡΗΜΑΤΙΚΩΝ ΑΠΟΦΑΣΕΩΝ... 21 ΕΙΔΗ ΑΠΟΦΑΣΕΩΝ ΓΙΑ ΤΗ ΔΙΟΙΚΗΣΗ ΠΑΡΑΓΩΓΗΣ... 22 ΟΙ ΒΑΣΙΚΕΣ ΛΕΙΤΟΥΡΓΙΕΣ ΣΕ ΜΙΑ

Διαβάστε περισσότερα

Γενικά Στοιχεία Ηλεκτρονικού Υπολογιστή

Γενικά Στοιχεία Ηλεκτρονικού Υπολογιστή Γενικά Στοιχεία Ηλεκτρονικού Υπολογιστή 1. Ηλεκτρονικός Υπολογιστής Ο Ηλεκτρονικός Υπολογιστής είναι μια συσκευή, μεγάλη ή μικρή, που επεξεργάζεται δεδομένα και εκτελεί την εργασία του σύμφωνα με τα παρακάτω

Διαβάστε περισσότερα

ΕΙΣΑΓΩΓΗ ΣΤΟΥΣ ΑΛΓΟΡΙΘΜΟΥΣ ΚΑΙ ΣΤΟΝ ΠΡΟΓΡΑΜΜΑΤΙΣΜΟ

ΕΙΣΑΓΩΓΗ ΣΤΟΥΣ ΑΛΓΟΡΙΘΜΟΥΣ ΚΑΙ ΣΤΟΝ ΠΡΟΓΡΑΜΜΑΤΙΣΜΟ ΕΙΣΑΓΩΓΗ ΣΤΟΥΣ ΑΛΓΟΡΙΘΜΟΥΣ ΚΑΙ ΣΤΟΝ ΠΡΟΓΡΑΜΜΑΤΙΣΜΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΑΙΓΑΙΟΥ ΤΜΗΜΑ ΠΟΛΙΤΙΣΜΙΚΗΣ ΤΕΧΝΟΛΟΓΙΑΣ ΚΑΙ ΕΠΙΚΟΙΝΩΝΙΑΣ Διδάσκουσα Δρ Β. Καβακλή Χειμερινό Εξάμηνο 2001 1 Δοκιμή Έλεγχος Αλγορίθμου Για να

Διαβάστε περισσότερα

Χαράλαμπος Καραγιαννίδης

Χαράλαμπος Καραγιαννίδης Διάλεξη 4 Λειτουργικό Σύστημα & Λογισμικό Εφαρμογών H/Y Εισαγωγή στις Εφαρμογές ΤΠΕ Χαράλαμπος Καραγιαννίδης karagian@uth.gr Διάλεξη 4: Λειτουργικό Σύστημα & Εφαρμογές 1/41 20/10/2015 Σύνοψη Μαθήματος

Διαβάστε περισσότερα

Λειτουργικά Συστήματα (ΙΙ) (διαχείριση αρχείων)

Λειτουργικά Συστήματα (ΙΙ) (διαχείριση αρχείων) Ιόνιο Πανεπιστήμιο Τμήμα Πληροφορικής Εισαγωγή στην Επιστήμη των Υπολογιστών 2015-16 Λειτουργικά Συστήματα (ΙΙ) (διαχείριση αρχείων) http://di.ionio.gr/~mistral/tp/csintro/ Μ.Στεφανιδάκης Λειτουργικό Σύστημα:

