Ανάπτυξη μοριακής μεθόδου ανίχνευσης ιών του γένους Polerovirus και μερικός χαρακτηρισμός ενός Polero ιού που σχετίζεται με τον ίκτερο της πιπεριάς

Μέγεθος: px
Εμφάνιση ξεκινά από τη σελίδα:

Download "Ανάπτυξη μοριακής μεθόδου ανίχνευσης ιών του γένους Polerovirus και μερικός χαρακτηρισμός ενός Polero ιού που σχετίζεται με τον ίκτερο της πιπεριάς"

Transcript

1 ΑΡΙΣΤΟΤΕΛΕΙΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΘΕΣΣΑΛΟΝΙΚΗΣ ΓΕΩΠΟΝΙΚΗ ΣΧΟΛΗ ΤΟΜΕΑΣ ΦΥΤΟΠΡΟΣΤΑΣΙΑΣ ΜΕΤΑΠΤΥΧΙΑΚΗ ΕΙΔΙΚΕΥΣΗ ΕΠΙΣΤΗΜΩΝ ΦΥΤΟΠΡΟΣΤΑΣΙΑΣ Ανάπτυξη μοριακής μεθόδου ανίχνευσης ιών του γένους Polerovirus και μερικός χαρακτηρισμός ενός Polero ιού που σχετίζεται με τον ίκτερο της πιπεριάς Λεωνίδας Λώτος Γεωπόνος Α.Π.Θ Υπότροφος Ι.Κ.Υ Μεταπτυχιακή Διατριβή Θεσσαλονίκη 2009

2 ΑΡΙΣΤΟΤΕΛΕΙΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΘΕΣΣΑΛΟΝΙΚΗΣ ΓΕΩΠΟΝΙΚΗ ΣΧΟΛΗ ΤΟΜΕΑΣ ΦΥΤΟΠΡΟΣΤΑΣΙΑΣ ΜΕΤΑΠΤΥΧΙΑΚΗ ΕΙΔΙΚΕΥΣΗ ΕΠΙΣΤΗΜΩΝ ΦΥΤΟΠΡΟΣΤΑΣΙΑΣ Ανάπτυξη μοριακής μεθόδου ανίχνευσης ιών του γένους Polerovirus και μερικός χαρακτηρισμός ενός Polero ιού που σχετίζεται με τον ίκτερο της πιπεριάς Λεωνίδας Λώτος Μεταπτυχιακή Διατριβή Η διατριβή εκπονήθηκε στο Εργαστήριο Φυτοπαθολογίας της Γεωπονικής Σχολής του Αριστοτελείου Πανεπιστημίου Θεσσαλονίκης Τριμελής Εξεταστική Επιτροπή Ν. Ι. Κατής Καθηγητής Εισηγητής Χ. Ι. Δόβας Λέκτορας Μέλος Γ. Καραογλανίδης Λέκτορας Μέλος ΘΕΣΣΑΛΟΝΙΚΗ, ΔΕΚΕΜΒΡΗΣ 2009

3 ΠΡΟΛΟΓΟΣ ΕΥΧΑΡΙΣΤΙΕΣ Η παρούσα διατριβή εκπονήθηκε κατά τα έτη στο εργαστήριο Φυτοπαθολογίας της Γεωπονικής Σχολής του Αριστοτέλειου Πανεπιστημίου Θεσσαλονίκης (Α.Π.Θ) στα πλαίσια του Μεταπτυχιακού Προγράμματος Σπουδών του τομέα Φυτοπροστασίας. Ολοκληρώνοντας την προσπάθεια αυτή αισθάνομαι την ανάγκη να ευχαριστήσω όλους όσους συνέβαλαν στην πραγματοποίησή της. Ιδιαίτερες ευχαριστίες οφείλω στον επιβλέποντα καθηγητή μου κ. Νικόλαο Ι. Κατή για την συνεχή καθοδήγηση, την άριστη συνεργασία, την υπομονή και την αμέριστη υποστήριξή του, εντός και εκτός του εργαστηρίου, καθ όλη την διάρκεια των προπτυχιακών και μεταπτυχιακών μου σπουδών. Θερμές ευχαριστίες θα ήθελα να εκφράσω στους λέκτορες κ. Χρυσόστομο Δόβα και κ. Γεώργιο Καραογλανίδη, μέλη της τριμελούς εξεταστικής επιτροπής, για την κριτική ανάγνωση της μεταπτυχιακής μου διατριβής. Επίσης στον κ. Κωνσταντίνο Ευθυμίου και την Δρ. Βαρβάρα Μαλιόγκα για την συνεχή βοήθεια και συμπαράστασή τους, τις πολύτιμες υποδείξεις τους και την μετάδοση της αγάπης τους για την επιστήμη της Ιολογίας. Θα ήθελα να ευχαριστήσω σύσσωμο το εργαστήριο Φυτοπαθολογίας της Γεωπονικής Σχολής του Α.Π.Θ. και τους συμφοιτητές μου στο μεταπτυχιακό πρόγραμμα σπουδών για το όμορφο κλίμα των ετών αυτών. Βαθύτατες ευχαριστίες αρμόζουν στους Ράνια, Αποστόλη, Γιώργο, Λέλα, Μένια, Ξένια, Χάρη και Χριστίνα για την πολύτιμη βοήθεια και υποστήριξή τους. Ευχαριστίες εκφράζονται επίσης στους: Δρ. E. Komor (Botanisches Institut Universitat Bayreuth, Germany), Δρ. O. Lemaire (INRA, Colmar France), Δρ. S. A. MacFarlane (SCRI, Dundee UK), Δρ. H. J. Vetten (JKI, Braunschweig Germany) και Δρ. S. Winter (DSMZ, Braunschweig Germany) για την παροχή ιικών απομονώσεων. Λέκτορα κ. Γεώργιο Καραογλανίδη για την προμήθεια δειγμάτων ζαχαρότευτλων από την περιοχή της Ημαθίας. Το Ίδρυμα Κρατικών Υποτροφιών (ΙΚΥ) για την οικονομική ενίσχυση κατά τη διάρκεια των μεταπτυχιακών μου σπουδών. Τέλος, ένα μεγάλο ευχαριστώ αρμόζει στους γονείς μου Χρήστο και Άννα και στην αδερφή μου Χρυσαφένια που ήταν πάντα δίπλα μου και με ενθάρρυναν κάθε στιγμή. i

4 ΠΕΡΙΕΧΟΜΕΝΑ Πρόλογος Ευχαριστίες i Περιεχόμενα ii Συντομογραφίες iv Ευρετήριο Εικόνων και Πινάκων vii Περίληψη Abstract x Κεφάλαιο 1. Εισαγωγή Η Οικογένεια Luteoviridae Ιστορική Αναδρομή Βιολογικά Χαρακτηριστικά Ιδιότητες των Ιoσωματίων Γένη της Οικογένειας Luteoviridae Γένος Enamovirus Γένος Luteovirus Γένος Polerovirus Γένος Polerovirus Μέλη του Γένους Ιοί που σχετίζονται με τον ίκτερο των τεύτλων (BChV, BMYV, BWYV, TuYV) Ιός των κόκκινων φύλλων του καρότου Carrot red leaf virus (CtRLV) Ιός του κίτρινου νανισμού των δημητριακών Cereal yellow dwarf virus (CYDV) Ιός του χλωρωτικού νανισμού του ρεβιθιού Chickpea chlorotic stunt virus (CpCSV) Ιός του καρουλιάσματος των φύλλων με νανισμό του βαμβακιού Cotton leafroll dwarf virus Ιός του αφιδομεταδιδόμενου ίκτερου των κολοκυνθοειδών Cucurbit aphid borne virus (CABYV) Ιός του αφιδομεταδιδόμενου ίκτερου του πεπονιού Melon aphid borne virus (MABYV) Ιός του καρουλιάσματος των φύλλων της πατάτας Potato leafroll virus (PLRV) Ιός των κίτρινων φύλλων του σακχαροκάλαμου Sugarcane yellow leaf virus (ScYLV) Ιός της παραμόρφωσης των νεύρων του καπνού Tobacco vein distorting virus (TVDV) Οργάνωση του Γονιδιώματος Μετάδοση των Polero ιών Μετάδοση με αφίδες Μηχανική μετάδοση Συμβιωτικές Σχέσεις Umbravirus RNAs που σχετίζονται με Polero ιούς (associated RNAs) Δορυφορικά RNA που σχετίζονται με Polero ιούς Ιοειδή Μέθοδοι Διάγνωσης Βιολογικές Ορολογικές Μοριακές Σκοπός της εργασίας 32 Κεφάλαιο 2. Ανάπτυξη Μοριακής Μεθόδου Γενικής Ανίχνευσης Polero ιών 33 ii

5 2.1 Εισαγωγή Υλικά και Μέθοδοι Ιικές Απομονώσεις Χαρακτηρισμένες απομονώσεις Απομονώσεις που εντοπίστηκαν στη χώρα μας Εκχύλιση RNA Επιλογή των Εκκινητών Γενικής Ανίχνευσης Επιλογή της περιοχής υβριδοποίησης των εκκινητών Σχεδιασμός των εκκινητών Σχεδιασμός Βέλτιστου Πρωτοκόλλου RT PCR Ανάλυση των Προϊόντων της PCR με Ηλεκτροφόρηση Αλληλούχιση Προϊόντων PCR Φυλογενετική Ανάλυση Αποτελέσματα Συζήτηση Ιικές Απομονώσεις Ανάπτυξη Γενικής Μεθόδου Ανίχνευσης Polero ιών Αξιολόγηση Μεθόδου Φυλογενετική Ανάλυση Συμπεράσματα 61 Κεφάλαιο 3. Μερικός Χαρακτηρισμός Ενος Polero ιού Που Σχετίζεται Με Τον Ίκτερο Της Πιπεριάς Εισαγωγή Υλικά και Μέθοδοι Φυτικό Υλικό Εκχύλιση RNA Αλληλούχιση Τμήματος του Γονιδιώματος της Απομόνωσης PY Επιλογή περιοχών υβριδοποίησης των εκκινητών Σχεδιασμός εκκινητών Πρωτόκολλο θερμοκυκλοποίησης Ανάλυση των Προϊόντων της PCR με Ηλεκτροφόρηση Αλληλούχιση Προϊόντων PCR Φυλογενετική Ανάλυση Αποτελέσματα Συζήτηση Αλληλούχιση της Απομόνωσης PY Φυλογενετική Ανάλυση Αξιολόγηση φυλογενετικών δέντρων Γενετικές αποστάσεις της απομόνωσης PY με τα υπόλοιπα μέλη του γένους Polerovirus Ταξινόμηση της PY Συμπεράσματα 81 Κεφάλαιο 4. Γενική Συζήτηση Και Συμπεράσματα 83 Βιβλιογραφία 87 Παράρτημα 104 iii

6 ΣΥΝΤΟΜΟΓΡΑΦΙΕΣ Συντομογραφίες ιών ασθενειών BChV Ιός της χλώρωσης των τεύτλων (Beet chlorosis virus) BLRV Ιός του καρουλιάσματος των φύλλων του φασολιού (Bean leafroll virus) BMYV Ιός του ήπιου ίκτερου των τεύτλων (Beet mild yellowing virus) BWYV Ιός του δυτικού ίκτερου των τεύτλων (Beet western yellows virus) BYDV MAV Ιός του κίτρινου νανισμού του κριθαριού MAV (Barley yellow dwarf virus MAV) BYDV PAS Ιός του κίτρινου νανισμού του κριθαριού PAS (Barley yellow dwarf virus PAS) BYDV PAV Ιός του κίτρινου νανισμού του κριθαριού PAV (Barley yellow dwarf virus PAV) BYV Ιός του ίκτερου των τεύτλων (Beet yellows virus) CABYV Ιός του αφιδομεταδιδόμενου ίκτερου των κολοκυνθοειδών (Cucurbit aphid borne yellows virus) CLRDV Ιός του καρουλιάσματος των φύλλων με νανισμό του βαμβακιού (Cotton leafroll dwarf virus) CMD Ασθένεια του νανισμού με ποικιλόχρωση του καρότου (Carrot motley dwarf disease) CMoMV Μιμητικός ιός της ποικιλοχλώρωσης του καρότου (Carrot mottle mimic virus) CMoV Ιός της ποικιλοχλώρωσης του καρότου (Carrot mottle virus) COMV Ιός της ποικιλοχλώρωσης της δακτυλίδας (Cocksfoot mottle virus) CpCSV Ιός του χλωρωτικού νανισμού του ρεβιθιού (Chickpea chlorotic stunt virus) CRLVaRNA RNA σχετιζόμενο με τον ιό των κόκκινών φύλλων του καρότου (Carrot red leaf virus associated RNA) CtRLV Ιός των κόκκινων φύλλων του καρότου (Carrot red leaf virus) CYDV GPV Ιός του κίτρινου νανισμού των δημητριακών GPV (Cereal yellow dwarf virus GPV) CYDV RPS Ιός του κίτρινου νανισμού των δημητριακών RPS (Cereal yellow dwarf virus RPS) CYDV RPV Ιός του κίτρινου νανισμού των δημητριακών RPV (Cereal yellow dwarf virus RPV) CYV Ιός του ίκτερου της πιπεριάς (Capsicum yellows virus) GRV Ιός της ροζέτας της αραχίδας (Groundnut rosette virus) LSMV Ιός της κηλιδωτής ποικιλοχλώρωσης του μαρουλιού (Lettuce speckles mottle virus) LTSV Ιός της παροδικής ράβδωσης της μηδικής (Lucerne transient streak virus) MABYV Ιός του αφιδομεταδιδόμενου ίκτερου του πεπονιού (Melon aphid borne yellows virus) PEMV Ιός του μωσαϊκού με γλωσσίδια του αρακά (Pea enation mosaic virus) PeVYV Ιός του ίκτερου των νεύρων της πιπεριάς (Pepper vein yellows virus) PeYV Ιός του ίκτερου της πιπεριάς (Pepper yellows virus) PLRV Ιός του καρουλιάσματος των φύλλων της πατάτας (Potato leafroll virus) PSTVd Ιοειδές των ατρακτοειδών κονδύλων της πατάτας (Potato spindle tuber viroid) PVY Ιός Υ της πατάτας (Potato virus Y) RGMoV Ιός της ποικιλοχλώρωσης της ήρας (Ryegrass mottle virus) RuCMV Ιός της χλωρωτικής ποικοιλοχλώρωσης των Rubus sp. (Rubus chlorotic mottle virus) RYMV Ιός της κίτρινης ποικιλοχλώρωσης του ρυζιού (Rice yellow mottle virus) SbDV Ιός του νανισμού της σόγιας (Soybean dwarf virus) SBMV Ιός του μωσαϊκού του νότιου φασολιού (Southern bean mosaic virus) iv