Διαβάστε περισσότερα

ΠΕΡΙΕΧΟΜΕΝΑ ΜΕΡΟΣ Α : ΘΕΜΑΤΑ ΒΑΣΗΣ 1. ΕΙΣΑΓΩΓΗ ΣΤΗΝ ΠΛΗΡΟΦΟΡΙΚΗ...11 2. ΑΡΙΘΜΗΤΙΚΑ ΣΥΣΤΗΜΑΤΑ...30

ΠΕΡΙΕΧΟΜΕΝΑ ΜΕΡΟΣ Α : ΘΕΜΑΤΑ ΒΑΣΗΣ 1. ΕΙΣΑΓΩΓΗ ΣΤΗΝ ΠΛΗΡΟΦΟΡΙΚΗ...11 2. ΑΡΙΘΜΗΤΙΚΑ ΣΥΣΤΗΜΑΤΑ...30 ΠΕΡΙΕΧΟΜΕΝΑ ΜΕΡΟΣ Α : ΘΕΜΑΤΑ ΒΑΣΗΣ 1. ΕΙΣΑΓΩΓΗ ΣΤΗΝ ΠΛΗΡΟΦΟΡΙΚΗ...11 1.1 Τι είναι Πληροφορική;...11 1.1.1 Τι είναι η Πληροφορική;...12 1.1.2 Τι είναι ο Υπολογιστής;...14 1.1.3 Τι είναι το Υλικό και το

Διαβάστε περισσότερα

Ευκαιρίες και προϋποθέσεις για τον κλάδο ΤΠΕ στο Ανοικτό Λογισμικό. Δρ. Βασίλης Χρηστίδης Διευθύνων Σύμβουλος Knowledge Broadband Services AE

Ευκαιρίες και προϋποθέσεις για τον κλάδο ΤΠΕ στο Ανοικτό Λογισμικό. Δρ. Βασίλης Χρηστίδης Διευθύνων Σύμβουλος Knowledge Broadband Services AE Ευκαιρίες και προϋποθέσεις για τον κλάδο ΤΠΕ στο Ανοικτό Λογισμικό Δρ. Βασίλης Χρηστίδης Διευθύνων Σύμβουλος Knowledge Broadband Services AE Knowledge Broadband Services AE Επιλογή : Έδρα στην Περιφέρεια

Διαβάστε περισσότερα

Α ΕΞΑΜΗΝΟ. 1. Μοριακή Βιολογία και Γονιδιωµατική

Α ΕΞΑΜΗΝΟ. 1. Μοριακή Βιολογία και Γονιδιωµατική Α ΕΞΑΜΗΝΟ 1. Μοριακή Βιολογία και Γονιδιωµατική ιδάσκοντες: Γ. Ροδάκης Γ. ιαλλινάς Γ. Γουλιέλµος Α. Κατσιώτης Μοριακά συστατικά οργανισµών. Γονιδίωµα, γονίδια. DNA, RNA, πρωτείνες. Μετάδοση της γενετικής

Διαβάστε περισσότερα

Δομές Δεδομένων Εργαστηριακή Άσκηση 2012-2013. Γκόγκος Νίκος Α.Μ.: 4973 Έτος: 3 ο Email: gkogkos@ceid.upatras.gr. Εισαγωγικά:

Δομές Δεδομένων Εργαστηριακή Άσκηση 2012-2013. Γκόγκος Νίκος Α.Μ.: 4973 Έτος: 3 ο Email: gkogkos@ceid.upatras.gr. Εισαγωγικά: Δομές Δεδομένων Εργαστηριακή Άσκηση 2012-2013 Γκόγκος Νίκος Α.Μ.: 4973 Έτος: 3 ο Email: gkogkos@ceid.upatras.gr Εισαγωγικά: Η υλοποίηση του project έχει γίνει σε python [2.7]. Τα python modules είναι αυτόνομα

Διαβάστε περισσότερα

Κλέτσας Αλέξανδρος Τεχνικός ΚΕ.ΠΛΗ.ΝΕ.Τ. Σερρών 24/10/2014 ΚΕ.ΠΛΗ.ΝΕ.Τ. ΣΕΡΡΩΝ 1

Κλέτσας Αλέξανδρος Τεχνικός ΚΕ.ΠΛΗ.ΝΕ.Τ. Σερρών 24/10/2014 ΚΕ.ΠΛΗ.ΝΕ.Τ. ΣΕΡΡΩΝ 1 Κλέτσας Αλέξανδρος Τεχνικός ΚΕ.ΠΛΗ.ΝΕ.Τ. Σερρών 24/10/2014 ΚΕ.ΠΛΗ.ΝΕ.Τ. ΣΕΡΡΩΝ 1 Το Joomla! είναι λογισμικό ανοικτού κώδικα (open source) το οποίο υλοποιεί τη λειτουργικότητα Συστήματος Διαχείρισης Περιεχομένου

Διαβάστε περισσότερα

ΤΕΧΝΙΚΕΣ ΑΝΤΙΚΕΙΜΕΝΟΣΤΡΑΦΟΥΣ ΠΡΟΓΡΑΜΜΑΤΙΣΜΟΥ. Εισαγωγή στη Java III

ΤΕΧΝΙΚΕΣ ΑΝΤΙΚΕΙΜΕΝΟΣΤΡΑΦΟΥΣ ΠΡΟΓΡΑΜΜΑΤΙΣΜΟΥ. Εισαγωγή στη Java III ΤΕΧΝΙΚΕΣ ΑΝΤΙΚΕΙΜΕΝΟΣΤΡΑΦΟΥΣ ΠΡΟΓΡΑΜΜΑΤΙΣΜΟΥ Εισαγωγή στη Java III Το if-else statement Το if-else statement δουλεύει καλά όταν στο condition θέλουμε να περιγράψουμε μια επιλογή με δύο πιθανά ενδεχόμενα.

Διαβάστε περισσότερα

Εργαστήριο Λειτουργικών Συστημάτων 8o εξάμηνο, Ροή Υ, ΗΜΜΥ

Εργαστήριο Λειτουργικών Συστημάτων 8o εξάμηνο, Ροή Υ, ΗΜΜΥ ΕΘΝΙΚΟ ΜΕΤΣΟΒΙΟ ΠΟΛΥΤΕΧΝΕΙΟ Σχολή Ηλεκτρολόγων Μηχανικών και Μηχανικών Υπολογιστών Εργαστήριο Λειτουργικών Συστημάτων 8o εξάμηνο, Ροή Υ, ΗΜΜΥ Σχεδιασμός και υλοποίηση υποδομής σημείωσης διεργασιών στον

Διαβάστε περισσότερα

ΕΠΛ031 - Εισαγωγή στον Προγραμματισμό

ΕΠΛ031 - Εισαγωγή στον Προγραμματισμό Εισαγωγή στην Fortran ΕΠΛ031 Εισαγωγή στον Προγραμματισμό Νέαρχος Πασπαλλής Επισκέπτης Ακαδημαϊκός (Λέκτορας) nearchos@cs.ucy.ac.cy Γραφείο #B120, Τηλ. ext. 2744 FORTRAN: Ιστορική Αναδρομή 1954 1957, πρώτος

Διαβάστε περισσότερα

ΕΙΣΑΓΩΓΗ ΣΤΟΥΣ ΑΛΓΟΡΙΘΜΟΥΣ ΚΑΙ ΣΤΟΝ ΠΡΟΓΡΑΜΜΑΤΙΣΜΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΑΙΓΑΙΟΥ ΤΜΗΜΑ ΠΟΛΙΤΙΣΜΙΚΗΣ ΤΕΧΝΟΛΟΓΙΑΣ ΚΑΙ ΕΠΙΚΟΙΝΩΝΙΑΣ. Διδάσκουσα Δρ Β.

ΕΙΣΑΓΩΓΗ ΣΤΟΥΣ ΑΛΓΟΡΙΘΜΟΥΣ ΚΑΙ ΣΤΟΝ ΠΡΟΓΡΑΜΜΑΤΙΣΜΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΑΙΓΑΙΟΥ ΤΜΗΜΑ ΠΟΛΙΤΙΣΜΙΚΗΣ ΤΕΧΝΟΛΟΓΙΑΣ ΚΑΙ ΕΠΙΚΟΙΝΩΝΙΑΣ. Διδάσκουσα Δρ Β. ΕΙΣΑΓΩΓΗ ΣΤΟΥΣ ΑΛΓΟΡΙΘΜΟΥΣ ΚΑΙ ΣΤΟΝ ΠΡΟΓΡΑΜΜΑΤΙΣΜΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΑΙΓΑΙΟΥ ΤΜΗΜΑ ΠΟΛΙΤΙΣΜΙΚΗΣ ΤΕΧΝΟΛΟΓΙΑΣ ΚΑΙ ΕΠΙΚΟΙΝΩΝΙΑΣ Διδάσκουσα Δρ Β. Καβακλή Χειμερινό Εξάμηνο 2001 1 Program cinema (input, output);