7 SCMoV SCPMV ScYLV SeMV ST9aRNA TBTD TBTV TMoV TRoV TuYV TVDV YLD WYDV GPV Ιός της ποικιλοχλώρωσης του υπόγειου τριφυλλιού (Subterranean clover mottle virus) Ιός του μωσαϊκού του νότιου μαυρομάτικου φασολιού (Southern cowpea mosaic virus) Ιός των κίτρινων φύλλων του ζαχαροκάλαμου (Sugarcane yellow leaf virus) Ιός του μωσαϊκού του είδους Sesbania grandiflora (Sesbania mosaic virus) ST9 σχετιζόμενο RNA (ST9 associated RNA) Ασθένεια της θαμνώδους κορυφής του καπνού (Tobacco bushy top disease) Ιός της θαμνώδους κορυφής του καπνού (Tobacco bushy top virus) Ιός της ποικιλοχλώρωσης του καπνού (Tobacco mottle virus) Ιός της ροζέτας του γογγυλιού (Turnip rosette virus) Ιός του ίκτερου του γογγυλιού (Turnip yellows virus) Ιός της παραμόρφωσης των νεύρων του καπνού (Tobacco vein distorting virus) Ασθένεια των κίτρινων φύλλων (Yellow leaf disease) Ιός του κίτρινου νανισμού του σιταριού GPV (Wheat yellow dwarf virus GPV) Άλλες Συντομογραφίες aa AAP alrt ASG BIC bp cdna Clostero ιοί CP DEPC DMSO DNA dntps dsrna DTT EDTA ELISA Enamo ιοί grna IAP ICTV incr kb kda λουτεοϊοί Luteo ιοί Άμινοξέα (amino acids) Χρόνος πρόσληψης (Acquisition Access Period) Κατά προσέγγιση πηλίκο πιθανοφανειών (approximate Likelihood Ratio Test) Βοηθητικοί σιελογόνοι αδένες (Accessory Salivary Glands) Bayesian Information Criterion Ζεύγη βάσεων (base pair) Συμπληρωματικό DNA (complementary DNA) Ιοί του γένους Closterovirus Καψιδιακή πρωτεΐνη (Coat Protein) Διαίθυλοπυροανθρακικός εστέρας (Diethylpyrocarbonate) Διμέθυλοσουλφοξίδιο (Dimethyl sulfoxide) Δεοξυριβονουκλεϊκό οξύ (Deoxyribonucleic acid) 5 τριφωσφορικά δεοξυριβονουκλεοτίδια (Deoxynucleotides triphosphate) Δίκλωνο RNA (double stranded RNA) Διθειοθρεϊτόλη (Dithiothreitol) Αιθύλενο διάμινο τετραοξικό οξύ (Εthylenediaminetetraacetic acid) Ανοσοενζυμική δοκιμή (Enzyme linked immunosorbent assay) Ιοί του γένους Enamovirus Γενωμικό RNA (genomic RNA) Χρόνος μετάδοσης (Inoculation Access Period) Διεθνής Επιτροπή της Συστηματικής Ταξινόμησης των Ιών (International Committee on Taxonomy of Viruses) Διαγονιδιακή αμετάφραστη περιοχή (intergenic NCR) Χιλιάδες βάσεων Χιλάδες Dalton Ιοί της οικογένειας Luteoviridae Ιοί του γένους Luteovirus v

8 MAbs Μονοκλωνικά αντισώματα (Monoclonal antibodies) MB Μοριακό βάρος ML Μέγιστη Πιθανοφάνεια (Maximum Likelihood) μl Μικρόλιτρα mm Χιλιοστομοριακότητα (Millimolar) μμ Μικρομοριακότητα (Micromolar) MP Πρωτεΐνη διακυτταρικής μετακίνησης (Movement Protein) Mr Μοριακή μάζα (Molecular mass) NCR Αμετάφραστη περιοχή (Non Coding Region) nm Νανόμετρα nt Νουκλεοτίδια (nucleotides) ORF Ανοιχτό πλαίσιο ανάγνωσης (Open Reading Frame) PAbs Πολυκλωνικά αντισώματα (Polyclonal Antibodies) PCR Αλυσιδωτή αντίδραση της πολυμεράσης (Polymerase Chain Reaction) Polero ιοί Ιοί του γένους Polerovirus PSG Πρωτεύοντες σιελογόνοι αδένες (Primary Salivary Glands) RdRp RNA εξαρτώμενη RNA πολυμεράση (RNA dependant RNA polymerase) RNA Ριβονουκλεϊκό οξύ (Ribonucleic acid) RT PCR Αντίστροφη μεταγραφή PCR (Reverse Transcription PCR) satrna Δορυφορικό RNA (satellite RNA) sgrna Υπογενωμικό RNA (sub genomic RNA) SH alrt Shimodaira Hasegawa alrt Sobemo ιοί Ιοί του γένους Sobemovirus ssrna Μονόκλωνο RNA (single stranded RNA) TRIS 2 άμινο 2 υδροξυμέθυλο 1,3 προπανοδιόλη [2 Amino 2 (hydroxymethyl) 1,3 propanediol] u Ενεργότητα ενζύμου (Enzyme unit) VPg Ιική πρωτεΐνη συνδεδεμένη με το γονιδίωμα (Viral Protein genome linked) WANA Δυτική Ασία και Βόρεια Αφρική (Western Asia North Africa ) vi

9 ΕΥΡΕΤΗΡΙΟ ΕΙΚΟΝΩΝ ΚΑΙ ΠΙΝΑΚΩΝ Εικόνες Εικόνα 1.1: (Αριστερά) Διάγραμμα της προτεινόμενης δομής των ιοσωματίων των λουτεοϊών. (Κέντρο) Ιοσωμάτια του BYDV PAV. (Δεξιά) Ιοσωμάτια του PEMV 1 5 Εικόνα 1.2: Διάγραμμα της οργάνωσης του γονιδιώματος και των προϊόντων μετάφρασης του PEMV 1 8 Εικόνα 1.3: Διάγραμμα της οργάνωσης του γονιδιώματος και των προϊόντων μετάφρασης του BYDV PAV 9 Εικόνα 1.4: Προτεινόμενη οργάνωση του γονιδιώματος και υπογενωμικά RNA του PLRV 17 Εικόνα 1.5: Οργάνωση του γονιδιώματος του γένους Polerovirus 19 Εικόνα 1.6: Κυκλοφορία των Polero ιών στο σώμα των αφίδων φορέων 23 Εικόνα 1.7: (a) Διάγραμμα της σχετικής θέσης του τροφικού καναλιού, του μυκητώματος και των σιελογόνων αδένων της αφίδας, καθώς και του μονοπατιού κυκλοφορίας των ιοσωματίων. (b) Ο υποθετικός ρόλος της συμβιονίνης στην κατακράτηση των ιοσωματίων. (c) Ηλεκτρονική μικρογραφία των κυττάρων του Buchnera στο μυκήτωμα 24 Εικόνα 2.1: Στοίχιση νουκλεοτιδικών αλληλουχιών απομονώσεων των CtRLV (Α), BMYV (Β), BWYV (Γ) και TuYV (Δ) 38 Εικόνα 2.2: Θέση των εκκινητών του Πίν. 2.5 σε σχέση με το ORF2 41 Εικόνα 2.3: Στοίχιση νουκλεοτιδικών αλληλουχιών της περιοχής της RdRp των Polero, Sobemo και Enamo ιών 43 Εικόνα 2.4: Ηλεκτοφόρημα δειγμάτων που βρέθηκαν θετικά για προσβολή από τον CABYV, ενισχύοντας το προβλεπόμενο τμήμα των 484bp 50 Εικόνα 2.5: Ηλεκτροφόρημα του δείγματος ΒΥ 1 όπου φαίνεται το προβλεπόμενο προϊόν των 830bp και το παραπροϊόν των ~300bp 50 Εικόνα 2.6: Ηλεκτροφορήματα θετικών δειγμάτων, για τον CtRLV, που ανιχνεύτηκαν με τους εκκινητές CtRLV Up και CtRLV Down (Α) και με την μέθοδο των Vercruysse et al. (2000) (Β) 50 Εικόνα 2.7: Ηλεκτροφορήματα δειγμάτων που βρέθηκαν θετικά για έναν τουλάχιστον ιό από τους BMYV (A), BWYV (B) και TuYV (Γ) 51 Εικόνα 2.8: Ηλεκτροφόρημα PCR γενικής ανίχνευσηςpolero ιών, η RT της οποίας έγινε με τον PolGenRT 52 Εικόνα 2.9: Ηλεκτροφορήματα αντιδράσεων στις οποίες διαφοροποιείται η συγκέντρωση του DMSO ως εξής: 0% (Α), 5% (Β) και 10% (Γ) 53 vii

10 Εικόνα 2.10: Ηλεκτροφορήματα αντιδράσεων στις οποίες διαφοροποιείται η συγκέντρωση του MgCl2 ως εξής: 1,0mM (Α), 1,5mM (Β) και 2,0mM (Γ) 54 Εικόνα 2.11: Ηλεκτροφόρημα όλων των απομονώσεων των Polero ιών που χρησιμοποιήθηκαν στην παρούσα μελέτη 56 Εικόνα 2.12: Ηλεκτροφόρημα απομονώσεων των γενών Luteovirus, Enamovirus και Sobemovirus 56 Εικόνα 2.13: Φυλογενετικό δέντρο μέγιστης πιθανοφάνειας αμινοξικών αλληλουχιών της P2 του γένους Polerovirus 57 Εικόνα 2.14: Φυλογενετικό δέντρο μέγιστης πιθανοφάνειας αμινοξικών αλληλουχιών του τμήματος που ενισχύεται με τη γενική μέθοδο ανίχνευσης 58 Εικόνα 2.15: Φυλογενετικό δέντρο μέγιστης πιθανοφάνειας αμινοξικών αλληλουχιών του τμήματος που ενισχύεται με τη γενική μέθοδο ανίχνευσης σε συνδυασμό με τις απομονώσεις που βρέθηκαν στην παρούσα μελέτη (έντονη γραφή) 59 Εικόνα 3.1: Στοίχιση νουκλεοτιδικών αλληλουχιώντης περιοχής της P5(A), CP(B) και RdRp(Γ) απομονώσεων μελών του γένους Polerovirus 68 Εικόνα 3.2: Σχετική θέση εκκινητών και προϊόντα των PCR που χρησιμοποιήθηκαν για την αλληλούχιση της απομόνωσης PY 70 Εικόνα 3.3: Ηλεκτροφόρημα των προϊόντων της εστιασμένης RT PCR 73 Εικόνα 3.4: Ηλεκτροφόρημα των προϊόντων της PCR για την ενίσχυση του ORF3 της PY 73 Εικόνα 3.5: Φυλογενετικό δέντρο μέγιστης πιθανοφάνειας αμινοξικών αλληλουχιών του καρβοξυτελικού τμήματος της RdRp 74 Εικόνα 3.6: Φυλογενετικό δέντρο μέγιστης πιθανοφάνειας αμινοξικών αλληλουχιών της MP 75 Εικόνα 3.7: Φυλογενετικό δέντρο μέγιστης πιθανοφάνειας αμινοξικών αλληλουχιών της CP 76 Πίνακες Πίνακας 1.1: Πρωτεϊνικά προϊόντα, μέγεθος (kda) και πιθανές λειτουργίες των διαφόρων ORFs 6 Πίνακας 1.2: Τακτικά μέλη του γένους Luteovirus 8 Πίνακας 1.3: Τακτικά μέλη του γένους Polerovirus 10 Πίνακας 1.4: Ιοί που έχει προταθεί η ένταξή τους στο γένος Polerovirus 10 Πίνακας 1.5: Κυριότερα είδη αφίδων φορέων ιών του γένους Polerovirus 22 Πίνακας 1.6: Ασθένειες που οφείλονται στην αλληλεπίδραση ιών του γένους Umbravirus και Polerovirus 28 viii