Διαβάστε περισσότερα

Συστήματα διαχείρισης περιεχομένου

Συστήματα διαχείρισης περιεχομένου Content Management Systems Συστήματα διαχείρισης περιεχομένου Συμεωνίδης Ευστάθιος BSc in Information Technology MSc in Information Systems MSc in Management Linked In: http://gr.linkedin.com/pub/stathis-simeonidis/24/217/92

Διαβάστε περισσότερα

ΠΑΝΕΠΙΣΤΗΜΙΟ ΚΥΠΡΟΥ ΤΜΗΜΑ ΒΙΟΛΟΓΙΚΩΝ ΕΠΙΣΤΗΜΩΝ

ΠΑΝΕΠΙΣΤΗΜΙΟ ΚΥΠΡΟΥ ΤΜΗΜΑ ΒΙΟΛΟΓΙΚΩΝ ΕΠΙΣΤΗΜΩΝ ΠΑΝΕΠΙΣΤΗΜΙΟ ΚΥΠΡΟΥ ΤΜΗΜΑ ΒΙΟΛΟΓΙΚΩΝ ΕΠΙΣΤΗΜΩΝ (ΒΙΟ 650) Ειδικά Θέματα Βιοπληροφορικής Διδάσκων: Βασίλειος Ι. Προμπονάς, Ph.D. Λέκτορας Βιοπληροφορικής ΓΕΝΙΚΕΣ ΠΛΗΡΟΦΟΡΙΕΣ Διαλέξεις Δευτέρα και Πέμπτη

Διαβάστε περισσότερα

Αρχιτεκτονική Υπολογιστών

Αρχιτεκτονική Υπολογιστών Τμήμα Μηχανικών Πληροφορικής & Τηλεπικοινωνιών Αρχιτεκτονική Υπολογιστών Ενότητα 13: Λειτουργίες Αρχείων Δρ. Μηνάς Δασυγένης mdasyg@ieee.org Εργαστήριο Ψηφιακών Συστημάτων και Αρχιτεκτονικής Υπολογιστών

Διαβάστε περισσότερα

Διαχείριση Δικτύων (ΕΠ 17) Εαρινό Εξάµηνο 2014-2015. Εργασία Εξαµήνου, Ηµεροµηνία Παράδοσης: Ηµέρα Εξέτασης Μαθήµατος (25/6/2015)

Διαχείριση Δικτύων (ΕΠ 17) Εαρινό Εξάµηνο 2014-2015. Εργασία Εξαµήνου, Ηµεροµηνία Παράδοσης: Ηµέρα Εξέτασης Μαθήµατος (25/6/2015) Διαχείριση Δικτύων (ΕΠ 17) Εαρινό Εξάµηνο 2014-2015 Εργασία Εξαµήνου, Ηµεροµηνία Παράδοσης: Ηµέρα Εξέτασης Μαθήµατος (25/6/2015) Οµαδική εργασία (2 ατόµων) Σε αυτή την εργασία καλείστε να υλοποιήσετε ένα

Διαβάστε περισσότερα

«ΕΙΔΙΚΑ ΘΕΜΑΤΑ ΕΚΠΑΙΔΕΥΣΗΣ ΜΕ ΧΡΗΣΗ ΝΕΩΝ ΤΕΧΝΟΛΟΓΙΩΝ» Εαρινό Εξάμηνο 2010

«ΕΙΔΙΚΑ ΘΕΜΑΤΑ ΕΚΠΑΙΔΕΥΣΗΣ ΜΕ ΧΡΗΣΗ ΝΕΩΝ ΤΕΧΝΟΛΟΓΙΩΝ» Εαρινό Εξάμηνο 2010 «ΕΙΔΙΚΑ ΘΕΜΑΤΑ ΕΚΠΑΙΔΕΥΣΗΣ ΜΕ ΧΡΗΣΗ ΝΕΩΝ ΤΕΧΝΟΛΟΓΙΩΝ» Εαρινό Εξάμηνο 2010 Απόστολος Κώστας Μέλος Ε.Τ.Ε.Π. Πληροφορικής, Υ.Δ. Π.Τ.Δ.Ε. Email: apkostas@aegean.gr Πρόγραμμα Μαθημάτων 1 ο - 18 Μαρ Αρχές Οργάνωσης