11 Πίνακας 2.1: Χαρακτηρισμένες απομονώσεις ιών που χρησιμοποιήθηκαν για την ανάπτυξη της γενικής μεθόδου ανίχνευσης 36 Πίνακας 2.2: Δείγματα που ελέχθησαν για την εύρεση απομονώσεων της οικογένειας Luteoviridae 37 Πίνακας 2.3: Αλληλουχίες εκκινητών για την ειδική ανίχνευση των CtRLV, BMYV, BWYV και TuYV και μέγεθος προβλεπόμενου προϊόντος 38 Πίνακας 2.4: Εκκινητές που επιλέχθηκαν για την ανάπτυξη της γενικής ανίχνευσης Polero ιών 41 Πίνακας 2.5: Απομονώσεις ιών που χρησιμοποιήθηκαν για τον σχεδιασμό εκκινητών γενικής ανίχνευσης 42 Πίνακας 2.6: Απομονώσεις ιών που χρησιμοποιήθηκαν για την κατασκευή φυλογενετικών δέντρων της P2 48 Πίνακας 2.7: Συγκεντρώσεις και Tm των εκκινητών που χρησιμοποιήθηκαν για την ανίχνευση των CtRLV, BMYV, BWYV, TuYV 49 Πίνακας 2.8: Απομονώσεις που χρησιμοποιήθηκαν για την ανάπτυξη της γενικής μεθόδου ανίχνευσης Polero ιών 52 Πίνακας 3.1: Απομονώσεις ιών του γένους Polerovirus που χρησιμοποιήθηκαν για τον σχεδιασμό εκκινητών στην CP 66 Πίνακας 3.2: Απομονώσεις ιών του γένους Polerovirus που χρησιμοποιήθηκαν για τον σχεδιασμό εκκινητών στην P5 67 Πίνακας 3.3: Εκκινητές που χρησιμοποιήθηκαν για την αλληλούχιση της απομόνωσης PY 67 Πίνακας 3.4: Απομονώσεις ιών της οικογένειας Luteoviridae που χρησιμοποιήθηκαν στην κατασκευή των φυλογενετικών δέντρων της CP και MP 72 Πίνακας 3.5: Διαφορές % σε επίπεδο αμινοξέων της απομόνωσης PY σε σύγκριση με ιούς του γένους Polerovirus 78 Πίνακας 3.6: Διαφορές % σε επίπεδο αμινοξέων των απομονώσεων του TVDV και της PY στην CP (έντονη γραφή) και MP (πλάγια γραφή) 79 ix

12 ΠΕΡΙΛΗΨΗ Οι ιοί του γένους Polerovirus αποτελούν από τους πλέον διαδεδομένους παγκοσμίως και προσβάλλουν οικονομικώς σημαντικές καλλιέργειες όπου προκαλούν σημαντικές απώλειες στην παραγωγή. Στην παρούσα μελέτη αναπτύχθηκε μια μέθοδος γενικής ανίχνευσης των Polero ιών η οποία βασίζεται στην χρησιμοποίηση εκφυλισμένων εκκινητών που υβριδοποιούνται στην περιοχή της RdRp σε συνδυασμό με μία RT PCR με κλιμακωτή θερμοκρασία υβριδοποίησης. Το προβλεπόμενο προϊόν των 593bp μπορεί να αλληλουχηθεί απευθείας για την απόκτηση μιας αρχικής εικόνας σχετικά με την κατάταξη των απομονώσεων. Η μέθοδος που αναπτύχθηκε είναι ικανή να ανιχνεύσει γρήγορα και αξιόπιστα απομονώσεις τουλάχιστον 10 διαφορετικών μελών του γένους. Επίσης, πραγματοποιήθηκε μερικός χαρακτηρισμός ενός Polero ιού που απομονώθηκε από φυτά πιπεριάς που εμφάνιζαν συμπτώματα ίκτερου. Αλληλούχιση τμήματος 1630nt του γονιδιώματος της απομόνωσης αυτής και φυλογενετικές αναλύσεις των προβλεπόμενων αμινοξικών αλληλουχιών της RdRp, CP και MP, έδειξαν την σαφή διαφοροποίησή της από τα υπόλοιπα μέλη της οικογένειας Luteoviridae. Τα αποτελέσματα αυτά οδήγησαν στην πρόταση της δημιουργίας ενός νέου, υπό ένταξη, είδους ιού στο γένος Polerovirus της οικογένειας Luteoviridae το οποίο θα περιλαμβάνει τη νεοευρεθείσα απομόνωση με το όνομα ιός του ίκτερου της πιπεριάς Pepper yellows virus PeYV. x

13 ABSTRACT Viruses of the genus Polerovirus are amongst the most commonly found plant virus worldwide and infect economically important crops resulting in severe yield losses. In this study a generic detection method of poleroviruses was developed using degenerate primers which target the RdRp region of the genome. The predicted amplicon of 593bp can be directly sequenced in order to obtain initial information about the classification of the isolates. The method developed detected fast and reliably isolates of at least 10 different members of the genus. Also, a polerovirus isolate from pepper plants exhibiting yellowing symptoms was partially characterized. Comparison of a 1630bp sequence of this isolate s genome along with phylogenetic analysis of the predicted amino acid sequences corresponding to the RdRp, CP and MP regions, revealed a clear distinction from other members of the family Luteoviridae. From the available results we consider this as a new tentative virus species of the genus Polerovius in the family Luteoviridae and for which we propose the name of Pepper yellows virus PeYV. xi

14 1

15 Κεφ. 1 Εισαγωγή 1.1 Η Οικογένεια Luteoviridae Ιστορική Αναδρομή Η πρώτη αναφορά συμπτωμάτων τα οποία αποδόθηκαν σε ένα λουτεοϊό είναι πιθανώς αυτά του «καρουλιάσματος της πατάτας» που περιγράφηκαν στην Ευρώπη το δεύτερο μισό του 18 ου αιώνα. Το 1790 ο Marshal ανέφερε ότι η κατάσταση αυτή, γνωστή ως «εκφυλισμός της πατάτας», που πιθανώς οφειλόταν σε μικτή μόλυνση από τον ιό του καρουλιάσματος των φύλλων της πατάτας (Potato leaf roll virus PLRV) και τον ιό Υ της πατάτας (Potato virus Y PVY), επέφερε μείωση της παραγωγής έως και 75%. Πολύ αργότερα, ο Orton (1913) διαχώρισε το αίτιο της ασθένειας του καρουλιάσματος των φύλλων της πατάτας (PLRV) από αυτό του μωσαϊκού και της ράβδωσης (PVY), οι Quanjer et al. (1916) προσδιόρισαν την μολυσματική φύση του PLRV και ο Botjes (1920) μετέδωσε τον μολυσματικό παράγοντα με αφίδες. Ο PLRV ενδημεί στο Περού, τη χώρα καταγωγής της πατάτας στη Νότια Αμερική (McKee, 1964), ενώ πλέον είναι διαδεδομένος σχεδόν σε όλες τις χώρες που καλλιεργούνται πατάτες. Η ανακάλυψη των λουτεοϊών σε φυτά τα οποία εκδήλωναν συμπτώματα ικτέρου (κιτρίνισμα) είναι αρκετά πιο πρόσφατη. Οι Oswald και Houston (1951, 1953) ήταν οι πρώτοι που απέδειξαν ότι το κιτρίνισμα των φύλλων του κριθαριού ήταν ιολογικής αιτιολογίας και μεταδίδονταν με έμμονο τρόπο με αφίδες. Ο ιός αίτιο της ασθένειας ονομάστηκε ιός του κίτρινου νανισμού του κριθαριού Barley yellow dwarf virus BYDV [ο BYDV, όπως ορίστηκε τότε, μπορεί να αντιστοιχεί σήμερα σε οποιοδήποτε είδος των BYDVs ή CYDVs (ιός του κίτρινου νανισμού των δημητριακών Cereal yellow dwarf virus)]. Ο BYDV έχει παγκοσμία διάδοση, προσβάλει ένα σημαντικό αριθμό ειδών της οικογένειας των αγρωστωδών (Poaceae, πρώην Graminae), συμπεριλαμβανομένων της βρώμης, του σίτου και πολλών άλλων καλλιεργούμενων και μη ειδών (D Arcy, 1995) και επιφέρει μεγάλες απώλειες στην παραγωγή. Δυο άλλοι λουτεοϊoί, ο ήπιος ίκτερος των τεύτλων (Beet mild yellowing virus BMYV) και ο δυτικός ίκτερος των τεύτλων (Beet western yellows virus BWYV), προκαλούν σημαντικές ζημιές στα τεύτλα. Τα συμπτώματά τους συγχέονταν αρχικά με αυτά του ίκτερου των τεύτλων (Beet yellows virus BYV), ενός Clostero ιού, αλλά τελικά η ύπαρξή τους ως διακριτά αίτια της ασθένειας του ίκτερου των τεύτλων διευκρινίστηκε τόσο στην Ευρώπη (Watson, 1952, Russel, 1958) όσο και στην Βόρεια Αμερική (Costa et al., 1959, Duffus, 1960). Μέλη των λουτεοϊών είναι τόσο διαδεδομένα σε ορισμένες περιοχές, τα αποτελέσματα της παρουσίας των οποίων αποδόθηκαν από τον Duffus (1977) ως η «κίτρινη πανώλη». 2

16 Κεφ. 1 Εισαγωγή Η ταξινομική ιστορία της οικογένειας ξεκίνησε το 1976 όταν ο Fenner αναγνώρισε επίσημα τους λουτεοϊούς ως μια διακριτή ομάδα ιών. Η ομάδα αυτή περιελάμβανε τα στελέχη RPV, RMV και SGV του BYDV, τον BWYV και τον ιό του νανισμού της σόγιας (Soybean dwarf virus SbDV), ενώ διάφοροι άλλοι ιοί θεωρήθηκαν ως μέλη των οποίων η ένταξη εκκρεμούσε. Η κατάταξή τους στην ομάδα βασίστηκε σε ορολογικές σχέσεις, φυσικοχημικές ιδιότητες των ιοσωματίων και βιολογικά χαρακτηριστικά όπως η αλληλεπίδραση με τους φορείς και ο εντοπισμός τους στους ιστούς των ξενιστών. Η ανακάλυψη των μονοκλωνικών αντισωμάτων επέτρεψε την πιο λεπτομερή μελέτη των ορολογικών σχέσεων μεταξύ των διαφόρων λουτεοϊών, με την ύπαρξη όμως πολλών σταυροειδών αντιδράσεων (cross reactions) 1 (Mayo και D Arcy, 1999). Ο αριθμός των βέβαιων μελών της ομάδας ποικίλει ανάμεσα στις αναφορές της Διεθνούς Επιτροπής της Συστηματικής Ταξινόμησης των Ιών (International Committee on Taxonomy of Viruses ICTV) (Matthews, 1979, 1982). Η 5 η αναφορά της ICTV (Francki et al., 1991) αναφέρει δέκα ιούς ως τακτικά μέλη, ενώ στην επόμενη αναφορά η ομάδα των λουτεοϊών μετονομάζεται σε γένος Luteovirus (Randles και Rathjen, 1995) και τα είδη διαχωρίζονται σε δύο υποομάδες (I και II) με τυπικά μέλη τους BYDV PAV και PLRV, αντιστοίχως. Η 7 η ήταν αυτή που διαμόρφωσε την ταξινόμηση των λουτεοϊών που ισχύει μέχρι σήμερα. Η ICTV αναβάθμισε τις δύο υποομάδες σε γένη (Luteovirus και Polerovirus), τα οποία και κατάταξε στην νεοϊδρυθείσα οικογένεια Luteoviridae μαζί με το έως τότε «ελεύθερο» γένος Enamovirus (D Arcy et al., 2000). Η Luteoviridae θεωρείται μια από τις πλέον οικονομικώς σημαντικές οικογένειες των φυτικών ιών Βιολογικά Χαρακτηριστικά Τυπικά συμπτώματα της μόλυνσης από ιούς της οικογένειας Luteoviridae αποτελούν το καρούλιασμα (συστροφή), το κοκκίνισμα και ο ίκτερος των φύλλων καθώς και η ανάσχεση της ανάπτυξης των φυτών. Παρόμοια συμπτώματα εκδηλώνονται και από άλλα αίτια όπως π.χ. οι τροφοπενίες και η τροφική δραστηριότητα εντόμων, τα οποία σε συνδυασμό με την αδυναμία μηχανικής μετάδοσης των λουτεοϊών, καθυστέρησαν αναμφίβολα την ανακάλυψή τους. Παρόλα αυτά, τα αποτελέσματα της ύπαρξής τους στο φλοίωμα εντοπίστηκαν αρκετά νωρίς. Ο Quanjer (1913) παρατήρησε νέκρωση του φλοιώματος φυτών πατάτας μολυσμένα με τον PLRV. Η νέκρωση αυτή συνοδεύεται από την συσσώρευση καλλόζης στους ηθμοσωλήνες η οποία δίνει 1 Σταυροειδής (διασταυρωτή) αντίδραση ορίζεται η αντίδραση ενός αντισώματος με ένα αντιγόνο το οποίο είναι διαφορετικό από αυτό που χρησιμοποιήθηκε για την παραγωγή του αντισώματος. 3

17 Κεφ. 1 Εισαγωγή χαρακτηριστικές αντιδράσεις χρώσης (Sheffield, 1943). Η χρώση των αποθέσεων καλλόζης ήταν η μοναδική μέθοδος ανίχνευσης των προσβεβλημένων από τον PLRV κονδύλων πριν από την ανάπτυξη των ορολογικών δοκιμών (de Bokx, 1967). Ο εκφυλισμός του φλοιώματος (Esau, 1957) όπως και ο εντοπισμός των ιοσωματίων στα παρεγχυματικά κύτταρα του φλοιώματος, στα συνοδά κύτταρα και στους ηθμοσωλήνες (Kojima et al., 1968, Jensen, 1969, Taliansky και Barker, 1999, van Bel, 2003), αποτελούν χαρακτηριστικά των λουτεοϊών. Η μέγιστη συσσώρευση των ιοσωματίων παρατηρείται στα συνοδά κύτταρα του φλοιώματος (Shepardson et al., 1980). Ενδοκυτταρικά κατανέμονται κυρίως στο κυτταρόπλασμα, αν και κάποιες απομονώσεις του BYDV βρέθηκαν στον πυρήνα (Gill και Chong, 1976). Η δυσλειτουργία του φλοιώματος, ως αποτέλεσμα της προσβολής από τους λουτεοϊούς, διαταράσσει των μεταβολισμό των υδατανθράκων, με αποτέλεσμα τη συσσώρευση αναγωγικών σακχάρων στα φύλλα γεγονός που καθυστερεί την ανάπτυξη ενώ παράλληλα τα καθιστά εύθρυπτα και γλυκά στη γεύση (Harrison, 1999). Η πλειονότητα των μελών της οικογένειας Luteoviridae συνήθως περιορίζεται, όσον αφορά τους ξενιστές της, σε μια βοτανική οικογένεια όπως για παράδειγμα στους BYDV CYDV (D Arcy, 1995) και στον ιό του χλωρωτικού νανισμού του ρεβιθιού Chickpea chlorotic stunt virus (CpCSV) (Abraham et al., 2006), με τους ξενιστές τους να ανήκουν στα αγρωστώδη και στα ψυχανθή, αντιστοίχως. Ωστόσο, πρόσφατες μελέτες δείχνουν ότι τόσο οι ιοί του σύμπλοκου των τεύτλων [BMYV, BWYV, BChV (ιός της χλώρωσης των τεύτλων Beet chlorosis virus), TuYV (ιός του ίκτερου του γογγυλιού Turnip yellows virus)] (Beuve et al., 2008) όσο και ο PLRV (Thomas και Hassan, 2002) έχουν μεγάλο εύρος ξενιστών που ανήκουν σε διαφορετικές οικογένειες. Η γεωγραφική κατανομή των τριών γενών της οικογένειας Luteoviridae είναι παγκόσμια με τα περισσότερα είδη να ενδημούν στις περιοχές όπου καλλιεργούνται οι κύριοι ξενιστές τους. Αν και κάποιοι ιοί της οικογένειας φαίνεται να περιορίζονται σε μια συγκεκριμένη χώρα ή περιοχή, αυτό πιθανώς οφείλεται στην έλλειψη εκτεταμένων μελετών. Οι λουτεοϊοί μεταδίδονται με αφίδες με έμμονο τρόπο, είναι κυκλοφορούντες αλλά όχι πολλαπλασιαζόμενοι. Η πρόσληψη και μετάδοση γίνεται τόσο από ενήλικα όσο και από προνύμφες, ενώ οι αφίδες διατηρούν την ιοφόρο ικανότητα για εβδομάδες και μετά από εκδύσεις. Ο συνδυασμός του περιορισμού των ιοσωματίων στον ιστό του φλοιώματος με την υποχρεωτική τους κυκλοφορία μέσα στο σώμα τον φορέων τους έχει ως αποτέλεσμα να απαιτούνται μεγαλύτεροι χρόνοι πρόσληψης (acquisition access period AAP), λανθάνουσας περιόδου (latent period) και μετάδοσης (inoculation access period IAP) (Herrbach, 1999). Η εξειδίκευση των αφίδων φορέων είναι ένα χαρακτηριστικό των ιών μελών της οικογένειας 4

18 Κεφ. 1 Εισαγωγή Luteoviridae με αποτέλεσμα ένας ιός να μεταδίδεται αποτελεσματικά από ένα ή από περιορισμένο αριθμό ειδών αφίδων. Το γεγονός αυτό είναι ιδιαίτερα χαρακτηριστικό στην περίπτωση του BYDV όπου είχαν ταυτοποιηθεί έξι κύριες ομάδες απομονώσεών του (οι ομάδες αυτές αποτελούν πλέον τα είδη των BYDVs CYDVs), με κριτήριο διαχωρισμού τους την εξειδίκευση των αφίδων φορέων (Gill, 1967, Rochow, 1969) Ιδιότητες των Ιοσωματίων Τα ιοσωμάτια έχουν διάμετρο 25 με 30 nm, εξαγωνικό περίγραμμα και δεν φέρουν φάκελο (Εικ. 1.1), παρουσιάζουν εικοσαεδρική συμμετρία (Τ=3), ενώ τα καψίδια δομούνται από δυο πρωτεΐνες (προϊόντα έκφρασης των ORFs 2 3 και 5) και περιέχουν το γενωμικό +ssrna 3. Ύπαρξη λιπιδίων ή υδατανθράκων δεν έχει αναφερθεί για κανένα μέλος της οικογένειας. Εικόνα 1.1: (Αριστερά) Διάγραμμα της προτεινόμενης δομής των ιοσωματίων των λουτεοϊών. (Κέντρο) Ιοσωμάτια του BYDV PAV. (Δεξιά) Ιοσωμάτια του PEMV 1 (ιός του μωσαϊκού με γλωσσίδια του αρακά 1 Pea enation mosaic virus 1). Οι μπάρες αντιπροσωπεύουν 100nm (D Arcy και Domier, 2005). Στους Luteo και Polero ιούς, το Mr των ιοσωματίων είναι περίπου 6 x 10 6, η ανωστική πυκνότητα (buoyant density) σε CsCl 1,40 g/cm 3 και το S 20w είναι S. Για τους Enamo ιούς το Mr είναι περίπου 5,6 x 10 6, η πυκνότητα αιώρησης σε CsCl 1,42 g/cm 3 και το S 20w είναι S. Τα ιοσωμάτια είναι μετρίως σταθερά και ανθίστανται σε μεταχειρίσεις με χλωροφόρμιο και μη ιονικά απορρυπαντικά, αλλά αποδιατάσσονται ύστερα από παρατεταμένη μεταχείριση σε υψηλές συγκεντρώσεις αλάτων, ενώ τα ιοσωμάτια των Luteo και Polero ιών είναι ανθεκτικά στο πάγωμα. Τα ιοσωμάτια περιέχουν ένα μόνο μόριο μολυσματικού γραμμικού +ssrna. Το γονιδίωμα, όσον αφορά το μέγεθός του, είναι σε γενικές γραμμές ομοιογενές και κυμαίνεται από νουκλεοτίδια (nt) στον BWYV έως 5.882nt στον PLRV. Το γενωμικό RNA δεν φέρει πολύ Α ουρά στο 2 Το ORF (Open Reading Frame) έχει αποδοθεί στα ελληνικά ως Ανοιχτό Πλαίσιο Ανάγνωσης ΑΠΑ. Στην παρούσα διατριβή θα χρησιμοποιείται ο όρος ORF. 3 +: θετικής πολικότητας, ss: single stranded μονόκλωνο 5

19 Κεφ. 1 Εισαγωγή 3 άκρο του, ενώ μια VPg (viral protein genome linked) πρωτεΐνη είναι συνδεδεμένη στο 5 άκρο του γονιδιώματος των PLRV και CYDV RPV του γένους Polerovirus και του PEMV 1 του γένους Enamovirus (D Arcy και Domier, 2005). Το γονιδίωμα των μελών της οικογένειας περιέχει πέντε με έξι ORFs τα οποία έχουν οριστεί ως ORF0 έως ORF6 (Πιν. 1.1). Το ORF0 είναι μοναδικό για τα μέλη των γενών Enamovirus και Polerovirus, ενώ τα ORFs 4 και 6 απουσιάζουν από το γένος Enamovirus (D Arcy και Domier, 2005). Τα ORFs 1 και 2 κωδικοποιούν τις πρωτεΐνες που σχετίζονται με την αναπαραγωγή των ιών και οι οποίες στους Luteo ιούς είναι πιο συγγενικές με τις ομόλογες της οικογένειας Tombusviridae, εν αντιθέσει με τις πολυμεράσες των Polero και Enamo ιών που συγγενεύουν με αυτές του γένους Sobemovirus. Και στα τρία γένη το ORF2 εκφράζεται με τη μεταφραστική αλλαγή του πλαισίου ανάγνωσης (translational frameshift) κατά την έκφραση του ORF1. Αυτό επικαλύπτει το ORF2 για λιγότερο από 20 νουκλεοτίδια στους Luteo ιούς, όμως στην περίπτωση των Polero και Enamo ιών η επικάλυψη αυτή περιλαμβάνει περισσότερα από 400 νουκλεοτίδια. Οι δομικές πρωτεΐνες των ιοσωματίων είναι η καψιδιακή πρωτεΐνη (coat protein CP) που εκφράζεται από το ORF3 καθώς και μια πρωτεΐνη υπερανάγνωσης (translational readthrough) που είναι προϊόν της σύντηξης του ORF3 και του γειτονικού ORF5. Το ORF4 είναι απαραίτητο για την διακυτταρική μετακίνηση του ιού. Η διαγονιδιακή αμετάφραστη περιοχή μεταξύ των ORFs 2 και 3 έχει μέγεθος σχεδόν 100nt στους Luteo ιούς, ενώ είναι περίπου το διπλάσιο στους Polero και Enamo ιούς (D Arcy et al., 2000). Πίνακας 1.1: Πρωτεϊνικά προϊόντα, μέγεθος (kda) και πιθανές λειτουργίες των διαφόρων ORFs (D Arcy και Domier, 2005). ORF Γένος Luteovirus Polerovirus Enamovirus Λειτουργία του Γονιδιακού Προϊόντος Πιθανώς παράγοντας πολ/σμού συνδεδεμένος με μεμβράνες Μοτίβα ελικασών στους Luteo ιόυς, πρωτεασών και VPg στους Polero ιούς Πιθανώς RdRp* Γονίδιο της CP Πιθανώς MP # Πιθανώς παράγοντας που σχετίζεται με την αφιδομετάδοση ή την σταθερότητα των ιοσωματίων Άγνωστη (*: RdRp RNA dependant RNA polymerase πολυμεράση, #: MP Movement protein πρωτεΐνη διακυτταρικής μετακίνησης) 6

20 Κεφ. 1 Εισαγωγή Γένη της Οικογένειας Luteoviridae Από την VII αναφορά της ICTV η οικογένεια Luteoviridae απαρτίζεται από τρία διακριτά γένη (Enamovirus, Luteovirus και Polerovirus). Τα κριτήρια με τα οποία διαχωρίστηκε η οικογένεια ήταν η οργάνωση του γονιδιώματος, η ομολογία των αλληλουχιών και οι στρατηγικές έκφρασης των γονιδίων. Η ισχύουσα κατάταξη είναι ουσιαστικά ο διαχωρισμός του παλιού γένους Luteovirus [που είχε ως τυπικό του είδος τον BYDV MAV (Francki et al., 1991)] σε δυο νέα, καθένα από τα οποία έχει μέλη τους ιούς που αρχικά ανήκαν στην υποομάδα Ι ή στην υποομάδα ΙΙ. Για να διατηρηθεί η ονοματολογία, το πρώτο γένος με τυπικό είδος τον BYDV PAV και μέλη του τους ιούς της πρώτης υποομάδας, πήρε το όνομα Luteovirus. Στο δεύτερο γένος, που απαρτίζεται από ιούς που ανήκαν στην υποομάδα ΙΙ, δόθηκε το όνομα Polerovirus το οποίο είναι αρκτικόλεξο και προέρχεται από τον potato leafroll virus που είναι και το τυπικό είδος του γένους. Το γένος Enamovirus, το τρίτο μέλος της οικογένειας Luteoviridae, περιλαμβάνει ένα μόνο είδος, τον PEMV 1. Όπως και στην περίπτωση του γένους Polerovirus το όνομα είναι αρκτικόλεξο και προέρχεται από το όνομα του μοναδικού του είδους (pea enation mosaic virus) (Mayo και D Arcy, 1999). Τα κριτήρια που χρησιμοποιούνται για τον διαχωρισμό των ειδών της οικογένειας Luteoviridae είναι τα εξής : 1. Διαφορές στο εύρος και στην εξειδίκευση του εύρους ξενιστών 2. Αδυναμία σταυροειδούς προστασίας 3. Διαφοροποίηση στην ορολογική εξειδίκευση με μονοκλωνικά ή πολυκλωνικά αντισώματα 4. Διαφορά στην αλληλουχία των αμινοξέων οποιουδήποτε γονιδιακού προϊόντος υψηλότερη του 10% (D Arcy και Domier, 2005) Γένος Enamovirus Tο γένος Enamovirus περιλαμβάνει ένα μόνο είδος, τον PEMV 1. Αν και ο PEMV εμφανίζει πολλά κοινά χαρακτηριστικά με μέλη της οικογένειας Luteoviridae όπως το μέγεθος και τη δομή των ιοσωματίων, την ικανότητα μετάδοσης από αφίδες με έμμονο τρόπο και την ισχυρή συγγένεια με τον ιστό του φλοιώματος, εντούτοις η ικανότητά του για διασυστηματική μετακίνηση και σε ιστούς εκτός του φλοιώματος του φυτού ξενιστή, η ικανότητα μηχανικής μετάδοσης όπως και η πεποίθηση ότι διέθετε διμερές γονιδίωμά καθιστούσε την κατάταξή του ένα αίνιγμα (Demler και De Zoeten, 1991). Η αλληλούχιση του γονιδιώματος του PEMV (Demler et al., 1993) ανέδειξε την χιμαιρική του φύση και διευκόλυνε την ταξινόμησή του. Ο PEMV αποτελεί πλέον ένα σύμπλοκο δύο διαφορετικών ιών. Τα RNA 1 και RNA 2, του θεωρητικά διμερούς γονιδιώματός του, 7