Διαβάστε περισσότερα

Λογισμική Εφαρμογή Διαχείρισης Ερωτηματολογίων ΟΔΗΓΟΣ ΧΡΗΣΗΣ System Συμβουλευτική Α.Ε

Λογισμική Εφαρμογή Διαχείρισης Ερωτηματολογίων ΟΔΗΓΟΣ ΧΡΗΣΗΣ System Συμβουλευτική Α.Ε σχετικά με τον έλεγχο της καπνιστικής συνήθειας 1 22 Λογισμικές εφαρμογές καταγραφής και αξιοποίησης πληροφοριών σχετικά με τον έλεγχο της καπνιστικής συνήθειας Λογισμική Εφαρμογή Διαχείρισης Ερωτηματολογίων

Διαβάστε περισσότερα

ΚΡΥΠΤΟΓΡΑΦΙΑ ΚΑΙ ΑΣΦΑΛΕΙΑ ΥΠΟΛΟΓΙΣΤΩΝ

ΚΡΥΠΤΟΓΡΑΦΙΑ ΚΑΙ ΑΣΦΑΛΕΙΑ ΥΠΟΛΟΓΙΣΤΩΝ ΚΡΥΠΤΟΓΡΑΦΙΑ ΚΑΙ ΑΣΦΑΛΕΙΑ ΥΠΟΛΟΓΙΣΤΩΝ Δ Εξάμηνο Συναρτήσεις Κατακερματισμού και Πιστοποίηση Μηνύματος Διδάσκων : Δρ. Παρασκευάς Κίτσος Επίκουρος Καθηγητής e-mail: pkitsos@teimes.gr, pkitsos@ieee.org Αντίρριο

Διαβάστε περισσότερα

Ολοκλήρωση - Μέθοδος Monte Carlo

Ολοκλήρωση - Μέθοδος Monte Carlo ΦΥΣ 145 - Διαλ.09 Ολοκλήρωση - Μέθοδος Monte Carlo Χρησιμοποίηση τυχαίων αριθμών για επίλυση ολοκληρωμάτων Η μέθοδος Monte Carlo δίνει μια διαφορετική προσέγγιση για την επίλυση ενός ολοκληρώμτατος Τυχαίοι

Διαβάστε περισσότερα

Μεταδεδομένα ψηφιακού περιεχομένου

Μεταδεδομένα ψηφιακού περιεχομένου Μεταδεδομένα ψηφιακού περιεχομένου Ελεύθερο λογισμικό και λογισμικό ανοιχτού κώδικα για τη δημιουργία ψηφιακών βιβλιοθηκών - αποθετηρίων Αλέξανδρος Ταγκούλης Αριστεία ΕΛ/ΛΑΚ ΤΕΙ Αθήνας 2 Μεταδεδομένα Δεδομένα

Διαβάστε περισσότερα

Τεκμηρίωση ποσοτικών ερευνών με τη χρήση του Nesstar. Δρ. Απόστολος Λιναρδής Ερευνητής ΕΚΚΕ

Τεκμηρίωση ποσοτικών ερευνών με τη χρήση του Nesstar. Δρ. Απόστολος Λιναρδής Ερευνητής ΕΚΚΕ Τεκμηρίωση ποσοτικών ερευνών με τη χρήση του Nesstar Δρ. Απόστολος Λιναρδής Ερευνητής ΕΚΚΕ Μέρος Α Τεκμηρίωση βάσει του προτύπου Data Documentation Initiative (DDI) 2.X Οι φάσεις διεξαγωγής μίας ποσοτικής

Διαβάστε περισσότερα

Κεφάλαιο 2 Βιολογικές Βάσεις Δεδομένων

Κεφάλαιο 2 Βιολογικές Βάσεις Δεδομένων Κεφάλαιο 2 Βιολογικές Βάσεις Δεδομένων Σύνοψη Στο κεφάλαιο αυτό, θα γίνει η απαραίτητη εισαγωγή στις βιολογικές βάσεις δεδομένων έτσι ώστε ο αναγνώστης να μπορεί, στα επόμενα κεφάλαια, να ανατρέχει στις

Διαβάστε περισσότερα

Using Custom Python Expression Functions

Using Custom Python Expression Functions Using Custom Python Expression Functions QGIS Tutorials and Tips Author Ujaval Gandhi http://google.com/+ujavalgandhi Translations by Christina Dimitriadou Paliogiannis Konstantinos Tom Karagkounis Despoina

Διαβάστε περισσότερα

Have some raspberries for a school snack

Have some raspberries for a school snack Have some raspberries for a school snack Συστατικά Κατανάλωση Δημιουργικότητα Βαρετή Δυσνόητη Απόμακρη Όλα τα παραπάνω Πρέπει να ξέρεις να χρησιμοποιείς Πρέπει να ξέρεις να χειρίζεσαι Πρέπει να ξέρεις

Διαβάστε περισσότερα

711 Πληροφορικής ΤΕΙ Αθήνας

711 Πληροφορικής ΤΕΙ Αθήνας 711 Πληροφορικής ΤΕΙ Αθήνας Το Τμήμα Πληροφορικής του ΤΕΙ Αθήνας ιδρύθηκε και δέχτηκε τους πρώτους του σπουδαστές τον Οκτώβριο του 1983, ταυτόχρονα δηλαδή με την έναρξη ισχύος του νόμου 1404/83 για τα

Διαβάστε περισσότερα

Εισαγωγή στον Προγραμματισμό

Εισαγωγή στον Προγραμματισμό Εισαγωγή στον Προγραμματισμό Ενότητα 1 - Εισαγωγή Χρήστος Γκουμόπουλος Πανεπιστήμιο Αιγαίου Τμήμα Μηχανικών Πληροφοριακών και Επικοινωνιακών Συστημάτων Στόχοι Μαθήματος H ανάπτυξη ικανοτήτων και η απόκτηση

Διαβάστε περισσότερα

ΛΕΙΤΟΥΡΓΙΚΑ ΣΥΣΤΗΜΑΤΑ. Διαχείριση μνήμης III

ΛΕΙΤΟΥΡΓΙΚΑ ΣΥΣΤΗΜΑΤΑ. Διαχείριση μνήμης III ΛΕΙΤΟΥΡΓΙΚΑ ΣΥΣΤΗΜΑΤΑ Διαχείριση μνήμης III Υλικό από: Tanenbaum, Modern Operating Systems,Structured Computer Organization Stallings, Operating Systems: Internals and Design Principles. Silberschatz,

Διαβάστε περισσότερα

Εργαστήριο Σημασιολογικού Ιστού

Εργαστήριο Σημασιολογικού Ιστού Εργαστήριο Σημασιολογικού Ιστού Ενότητα 8: Εισαγωγή στη SPARQL Βασική Χρήση Μ.Στεφανιδάκης 3-5-2015. Η γλώσσα ερωτημάτων SPARQL Ερωτήσεις (και ενημερώσεις) σε σετ δεδομένων RDF Και σε δεδομένα άλλης μορφής

Διαβάστε περισσότερα

Τεχνολογίες Παγκόσμιου Ιστού. 1η διάλεξη

Τεχνολογίες Παγκόσμιου Ιστού. 1η διάλεξη Τεχνολογίες Παγκόσμιου Ιστού 1η διάλεξη Χαρακτηριστικά Μαθήματος Μάθημα προγραμματισμού (και όχι μόνον) Μπορεί να εξελιχθεί σε εφιάλτη αν δεν έχετε καλή γνώση και αρκετή εμπειρία προγραμματισμού (Java)