21 Κεφ. 1 Εισαγωγή μετονομάστηκαν σε PEMV 1 και PEMV 2 και κατατάχθηκαν στα γένη Enamovirus και Umbravirus αντιστοίχως (Mayo και D Arcy, 1999). Το γονιδίωμα του PEMV 1 αποτελείται από ένα γραμμικό μόρι ο +ssrna μεγέθους 5706nt το οποίο φέρει μια VPg στο 5 άκρο και κωδικοποιεί 5 ORFs η οργάνωση τ ων οποίων φαίνεται σ την Εικ Το Εικόνα 1.2: Διάγραμμα της οργάνωσης του γονιδιώματος και των προϊόντων μετάφρασης του PEMV 1. Οι μαύρες γραμμές αναπαριστούν RNA, τα μέγεθος των προϊόντων των πλαίσια ORFs, τα λεπτότερα πλαίσια προϊόντα μετάφρασης (το προβλεπόμενο μέγεθος αναγράφεται μέσα στο πλαίσιο) και ο γκρι κύκλος ORFs καθώς και οι πιθανές την VPg. Τα βέλη δίνουν τα προϊόντα μετάφρασης των αντίστοιχων ORFs σε σχέση με το RNA από το οποίο εκφράζονται (D Arcy και Domier, 2005). τους λειτουργίες συνοψίζονται στον Πίν Η έκφραση των ORFs 0, 2 και 3 γίνεται από την μετάφραση του γενωμικού RNA, ενώ των ORFs 3 και 5 από την μετάφραση του υπογενωμικού RNA του ιού (sub genomic RNA1 sgrna1) (D Arcy και Domier, 2005). Ένα ιδιαίτερο χαρακτηριστικό του PEMV 1, μοναδικό ανάμεσα στα είδη της οικογένειας, είναι η έλλειψη του ORF4 που κωδικοποιεί την MP των λουτεοϊών γεγονός που δεν του επιτρέπει τη διασυστηματική μετακίνηση μέσα στα φυτά ξενιστές χωρίς την συνδρομή του PEMV Γένος Luteovirus Το γένος Luteovirus, σύμφωνα με την VIII αναφορά της ICTV, απαριθμεί 5 τακτικά μέλη (Πίν. 1.2), με τυπικό μέλος τον BYDV PAV. Πίνακας 1.2: Τακτικά μέλη του γένους Luteovirus (D Arcy και Domier, 2005). Όνομα Ιού Συντομογραφία Ιός του κίτρινου νανισμού του κριθαριού MAV Barley yellow dwarf virus MAV BYDV MAV Ιός του κίτρινου νανισμού του κριθαριού PAS Barley yellow dwarf virus PAS BYDV PAS Ιός του κίτρινου νανισμού του κριθαριού PAV Barley yellow dwarf virus PAV BYDV PAV Ιός του καρουλιάσματος των φύλλων του φασολιού Bean leafroll virus BLRV Ιός του νανισμού της σόγιας Soybean dwarf virus SbDV 8

22 Κεφ. 1 Εισαγωγή Το γονιδίωμα των μελών του γένους αποτελείται από ένα γραμμικό +ssrna, μεγέθους περίπου 5600nt, το οποίο κωδικοποιεί 6 ORFs. Η οργάνωση των ORFs φαίνεται στην Εικ. 1.3, ενώ το μέγεθος και η λειτουργία των προϊόντων τους στον Πίν Κανένα από τα μέλη του γένους δεν διαθέτει VPg. Η έκφραση του ORF1 και 2 γίνεται από το γενωμικό RNA και των ORFs 3, 4, και 5 από το sgrna1 ενώ του ORF6 από την Εικόνα 1.3: Διάγραμμα της οργάνωσης του γονιδιώματος και των προϊόντων μετάφρασης του BYDV PAV. Οι μαύρες γραμμές αναπαριστούν RNA, τα πλαίσια ORFs και τα λεπτότερα πλαίσια προϊόντα μετάφρασης (το προβλεπόμενο μέγεθος αναγράφεται μέσα στο πλαίσιο). Τα βέλη δίνουν τα προϊόντα μετάφρασης των αντίστοιχων ORFs σε σχέση με το RNA από το οποίο εκφράζονται (D Arcy και Domier, 2005). μετάφραση του sgrna2 του ιού (D Arcy και Domier, 2005) Γένος Polerovirus Βλέπε παράγραφο

23 Κεφ. 1 Εισαγωγή 1.2 Γενος Polerovirus Μέλη του Γένους Η παγκόσμια εξάπλωση των μελών του γένους Polerovirus σε συνδυασμό με την ικανότητα μετάδοσής τους με αφίδες και την προσβολή οικονομικώς σημαντικών καλλιεργειών, τα έχει καταστήσει από τα πλέον διαδεδομένα και επιζήμια είδη ιών παγκοσμίως. Σύμφωνα με την VIII αναφορά της ICTV το γένος απαριθμεί 9 βέβαια μέλη (Πιν. 1.3) αν και πιο πρόσφατες μελέτες έχουν προτείνει την ένταξη τουλάχιστον 6 ακόμα ιών σ αυτό (Πιν. 1.4). Πίνακας 1.3: Τακτικά μέλη του γένους Polerovirus (D Arcy και Domier, 2005). Όνομα Ιού Συντομογραφία Ιός της χλώρωσης των τεύτλων Beet chlorosis virus BChV Ιός του ήπιου ίκτερου των τεύτλων Beet mild yellowing virus BMYV Ιός του δυτικού ίκτερου των τεύτλων Beet western yellows virus BWYV Ιός του κίτρινου νανισμού των δημητριακών RPV Cereal yellow dwarf virus RPV CYDV RPV Ιός του κίτρινου νανισμού των δημητριακών RPS Cereal yellow dwarf virus RPS CYDV RPS Ιός του αφιδομεταδιδόμενου ίκτερου των κολοκυνθοειδών Cucurbit aphid borne yellows virus CABYV Ιός του καρουλιάσματος των φύλλων της πατάτας Potato leafroll virus PLRV Ιός των κίτρινων φύλλων του ζαχαροκάλαμου Sugarcane yellow leaf virus ScYLV Ιός του ίκτερου του γογγυλιού Turnip yellows virus TuYV Πίνακας 1.4: Ιοί που έχει προταθεί η ένταξή τους στο γένος Polerovirus. Όνομα Ιού Συντομογραφία Ιός των κόκκινων φύλλων του καρότου 1 Carrot red leaf virus CtRLV Ιός του κίτρινου νανισμού του σιταριού GPV 2 Wheat yellow dwarf virus GPV WYDV GPV Ιός του χλωρωτικού νανισμού του ρεβιθιού 3 Chickpea chlorotic stunt virus CpCSV Ιός του καρουλιάσματος των φύλλων με νανισμό Cotton leafroll dwarf virus του βαμβακιού 4 CLRDV Ιός του αφιδομεταδιδόμενου ίκτερου του Melon aphid borne yellows virus πεπονιού 5 MABYV Ιός της παραμόρφωσης των νεύρων του καπνού Tobacco vein distorting virus TVDV (1: Huang et al., 2005, 2: Zhang et al., 2009, 3: Abraham et al., 2006, 4: Correa et al., 2005, 5: Xiang et al., 2008a) Ιοί που σχετίζονται με τον ίκτερο των τεύτλων (BChV, BMYV, BWYV, TuYV) Ο Roland το 1936 ήταν ο πρώτος ο οποίος υποστήριξε ότι το αίτιο του ίκτερου των τεύτλων ήταν ιολογικής φύσεως, ενώ αργότερα η Watson (1952) υπέδειξε ότι η ασθένεια ίσως να οφείλεται σε ένα σύμπλοκο διαφορετικών ιών. 10

24 Κεφ. 1 Εισαγωγή Η ταξινομική ιστορία του συμπλόκου ξεκίνησε το 1958 όταν οι Russel (1958) και Duffus (1960) χαρακτήρισαν σχεδόν ταυτόχρονα ιούς που σχετίζονταν με την εκδήλωση ίκτερου στα τεύτλα. Ο Russel ταυτοποίησε τον BMYV στη Μεγάλη Βρετανία, ενώ ο Duffus προσδιόρισε έναν παρόμοιο ιό στα δυτικά των Ηνωμένων Πολιτειών της Αμερικής (Η.Π.Α), στον οποίος αρχικά δόθηκε το όνομα ίκτερος του ραπανιού (radish yellows) και στη συνέχεια μετονομάστηκε σε BWYV. Τα Αμερικάνικα στελέχη του BWYV προκαλούσαν κιτρίνισμα και ανάσχεση της ανάπτυξης σε ένα μεγάλο αριθμό καλλιεργούμενων φυτών συμπεριλαμβανομένων των τεύτλων (Beta vulgaris), σπανακιού (Spinacia oleracea), μαρουλιού (Lactuca sativa) και μπρόκολου (Brassica oleracea var. Italica), ενώ είχαν ένα εκτεταμένο εύρος ξενιστών που περιλάμβανε περισσότερα από 150 είδη φυτών 23 δικότυλων οικογενειών (Duffus, 1964, Russel, 1965, Bjorling και Nilsson, 1966, Duffus, 1973). Λίγα χρόνια αργότερα, ένας ιός παρόμοιος του αμερικάνικου BWYV (BWYV like) εντοπίστηκε στη Μεγάλη Βρετανία σε ξενιστές οι οποίοι είχαν προηγουμένως αναφερθεί άνοσοι στον BMYV (Russel and Duffus, 1970a). Τα φυτά αυτά αποδείχθηκε ότι ήταν προσβεβλημένα με έναν ιό ορολογικώς και βιολογικώς συγγενή των αμερικάνικων απομονώσεων του BWYV (Russel and Duffus, 1970b). Παρόλα αυτά υπήρχαν ουσιαστικές διαφορές στο εύρος ξενιστών μεταξύ του BMYV και των ευρωπαϊκών απομονώσεων του BWYV. Αυτό είχε ως αποτέλεσμα τον ορισμό των ευρωπαϊκών απομονώσεων που προσέβαλλαν τα τεύτλα ως BMYV, ενώ θεωρήθηκαν ως απομονώσεις του BWYV όσες μόλυναν άλλες οικονομικώς σημαντικές καλλιέργειες, όπως είδη του γένους Brassica και το μαρούλι, αλλά όχι τα τεύτλα (Smith and Hinckes, 1985, Stevens et al., 1994). Οι διαφορές μεταξύ των ευρωπαϊκών και αμερικάνικων απομονώσεων του BWYV σε σχέση με την ικανότητα μόλυνσης ή μη των τεύτλων έδωσαν τροφή σε διάφορες συζητήσεις οι οποίες οδήγησαν την ICTV να εγκρίνει την πρόταση για μετονομασία των απομονώσεων του BWYV οι οποίες δεν προσβάλλουν τα τεύτλα σε TuYV (Mayo, 2002). O βιολογικός, ορολογικός και μοριακός χαρακτηρισμός του BMYV και μιας ευρωπαϊκής απομόνωσης του TuYV από μαρούλι (πρώην BWYV FL1) (Veidt et al., 1988), επιβεβαίωσε ότι ο BMYV και ο ευρωπαϊκός TuYV αποτελούν δυο διακριτά είδη (Guilley et al., 1995, Lemaire et al., 1995). Φυλογενετικές αναλύσεις ενός αριθμού γεωγραφικώς διαφοροποιημένων απομονώσεων του συμπλόκου των τεύτλων από διάφορες χώρες, προσδιόρισαν συγκεκριμένες περιοχές στο γονίδιο της CP, οι οποίες ήταν υψηλά συντηρημένες σε ιούς που απομονώθηκαν από το ίδιο φυτικό είδος (de Miranda et al., 1995). Εν αντιθέσει, οι αλληλουχίες του ORF0 (P0) παρουσίαζαν υψηλή παραλλακτικότητα. Διεξοδικές μελέτες των ομαδοποιήσεων της CP σε συνδυασμό με την ανάλυση των αλληλουχιών της P0 και 11

25 Κεφ. 1 Εισαγωγή των βιολογικών χαρακτηριστικών (ιδιαίτερα στους ξενιστές Capsella bursa pastoris και Chenopodium capitatum) είχαν ως αποτέλεσμα τον σαφή διαχωρισμό των στελεχών του TuYV από μαρούλι ή ελαιοκράμβη (Brassica napus) και του BMYV από ζαχαρότευτλα (Hauser et al., 2000a, Stevens et al., 2005b). Το 1994 οι Stevens et al. ταυτοποίησαν μια διακριτή απομόνωση των Polero ιών των τεύτλων στην Ευρώπη το οποίο δεν αντιδρούσε με το μονοκλωνικό αντίσωμα BYDV PAV IL 1 [το οποίο ανιχνεύει ειδικά τον BMYV (D Arcy, 1989)] και δεν μόλυνε τους, εξειδικευμένους για την ανίχνευση των BMYV και BWYV, φυτοδείκτες C. bursa pastoris και Montia perfoliata. Η απομόνωση αυτή θεωρήθηκε αρχικά ως ένα στέλεχος του BMYV. Λίγο αργότερα οι Liu et al. (1999) περιέγραψαν μια νέα ασθένεια που προκαλεί ίκτερο στα τεύτλα στις Η.Π.Α η οποία οφείλονταν σε ένα αφιδομετάδιδόμενο ιό ορολογικώς συγγενή του BWYV με περιορισμένο όμως εύρος ξενιστών σε σχέση με αυτόν. Για τις δυο αυτές απομονώσεις προτάθηκε από τους Liu et al (1999) το όνομα BChV ο οποίος πλέον αποτελεί ένα νέο είδος του γένους Polerovirus (Mayo, 2002). Συνεπώς το σύμπλοκο των Polero ιών των τεύτλων (ή ιών της ομάδας του BWYV) περιλαμβάνει τους BWYV, BMYV και BChV οι οποίοι αποτελούν τρία διακριτά είδη ιών που προσβάλλουν τα τεύτλα προκαλώντας συμπτώματα ίκτερου ή χλώρωσης, καθώς και τον συγγενικό TuYV ο οποίος όμως δε μολύνει τα ζαχαρότευτλα. Ιός της χλώρωσης των τεύτλων Beet Chlorosis Virus (BChV) Το μέγεθος του γραμμικού +ssrna γονιδιώματος κυμαίνεται από 5742 έως 5776nt στην αμερικάνικη (BChV California) και ευρωπαϊκή (BChV 2a) απομόνωση αντιστοίχως, ενώ αποτελείται από 6 ORFs τα οποία έχουν την τυπική οργάνωση των μελών του γένους Polerovirus (Hauser et al., 2002). O BChV μεταδίδεται αποτελεσματικά από την αφίδα Myzus persicae με έμμονο τρόπο, ενώ τα συμπτώματα στα τεύτλα περιλαμβάνουν μεσονεύρια χλώρωση, χλώρωση των φύλλων και νεκρωτικές κηλίδες (Liu et al, 1999). Αν και το εύρος ξενιστών του BChV είναι περιορισμένο σε σχέση με τα άλλα μέλη του συμπλόκου των τεύτλων, προσβάλλει τουλάχιστον 9 φυτικά είδη που ανήκουν σε 7 οικογένειες (Hauser et al., 2002, Beuve et al, 2008). Ιός του δυτικού ίκτερου των τεύτλων Beet Western Yellows Virus (BWYV) Ο BWYV (που συχνά αναφέρεται και ως BWYV USA) αποτελείται από ένα γραμμικό μόριο +ssrna μεγέθους 5666nt το οποίο περιλαμβάνει έξι ORFs που έχουν την τυπική οργάνωση των ιών του γένους Polerovirus. Μεταδίδεται με έμμονο τρόπο κυρίως από την αφίδα M. persicae και με 12

26 Κεφ. 1 Εισαγωγή μικρότερη αποτελεσματικότητα από την Macrosiphum euphorbiae (Stevens et al., 2005a). Μόλυνση από τον ιό προκαλεί στα ζαχαρότευτλα μεσονεύρια χλώρωση και χλώρωση των φύλλων (Duffus, 1973) που είναι πιο έντονη από τους υπόλοιπους ιούς του συμπλόκου. Μεταξύ των Polero ιών των τεύτλων, ο BWYV έχει το μεγαλύτερο εύρος ξενιστών προσβάλλοντας τουλάχιστον 34 φυτικά είδη 11 οικογενειών (Beuve et al, 2008). Ιός του ήπιου ίκτερου των τεύτλων Beet Mild Yellowing Virus (BMYV) Το γραμμικό +ssrna γονιδίωμα του BMYV έχει μέγεθος 5722nt και περιλαμβάνει έξι ORFs που έχουν την τυπική οργάνωση των ιών της οικογένειας Polerovirus (Guilley et al, 1995). Η μετάδοση γίνεται κυρίως από την αφίδα M. persicae με έμμονο τρόπο (Russell, 1962) και με μικρότερη αποτελεσματικότητα από την M. euphorbiae (Stevens et al., 2005a). Το εύρος ξενιστών του περιλαμβάνει τουλάχιστον 13 φυτικά είδη που ανήκουν σε 7 διαφορετικές οικογένειες (Beuve et al, 2008). Τα συμπτώματα στα ζαχαρότευτλα είναι παρόμοια με αυτά του BWYV, αλλά πιο ήπια, ενώ ορισμένα στελέχη εμφανίζουν έναν έντονο πορτοκαλί μεσονεύριο μεταχρωματισμό (Duffus, 1973). Ιός του ίκτερου του γογγυλιού Turnip Yellows Virus (TuYV) Το γονιδίωμα του TuYV (πρώην BWYV FL1) περιλαμβάνει ένα γραμμικό μόριο +ssrna μεγέθους περίπου 5600nt το οποίο κωδικοποιεί 6 ORFs με την τυπική οργάνωση του γένους Polerovirus (Veidt et al., 1988) και μεταδίδεται με έμμονο τρόπο κυρίως από την αφίδα M. persicae και δευτερευόντως από το είδος M. euphorbiae (Stevens et al., 2005a) Ιός των κόκκινων φύλλων του καρότου Carrot red leaf virus (CtRLV) Η ασθένεια του νανισμού με ποικιλόχρωση του καρότου (Carrot motley dwarf disease CMD) αναφέρθηκε για πρώτη φορά στην Αυστραλία (Stubbs, 1948). Αρχικά θεωρήθηκε ότι οφείλεται σε έναν μόνο ιό. Εκτενέστερες μελέτες της CMD στα καρότα απέδειξαν ότι η ασθένεια σχετιζόταν με την παρουσία τουλάχιστον δύο ιών (Παράγραφος ) και ότι η ύπαρξη του CtRLV είναι απαραίτητη για την δυνατότητα αφιδομετάδοσης της ασθένειας (Waterhouse και Murant, 1983). Η μετάδοσή του γίνεται από την αφίδα Cavariella aegopodii με έμμονο τρόπο (Watson et al., 1964). Η εξάπλωση του είναι παγκόσμια (Marco, 1991, Gibbs et al., 1996a, Gibbs et al., 1996b, Huang et al., 2005, Menzel et al., 2009), και περιλαμβάνει μόνο είδη της οικογένειας Umbelliferae 13

27 Κεφ. 1 Εισαγωγή (Watson et al., 1998, Vercruysse et al., 2000). Στα καρότα ο CtRLV προκαλεί κοκκίνισμα και κιτρίνισμα των φύλλων καθώς και μια περιορισμένη ανάσχεση της ανάπτυξης. Το γονιδίωμα του ιού αποτελείται από ένα γραμμικό μόριο +ssrna μεγέθους 5732nt το οποίο κωδικοποιεί 6 ORFs με την τυπική οργάνωση του γένους Polerovirus (Huang et al., 2005) Ιός του κίτρινου νανισμού των δημητριακών Cereal yellow dwarf virus (CYDV) Η ασθένεια των σιτηρών που σχετίζεται με συμπτώματα ίκτερου και νανισμού πρωτοαναφέρθηκε στην Καλιφόρνια των ΗΠΑ το 1950 στο κριθάρι (Oswald και Houston, 1951), ενώ έκτοτε έχει αναφερθεί στο σιτάρι, στη βρώμη και σε πολλά ακόμη είδη αγρωστωδών παγκοσμίως (D Arcy, 1995, Lapierre και Signoret, 2004). Αρχικά ως υπεύθυνο αίτιο της ασθένειας θεωρήθηκε ο BYDV (Rochow, 1969). Αν και περισσότερα από 25 είδη αφίδων έχουν αναφερθεί ως φορείς της ασθένειας, η μετάδοση κάθε ιικής απομόνωσης πραγματοποιείται εξειδικευμένα από ελάχιστα είδη. Ο συνδυασμός του κυριότερου φορέα με τις ορολογικές σχέσεις πέντε απομονώσεων του BYDV στις ΗΠΑ, οδήγησε τον Rochow στην κατάταξη αυτών σε δυο ομάδες (Ι και ΙΙ) και στη χρησιμοποίηση ενός συστήματος ονοματολογίας όπου το όνομα του ιού ακολουθείται από τρία γράμματα που υποδηλώνουν τον κυριότερο/ους φορέα/εις (π.χ. BYDV MAV που μεταδίδεται κυρίως από την Macrosiphon [=Sitobion] avenae) (Power και Gray, 1995). Ωστόσο τα τελευταία χρόνια αλληλούχιση και ανάλυση του γονιδιώματος διαφόρων απομονώσεων έδειξε ότι η πρώτη ομάδα αποτελείται από ιούς του γένους Luteovirus, ενώ η δεύτερη του γένους Polerovirus. Τα μέλη της δεύτερης ομάδας που μετονομάστηκαν από BYDV σε CYDV, αποτελούν πλέον διακριτά είδη και είναι τα CYDV RPV, CYDV RPS (κύριος φορέας η Rhopalosiphum padi), και CYDV GPV (κυριότεροι φορείς οι Schizaphis graminum και R. padi) (Lapierre και Signoret, 2004) αν και σε μια πρόσφατη μελέτη, για τον τελευταίο προτάθηκε το όνομα Wheat yellow dwarf virus GPV (Zhang et al., 2009). Ο τέταρτος ιός της δεύτερης ομάδας, BYDV RMV (κυριότερος φορέας η Rhopalosiphum maidis) αν και είναι συγγενικός των CYDVs, εντούτοις η έλλειψη δεδομένων για τη νουκλεοτιδική του αλληλουχία και μελετών πάνω στη βιολογία του, δεν επιτρέπει την κατάταξή του σε κάποιο γένος της οικογένειας Luteoviridae. Τα κοινά συμπτώματα της ασθένειας είναι ο νανισμός, το κιτρίνισμα και κοκκίνισμα των φύλλων, ωστόσο η συμπτωματολογική εικόνα εξαρτάται σε σημαντικό βαθμό από το είδος του ιού και το φυτό ξενιστή [π.χ. ο CYDV RPS Mex1 σχετίζεται με έντονο νανισμό, σπειροειδείς συστροφές (corkscrewing) και χαραγές στα φύλλα του σίτου]. Η γεωγραφική κατανομή του RPV είναι παγκόσμια, ο RPS περιορίζεται στις περιοχές του Μεξικού και της Καλιφόρνιας ενώ ο GPV 14

28 Κεφ. 1 Εισαγωγή εμφανίζεται κυρίως στην Βόρειο Βορειοδυτική Κίνα (Lapierre και Signoret, 2004). Το γονιδίωμα των CYDV αποτελείται από ένα γραμμικό μόριο +ssrna μεγέθους περίπου nt για τον CYDV RPV, 5662nt για τον CYDV RPS και 5673nt για τον CYDV GPV. Το γονιδίωμά τους κωδικοποιεί 6 ORFs με την τυπική οργάνωση του γένους Polerovirus Ιός του χλωρωτικού νανισμού του ρεβιθιού Chickpea chlorotic stunt virus (CpCSV) Δείγματα ρεβιθιού (Cicer arietinum) και κουκιών (Vicia faba) από το Άμπο της Αιθιοπίας τα οποία εκδήλωναν συμπτώματα χλώρωσης και νανισμού έδωσαν ισχυρά σήματα μόνο σε δοκιμές TAS ELISA στις οποίες χρησιμοποιήθηκε αντιορός έναντι του «BWYV» σε συνδυασμό με το, ειδικό κατά των λουτεοϊών, ευρέως φάσματος μονοκλωνικό αντίσωμα Β 2 5G4 (Abraham et al., 2006). Επιπλέον, κανένα από τα δείγματα αυτά δεν αντέδρασε με ειδικά αντισώματα για τους BLRV, PEMV, SbDV και BWYV που ενδημούν στις χώρες τις Δυτικής Ασίας και Βόρειας Αφρικής (Western Asia North Africa WANA) και προσβάλλουν ψυχανθή (Makkouk et al., 2003). Τα δεδομένα αυτά συνηγορούσαν υπέρ της υπόθεσης ύπαρξης ενός νέου ιού της οικογένειας Luteoviridae, το γονιδίωμα του οποίου αλληλουχήθηκε με αποτέλεσμα την ταυτοποιήση του CpCSV ο οποίος κατατάχθηκε στο γένος Polerovirus (Abraham et al., 2006). Στα ρεβίθια και στα κουκιά ο CpCSV προκαλεί ελαφρύ νανισμό ο οποίος συνοδεύεται από κιτρίνισμα και χλώρωση των νεύρων, κυρίως στα περιθώρια των παλαιότερων φύλλων. Στη φακή (Lens culinaris), προκαλεί ραβδωτό ίκτερο, ανάσχεση της ανάπτυξης και κοκκίνισμα σε συνδυασμό με μικρότερα και παραμορφωμένα φύλλα, ενώ δεν προκαλεί συμπτώματα στον αρακά (Pisum sativum) (Abraham et al., 2006). Η γεωγραφική του εξάπλωση φαίνεται να περιορίζεται σε χώρες της WANA (Αιθιοπία, Αίγυπτο, Σουδάν, Μαρόκο και Συρία) (Abraham et al., 2009). Το γονιδίωμα του CpCSV αποτελείται από ένα γραμμικό +ssrna μεγέθους 5900nt με οργάνωση τυπική του γένους Polerovirus κωδικοποιώντας 6 ORFs, με μόνη διαφορά το ότι το ORF 4 εκτείνεται μερικές βάσεις μετά το κωδικόνιο λήξης του ORF3 (CP). Μεταδίδεται από την αφίδα Aphis craccivora με έμμονο τρόπο. Τέσσερα είδη φυτών έχουν αναφερθεί ως ξενιστές του CpCSV: το ρεβίθι, τα κουκιά, η φακή και ο αρακάς (Abraham et al., 2006) Ιός του καρουλιάσματος των φύλλων με νανισμό του βαμβακιού Cotton leafroll dwarf virus (CLRDV) Η ασθένεια της κυάνωσης του βαμβακιού πρωτοαναφέρθηκε στην Κεντρική Αφρικανική Δημοκρατία το 1949 και έκτοτε έχει εμφανιστεί σε διάφορες περιοχές της Αφρικής, Ασίας και 15