Διαβάστε περισσότερα

ΕΙΣΑΓΩΓΗ ΣΤOΝ ΠΡΟΓΡΑΜΜΑΤΙΣΜΟ

ΕΙΣΑΓΩΓΗ ΣΤOΝ ΠΡΟΓΡΑΜΜΑΤΙΣΜΟ ΕΙΣΑΓΩΓΗ ΣΤOΝ ΠΡΟΓΡΑΜΜΑΤΙΣΜΟ Στόχοι του μαθήματος Μετά το τέλος του μαθήματος οι μαθητές πρέπει να είναι σε θέση: Να περιγράφουν τι είναι πρόγραμμα Να εξηγούν την αναγκαιότητα για τη δημιουργία γλωσσών

Διαβάστε περισσότερα

Alfresco. CyberStream. διαχείριση εγγράφων χωρίς όρια για την επιχείρηση. Νίκος Λυκουρόπουλος τεχνικός διευθυντής

Alfresco. CyberStream. διαχείριση εγγράφων χωρίς όρια για την επιχείρηση. Νίκος Λυκουρόπουλος τεχνικός διευθυντής Alfresco διαχείριση εγγράφων χωρίς όρια για την επιχείρηση Νίκος Λυκουρόπουλος τεχνικός διευθυντής CyberStream CyberStream και Ανοιχτό Λογισμικό η CyberStream από την ίδρυσή της το 2000, εξειδικεύεται

Διαβάστε περισσότερα

Η συνολική εικόνα. Ποιοτική Αναβάθμιση δεδομένων. Λογισμικό Επικοινωνιών DATA WAREHOUSE. Σχεδιασμός Ενοποίηση Επιλογή Συγχρονισμός Συντονισμός

Η συνολική εικόνα. Ποιοτική Αναβάθμιση δεδομένων. Λογισμικό Επικοινωνιών DATA WAREHOUSE. Σχεδιασμός Ενοποίηση Επιλογή Συγχρονισμός Συντονισμός Η συνολική εικόνα Τοπικές Βάσεις Βάσεις Κεντρικών Συστημάτων Βάσεις Τρίτων Ποιοτική Αναβάθμιση δεδομένων Λογισμικό Επικοινωνιών DATA WAREHOUSE Σχεδιασμός Ενοποίηση Επιλογή Συγχρονισμός Συντονισμός Warehouse

Διαβάστε περισσότερα

Πιο συγκεκριμένα, η χρήση του MATLAB προσφέρει τα ακόλουθα πλεονεκτήματα.

Πιο συγκεκριμένα, η χρήση του MATLAB προσφέρει τα ακόλουθα πλεονεκτήματα. i Π Ρ Ο Λ Ο Γ Ο Σ Το βιβλίο αυτό αποτελεί μια εισαγωγή στα βασικά προβλήματα των αριθμητικών μεθόδων της υπολογιστικής γραμμικής άλγεβρας (computational linear algebra) και της αριθμητικής ανάλυσης (numerical

Διαβάστε περισσότερα

(Διαφάνειες Νίκου Βιδάκη)

(Διαφάνειες Νίκου Βιδάκη) (Διαφάνειες Νίκου Βιδάκη) JAVA Inheritance Εβδομάδα Νο. 3 2 Προηγούμενο μάθημα (1/2) Τι είναι αντικείμενο? Ανάλυση αντικειμένων Πραγματικά αντικείμενα Καταστάσεις Συμπεριφορές Αντικείμενα στον προγραμματισμό

Διαβάστε περισσότερα

"Το λογισμικόgreenfoot ως εκπαιδευτικό εργαλείο"

Το λογισμικόgreenfoot ως εκπαιδευτικό εργαλείο "Το λογισμικόgreenfoot ως εκπαιδευτικό εργαλείο" Κωνσταντίνος Δελησταύρου Ευγενία Παπαδοπούλου ΕΠΑ.Λ. Αξιούπολης Ημερίδα Καλές Πρακτικές στη διδασκαλία της Πληροφορικής Κιλκίς 26/6/2014 Τι είναι το Greenfoot