29 Κεφ. 1 Εισαγωγή Αμερικής. Η ασθένεια μεταδίδεται με έμμονο τρόπο από την Aphis gossypii, ενώ τα προσβεβλημένα φυτά εκδηλώνουν ανάσχεση της ανάπτυξης λόγω της μείωσης του μήκους των μεσογονάτιων διαστημάτων, καρούλιασμα των φύλλων, έντονο πράσινο μεταχρωματισμό του φυλλώματος και κιτρίνισμα των νεύρων. Την ασθένεια προκαλεί ο ιός CLRDV. Δεν υπάρχουν πληροφορίες σχετικές με την αλληλουχία του συνόλου του γονιδιώματος του ιού (υπάρχουν μόνο τμηματικές της RdRp και της CP/MP) (Correa et al., 2005) Ιός του αφιδομεταδιδόμενου ίκτερου των κολοκυνθοειδών Cucurbit aphid borne virus (CABYV) Ο CABYV πρωτοαναφέρθηκε από τους Lecoq et al. το 1992 στην Γαλλία κατά την διερεύνηση του αίτιου για το έντονο κιτρίνισματος (ίκτερου) που παρατηρούνταν στα κολοκυνθοειδή από το Προσβολή από τον ιό προκαλεί συμπτώματα έντονου κιτρινίσματος και πάχυνσης των παλαιότερων φύλλων, η ένταση των οποίων διαφοροποιείται ανάλογα με την εποχή του έτους και είναι πιο έντονα κατά τους θερινούς μήνες. Η μετάδοση του ιού γίνεται με τα είδη M. persicae και A. gossypii με έμμονο τρόπο (Lecoq et al., 1992). Ως ξενιστές του CABYV έχουν αναφερθεί 16 διαφορετικά φυτικά είδη που ανήκουν σε 7 οικογένειες (Lecoq et al., 1992, Mnari Hattab et al., 2005, Xiang et al., 2008a). Αν και ο ιός έχει παγκόσμια γεωγραφική εξάπλωση, είναι ιδιαίτερα διαδεδομένος στη μεσογειακή λεκάνη και την Ασία (Lemaire et al., 1993, Abou Jawdah et al., 1997, Juarez, 2004, Mnari, 2005, Papayiannis et al., 2005, Bananej et al., 2006, Boubourakas et al., 2006, Tomassoli και Meneghini, 2007, Yardimci και Ozgonen, 2007, Xiang et al., 2008b). Το γονιδίωμά του αποτελείται από ένα γραμμικό +ssrna το οποίο κωδικοποιεί 6 ORFs που έχουν την τυπική οργάνωση του γένους Polerovirus, με το μέγεθος να ποικίλει μεταξύ των απομονώσεων από 5669 έως 5682nt (Guilley et al., 1994, Xiang et al., 2008a) Ιός του αφιδομεταδιδόμενου ίκτερου του πεπονιού Melon aphid borne virus (MABYV) Ο MABYV αποτελεί έναν υπό ένταξη ιό του γένους Polerovirus. Η ανακάλυψη του έγινε το 2006 από τους Xiang et al. στην Κίνα κατά τον έλεγχο κολοκυνθοειδών για την ύπαρξη του CABYV, όπου και παρατηρήθηκε η ύπαρξη ενός δεύτερου ιού σε φυτά με συμπτώματα ίκτερου. Το γονιδίωμά του αποτελείται από ένα γραμμικό +ssrna μεγέθους 5674nt, το οποίο κωδικοποιεί 6 ORFs σύμφωνα με την τυπική οργάνωση του γένους Polerovirus. H αλληλούχιση και ανάλυση του γονιδιώματος έδειξε μια σαφή διαφοροποίηση από τον CABYV. Ο MaBYV προσβάλει 7 16

30 Κεφ. 1 Εισαγωγή διαφορετικά φυτικά είδη της οικογένειας Cucurbitaceae και περιορίζεται στην Κίνα (Xiang et al., 2008a) Ιός του καρουλιάσματος των φύλλων της πατάτας Potato leafroll virus (PLRV) Η ασθένεια του καρουλιάσμαος των φύλλων της πατάτας πιθανώς είναι μια από τις πρώτες αναφορές ιολογικής ασθένειας και αναφέρθηκε στο Λανκασάιρ (Lancashire) της Μεγάλης Βρετανίας το Η μολυσματική φύση της ασθένειας αποδείχτηκε το 1916, ενώ η σημαντική ανακάλυψη ότι οι αφίδες την μεταδίδουν έγινε μέσα στην δεκαετία του Ο ιός καθαρίστηκε στα 1960, ενώ αντισώματα για την ανίχνευσή του παρήχθησαν το 1970 (Taliansky et al., 2003). Τα συμπτώματα της ασθένειας ποικίλουν ανάμεσα στις διάφορες απομονώσεις του ιού και περιλαμβάνουν (κυρίως σε φυτά που προέρχονται από μολυσμένους κονδύλους) ανάσχεση της ανάπτυξης, κιτρίνισμα των κατώτερων φύλλων, ευθρυπτότητα του ελάσματος καθώς και το χαρακτηριστικό καρούλιασμα των φύλλων προς τα πάνω. Τα συμπτώματα από πρωτογενείς μολύνσεις (φυτά που δεν προέρχονται από μολυσμένους κονδύλους αλλά μολύνθηκαν στον αγρό) είναι συνήθως πιο ήπια, εκτός κι αν αυτές πραγματοποιηθούν στην αρχή της καλλιεργητικής περιόδου που τα φυτά είναι ιδιαίτερα ευπαθή στη μόλυνση (Taliansky et al., 2003). Αρκετά είδη αφίδων που αποικίζουν την πατάτα είναι ικανά να μεταδώσουν τον PLRV, όμως η M. persicae αποτελεί τον πιο αποτελεσματικό φορέα, αν και είδη όπως τα Aulacorthum solani και Macrosiphum euphorbiae δεν θα πρέπει να υποτιμούνται επιδημιολογικά (Robert και Lemaire, 1999). Η εξάπλωση του ιού είναι παγκόσμια καθώς έχει απομονωθεί σ όλες τις περιοχές που καλλιεργείται η πατάτα (Guyader και Ducray, 2002), ενώ έχει εκτεταμένο εύρος ξενιστών, το οποίο απαριθμεί 43 φυτικά είδη που κατατάσσονται σε 10 οικογένειες (Thomas και Hassan, 2002). Το γονιδίωμά του αποτελείται από ένα γραμμικό μόριο +ssrna μεγέθους από nt το οποίο κωδικοποιεί 8 ORFs. Η οργάνωσή τους είναι παρόμοια με αυτήν Εικόνα 1.4: Προτεινόμενη οργάνωση του γονιδιώματος και υπογενωμικά RNA των υπολοίπων μελών του του PLRV. Οι γραμμές αντιπροσωπεύουν RNA και τα κουτιά ORF (Ashoub et al., γένους Polerovirus με μόνη 1998). διαφορά την πιθανή ύπαρξη δυο επιπλέον ORF στο 3 άκρο του γονιδιώματος (Εικ. 1.4). Η 17

31 Κεφ. 1 Εισαγωγή έκφραση των ORFs 6 και 7 γίνεται μέσω ενός δευτέρου υπογενωμικού RNA (sgrna2) (Ashoub et al., 1998) Ιός των κίτρινων φύλλων του σακχαροκάλαμου Sugarcane yellow leaf virus (ScYLV) Η ασθένεια των κίτρινων φύλλων (Yellow leaf disease YLD) που οφείλεται στον ScYLV αναφέρθηκε για πρώτη φορά στην Χαβάη στα τέλη της δεκαετίας του 1980 (Abu Ahmad et al., 2006a) και στη συνέχεια παρατηρήθηκε σ όλες τις περιοχές του κόσμου που καλλιεργείται το σακχαροκάλαμο μειώνοντας την ανάπτυξή του και την παραγωγή (Viswanathan et al., 2008). Ο ιός μεταδίδεται με έμμονο τρόπο από τις αφίδες Melanaphis sacchari, Rhopalosiphum maidis και Rhopalosiphum rufiabdominalis (Schenck και Lehrer, 2000). Εκτός από το σακχαροκάλαμο (Saccharum officinarum) που είναι και ο κύριος ξενιστής του, ο ScYLV προσβάλει άλλα 6 είδη της οικογένειας των αγρωστωδών (Poaceae) (Scagliusi και Lockhart, 2000, Schenck και Lehrer, 2000). Τα συμπτώματα εμφανίζονται κυρίως κατά την ωρίμανση των φυτών ως έντονο κιτρίνισμα των κεντρικών νεύρων στην κάτω πλευρά του φύλλου, το οποίο στη συνέχεια εξαπλώνεται πλευρικώς στο έλασμα, ενώ ακολουθεί νέκρωση των ιστών από την κορυφή του φύλλου και κατά μήκος του κεντρικού νεύρου. Μερικές φορές ο ιός προκαλεί και ερυθρωπό αποχρωματισμό της επιφάνειας του κεντρικού νεύρου στην άνω πλευρά του φύλλου (Viswanathan et al., 2008). Το γονιδίωμα του αποτελείται από ένα γραμμικό μόριο +ssrna μεγέθους nt, έχει την τυπική οργάνωση του γένους Polerovirus και κωδικοποιεί 6 ORFs. Η ανάλυση των αλληλουχιών δείχνει την ύπαρξη δυο τουλάχιστον συμβάντων ανασυνδυασμού (Moonan et al., 2000, Smith et al., 2000), ενώ μέχρι στιγμής έχουν βρεθεί 5 διαφορετικοί γενότυποι του ιού (BRA, CUB, PER, REU, IND) (Abu Ahmad et al., 2006b, Viswanathan et al., 2008) Ιός της παραμόρφωσης των νεύρων του καπνού Tobacco vein distorting virus (TVDV) Ο TVDV αναφέρθηκε για πρώτη φορά ως ο βοηθός ιός του συμπλόκου της ασθένειας της ροζέτας του καπνού (Tobacco Rosette Disease) (Smith, 1946), ενώ αργότερα βρέθηκε ότι συμμετέχει στο σύμπλοκο της ασθένειας της θαμνώδους κορυφής του καπνού (Tobacco Bushy Top Disease) (Gates, 1962). Η γεωγραφική του κατανομή (ως βοηθός ιός της TBTD) περιορίζεται στην υποσαχάρια Αφρική και στην Ασία (Mo et al., 2003). Ο TVDV προκαλεί στον καπνό παραμόρφωση των νεύρων των φύλλων τα οποία εκτός από την γενική παραμόρφωση μπορεί να εμφανίσουν και 18