Διαβάστε περισσότερα

Βιοπληροφορική. Ενότητα 14: Μοντέλα Πολλαπλής Στοίχισης (2/2), 1.5ΔΩ. Τμήμα: Βιοτεχνολογίας Όνομα καθηγητή: Τ. Θηραίου

Βιοπληροφορική. Ενότητα 14: Μοντέλα Πολλαπλής Στοίχισης (2/2), 1.5ΔΩ. Τμήμα: Βιοτεχνολογίας Όνομα καθηγητή: Τ. Θηραίου Βιοπληροφορική Ενότητα 14: Μοντέλα Πολλαπλής Στοίχισης (2/2), 1.5ΔΩ Τμήμα: Βιοτεχνολογίας Όνομα καθηγητή: Τ. Θηραίου Μαθησιακοί Στόχοι παρουσίαση των μοντέλων πολλαπλής στοίχισης. κατανόηση των εφαρμογών

Διαβάστε περισσότερα

Με τα sequence projects φτάσαμε στην εποχή που η ελάχιστη πληροφορία για να ξεκινήσει ένα πείραμα είναι ολόκληρη ακολουθία DNA του οργανισμού Το DNA

Με τα sequence projects φτάσαμε στην εποχή που η ελάχιστη πληροφορία για να ξεκινήσει ένα πείραμα είναι ολόκληρη ακολουθία DNA του οργανισμού Το DNA Microarrays Με τα sequence projects φτάσαμε στην εποχή που η ελάχιστη πληροφορία για να ξεκινήσει ένα πείραμα είναι ολόκληρη ακολουθία DNA του οργανισμού Το DNA όμως του οργανισμού είναι μια στατική πληροφορία

Διαβάστε περισσότερα

Information Technology for Business

Information Technology for Business Information Technology for Business! Lecturer: N. Kyritsis, MBA, Ph.D. Candidate!! e-mail: kyritsis@ist.edu.gr Διαχείριση Επιχειρηματικών Δεδομένων - Databases Ορισμός Βάσης Δεδομένων Συλλογή συναφών αρχείων

Διαβάστε περισσότερα

ΟΜΑΔΑ Ε ΓΕΩΡΓΙΟΥ ΦΩΤΕΙΝΗ ΗΛΙΟΥΔΗ ΑΦΡΟΔΙΤΗ ΜΕΤΑΛΛΙΔΟΥ ΧΡΥΣΗ ΝΙΖΑΜΗΣ ΑΛΕΞΑΝΔΡΟΣ ΤΖΗΚΑΛΑΓΙΑΣ ΑΝΔΡΕΑΣ ΤΡΙΓΚΑΣ ΑΓΓΕΛΟΣ

ΟΜΑΔΑ Ε ΓΕΩΡΓΙΟΥ ΦΩΤΕΙΝΗ ΗΛΙΟΥΔΗ ΑΦΡΟΔΙΤΗ ΜΕΤΑΛΛΙΔΟΥ ΧΡΥΣΗ ΝΙΖΑΜΗΣ ΑΛΕΞΑΝΔΡΟΣ ΤΖΗΚΑΛΑΓΙΑΣ ΑΝΔΡΕΑΣ ΤΡΙΓΚΑΣ ΑΓΓΕΛΟΣ ΟΜΑΔΑ Ε ΓΕΩΡΓΙΟΥ ΦΩΤΕΙΝΗ ΗΛΙΟΥΔΗ ΑΦΡΟΔΙΤΗ ΜΕΤΑΛΛΙΔΟΥ ΧΡΥΣΗ ΝΙΖΑΜΗΣ ΑΛΕΞΑΝΔΡΟΣ ΤΖΗΚΑΛΑΓΙΑΣ ΑΝΔΡΕΑΣ ΤΡΙΓΚΑΣ ΑΓΓΕΛΟΣ Η ΔΙΔΑΣΚΑΛΙΑ ΤΟΥ ΠΡΟΓΡΑΜΜΑΤΙΣΜΟΥ ΣΤΟ ΛΥΚΕΙΟ Εισαγωγή Η μεγάλη ανάπτυξη και ο ρόλος που

Διαβάστε περισσότερα