32 Κεφ. 1 Εισαγωγή συστροφή προς τα κάτω, ιδιαίτερα της κορυφής τους. Παρόμοια συμπτώματα εμφανίζονται και σε άλλα σολανώδη (Smith, 1946). Ο ιός μεταδίδεται με έμμονο τρόπο κυρίως από την M. persicae, ενώ και το είδος Myzus pseudosolani (συν. Aulacorthum solani) έχει αναφερθεί ως λιγότερο αποτελεσματικός φορέας (Smith, 1946). Το γονιδίωμα του TVDV απαρτίζεται από ένα γραμμικό μόριο +ssrna μεγέθους 5920nt με την τυπική οργάνωση των Polero ιών Οργάνωση του Γονιδιώματος Η οργάνωση του γονιδιώματος είναι ίδια για όλα τα μέλη του γένους Polerovirus και θεωρείται ότι οι στρατηγικές έκφρασης και η λειτουργία των γονιδίων που προσδιορίζονται για ένα είδος θα εφαρμόζονται και σ όλα τα άλλα είδη του γένους (Mayo και Ziegler Graff, 1996, Mayo και Miller, 1999). Το γονιδίωμα των Polero ιών αποτελείται από ένα γραμμικό μόριο +ssrna, μεγέθους περίπου nt το οποίο είναι γνωστό ότι κωδικοποιεί 6 ORFs (με τα αντίστοιχα προϊόντα P0 P5). Οι Polero ιοί έχουν τρεις αμετάφραστες περιοχές (Non Coding Regions NCR) στο γονιδίωμά τους, δύο στα άκρα του RNA (5 και 3 ) και μία διαγονιδιακή NCR (intergenic NCR incr) μεταξύ του ORF2 και ORF3 (Εικ. 1.5). Εικόνα 1.5: Οργάνωση του γονιδιώματος του γένους Polerovirus. Ο αστερισκός υποδηλώνει την αλλαγή πλαισίου ανάγνωσης, τα θαυμαστικά την διαρρέουσα σάρωση και το κίτρινο βέλος την υπερανάγνωση. Οι γραμμές αναπαριστούν RNA τα πλαίσια ORFs και το κόκκινο βέλος την μεταγραφή του RNA (τροποποιημένο από Stevens et al., 2005a). Τα τρία ORFs που βρίσκονται πλησιέστερα προς το 5 άκρο εκφράζονται απευθείας από την μετάφραση του γενωμικού RNA (grna), ενώ τα ORFs που βρίσκονται καθοδικά της incr εκφράζονται από ένα sgrna. Η έναρξη της μετάφρασης του ORF0 ξεκινάει στο πρώτο AUG του γονιδιώματος μετά από την 5 NCR, ενώ ο μηχανισμός της διαρρέουσας σάρωσης (leaky scanning) επιτρέπει στο ριβόσωμα να παρακάμψει τη θέση αυτή έτσι ώστε να αρχίσει τη μετάφραση από το κωδικώνιο έναρξης του ORF1. Αν και το προϊόν μετάφρασης του ORF0 δεν έχει ανιχνευθεί ποτέ 19

33 Κεφ. 1 Εισαγωγή στα μολυσμένα φυτά, αναλύσεις μεταλλαξογένεσης έχουν δείξει την σημασία της έκφρασής του για την συσσώρευση του ιού (Mayo και Ziegler Graff, 1996, Sadowy et al., 2001). Επίσης η P0 του TuYV φαίνεται να εμπλέκεται ως καταστολέας της μετα μεταγραφικής σίγησης γονιδίων, η οποία καθιστά ικανούς τους Polero ιούς να υπερνικούν την αντίσταση του φυτού ξενιστή κατά τη μόλυνση (Pfeffer et al., 2002). Η μετάφραση του ORF2 επιτυγχάνεται με την ριβοσωμική αλλαγή πλαισίου ανάγνωσης (translational frameshift) κατά την μετάφραση του ORF1. Οι Reutenauer et al. (1993) έδειξαν ότι οι P1 και P2 είναι απαραίτητες για την μόλυνση και ότι και οι δύο περιέχουν αλληλουχίες που υποδηλώνουν κάποιο ρόλο στην αντιγραφή του ιού (Mayo και Ziegler Graff, 1996). Είναι γνωστό ότι η P1 περιέχει μοτίβα πρωτεασών καθώς και την αλληλουχία που αποτελεί τμήμα της VPg, η οποία είναι ομοιοπολικά συνδεδεμένη με το 5 άκρο του γονιδιώματος (van der Wilk et al., 1997). Η P2 φέρει τις περιοχές οι οποίες περιλαμβάνουν το κύριο μοτίβο («πυρήνα») GDD της ιικής RdRp (Mayo και Ziegler Graff, 1996). Πρωτεολυτική επεξεργασία της P1 ή της P1 + P2 πρόδρομης πολυπρωτεΐνης έχει ως αποτέλεσμα την εξαγωγή της VPg (van der Wilk et al., 1997) και πιθανώς και διαφόρων άλλων προϊόντων (Prüfer et al., 1999). Η μετάφραση των γονιδίων που αποτελούν το σύμπλεγμα πλησιέστερα στο 3 άκρο (ORFs 3,4 και 5) πραγματοποιείται μετά την σύνθεση του sgrna, η οποία θεωρείται ότι εξαρτάται από την εσωτερική έναρξη της αντιγραφής από την ιική RdRp κατά τον πολλαπλασιασμό του γονιδιώματος. Η P3 είναι η κύρια CP. Μελέτες μεταλλαξογένεσης του TuYV έδειξαν ότι η CP δεν εμπλέκεται άμεσα στον πολλαπλασιασμό του ιικού RNA σε σύστημα πρωτοπλαστών, αν και η συσσώρευση του ιικού RNA ήταν χαμηλότερη σε μεταλλάγματα που αδυνατούσαν να εκφράσουν το ORF3 απ ότι στις άγριες απομονώσεις (Reutenauer et al., 1993). Αυτό βέβαια θα μπορούσε να είναι συνέπια της αστάθειας του RNA κατά την απουσία καψιδίωσης. Ομοίως μπορεί να είναι ένδειξη ενός ακόμα άγνωστου ρυθμιστικού ρόλου της P3, όπως και μιας ανασταλτικής δράσης (αρνητικής ανάδρασης) του μη καψιδιωμένου RNA στην αντιγραφή (Mayo και Ziegler Graff, 1996). Το ORF5 εκφράζεται ως συνέπεια της μεταφραστικής υπερανάγνωσης του ORF3 καταστέλλοντας το κωδικώνιο λήξης αυτού, κάτι που έχει ως αποτέλεσμα η P5 να υπάρχει μόνο ως μια συγχωνευμένη πρωτεΐνη μαζί με την P3 (P3 + P5). Η περιοχή υπερανάγνωσης της P5 έχει αποδειχθεί μέσω δοκιμών ελλείψεων και μεταλλαξογένεσης ότι δεν ασκεί κανέναν έλεγχο στην έναρξη της μόλυνσης ή τον σχηματισμό των ιοσωματίων (Reutenauer et al., 1993). Παρόλα αυτά η πρωτεΐνη σχετίζεται με την εκδήλωση των συμπτωμάτων, συσσώρευση των ιοσωματίων και πιθανώς με τη διασυστηματική μετακίνηση του ιού στο φυτό (Brault et al., 1995, Ziegler Graff et 20

34 Κεφ. 1 Εισαγωγή al., 1996). Επίσης, η P5 παίζει ένα ρόλο «κλειδί» στην αποτελεσματικότητα μετάδοσης του ιού με αφίδες, την εξειδίκευση της μετάδοσης, καθώς και στην εμμονή του ιού μέσα στο σώμα των φορέων του (van den Heuvel et al., 1997). Παρόμοια με το ORF1, το ORF4 μεταφράζεται με ένα μηχανισμό διαρρέουσας σάρωσης. Για όλους τους λουτεοϊούς, με την εξαίρεση των SbDV και BMYV, η αλληλουχία που γειτνιάζει με το κωδικώνιο έναρξης του ORF4 είναι πιο ευνοϊκή για την έναρξη της μετάφρασης απ ότι αυτή του διπλανού ORF3 (Mayo και Ziegler Graff, 1996). Η ακριβής αναλογία των προϊόντων μετάφρασης P3 : P4 in vivo δεν είναι ακόμη ξεκάθαρη, αν και για τον PLRV έχει αναφερθεί ότι είναι 1 : 1 (Juszczuk et al., 2000). Η P4 είναι απαραίτητη για την διασυστηματική μετακίνηση του ιού στο φυτό ξενιστή και πιθανώς δρα ως μια εξειδικευμένη πρωτεΐνη διασυστηματικής μετακίνησης στο φλοίωμα Μετάδοση των Polero ιών Ένα από τα μεγαλύτερα εμπόδια στην επιβίωση ενός φυτικού ιού είναι η αδυναμία κίνησης του ξενιστή του. Έτσι η πλειονότητα των ιών αυτών βασίζεται σε άλλους οργανισμούς όπως έντομα, ακάρεα, νηματώδεις ή μύκητες για την εξάπλωσή τους στο φυσικό περιβάλλον Μετάδοση με αφίδες Τα έντομα είναι οι πιο κοινοί φορείς των ιών, με τις αφίδες (Hemiptera, Aphididae) να είναι υπεύθυνες για τη μετάδοση περίπου του 50% των φυτικών ιών (Nault, 1997) και να θεωρούνται οι σημαντικότεροι φορείς τους (Gray, 1996). Οι αφίδες είναι «κατασκευασμένες» με εξαιρετικό τρόπο για την εκπλήρωση του ρόλου τους ως φορείς. Τα νύσσοντος τύπου μυζητικά στοματικά μόρια έχουν την ικανότητα να αποθέτουν τα ιοσωμάτια μέσα στα φυτικά κύτταρα χωρίς να προκαλούν ανεπανόρθωτη ζημιά. Με τη δυνατότητα για αγενή αναπαραγωγή (παρθενογένεση) οι πληθυσμοί τους αυξάνονται με ιδιαίτερα υψηλούς ρυθμούς, καθιστώντας δυνατή την εκδήλωση επιδημιών. Επιπλέον, οι αφίδες έχουν παγκόσμια εξάπλωση, ενώ ως φορείς έχουν αναφερθεί πάνω από 200 είδη, ένας αριθμός που κατά πάσα πιθανότητα αποτελεί μια χονδροειδή υποεκτίμηση (Ng και Perry, 2004). Τα κυριότερα είδη αφίδων φορέων των μελών του γένους Polerovirus φαίνονται στον Πιν Οι Polero ιοί είναι έμμονοι και κυκλοφορούντες ιοί και ως εκ τούτου είναι απαραίτητο να μετακινηθούν μέσα στο σώμα των αφίδων, διαμέσω διαφόρων οργάνων με μηχανισμούς ενδοκύττωσης και εξωκύττωσης έως ότου εξέλθουν από τον φορέα παρασυρόμενοι από τη σίελο των αφίδων και προσβάλλουν ένα νέο ξενιστή. Η μετάδοση των Polero ιών μπορεί να διαχωριστεί 21

35 Κεφ. 1 Εισαγωγή Πίνακας 1.5: Κυριότερα είδη αφίδων φορέων ιών του γένους Polerovirus Ιός Κυριότεροι Φορείς Βιβλιογραφική Αναφορά PLRV Myzus persicae, Macrosiphum euphorbiae, Aulacorthum solani Robert και Lemaire, 1999 CABYV M.persicae, Aphis gossypii Lecoq et al., 1992 BWYV M. persicae, M. euphorbiae BMYV M. persicae, M. euphorbiae TuYV M.persicae, M. euphorbiae Stevens et al., 2005a BChV M. persicae CtRLV Cavariella aegopodii Vercruysse et al., 2000 CYDV RPV Rhopalosiphum padi CYDV RPS R. padi Lapierre & Signoret, 2004 CYDV GPV R. padi, Schizaphis graminum CpCSV Aphis craccivora Abraham et al., 2006 ScYLV Melanaphis sacchari, Rhopalosiphum maidis Schenck & Lehrer, 2000 TVDV M. persicae, A.solani Smith, 1946 CLRDV A. gossypii Correa et al., 2005 σε τέσσερεις διακριτές φάσεις: (α) την εισρόφησή τους από τα φυτικά κύτταρα στο τροφικό κανάλι των αφίδων, (β) την πρόσληψή τους διαμέσω του εντέρου, (γ) την κατακράτησή τους στους ιστούς και στην αιμόκοιλο και (δ) την μετάδοσή τους διαμέσω των σιελογόνων αδένων μέσα στον φλοίωμα ενός φυτού ξενιστή (Εικ. 1.6) (Gray και Gildow, 2003). (α) Εισρόφηση Κατά την διάρκεια της τροφικής τους δραστηριότητας οι αφίδες πρώτα ελέγχουν το φυτό εάν είναι ο κατάλληλος ξενιστής δοκιμάζοντας το περιεχόμενο των επιδερμικών κυττάρων και στη συνέχεια, αν αυτό βρεθεί κατάλληλο, εισάγουν τα στιλέτα τους κάτω από τον επιδερμικό ιστό έως ότου φτάσουν τους ηθμοσωλήνες από τους οποίους μπορούν να τραφούν με τον φυτικό χυμό (Brault et al., 2007). Οι αφίδες μπορούν να διατρήσουν με τα στιλέτα τους το φύλλο και να αρχίσουν να τρέφονται στο φλοίωμα σε περίπου λεπτά (Scheller και Shukle, 1986, Lamb et al., 1996). Από τη στιγμή που τα στιλέτα διεισδύσουν στο φλοίωμα η εισρόφηση των ιοσωματίων μπορεί να αρχίσει μέσα σε 1 5 λεπτά (Leonard και Holbrook, 1978). Η εισρόφηση των ιών που προσβάλουν του φλοίωμα δεν είναι εξειδικευμένη και πολλοί ιοί που δεν μεταδίδονται από αφίδες μπορούν να εισροφηθούν στο έντερο και στη συνέχεια να εξέλθουν από αυτό μαζί με τα μελιτώδη αποχωρήματα (Gildow, 1993). (β)πρόσληψη Ο πεπτικός σωλήνας των αφίδων αποτελείται από τέσσερα διαφορετικά μέρη: το πρόσθιο 22

36 Κεφ. 1 Εισαγωγή έντερο (foregut), το μεγεθυμένο πρόσθιο τμήμα (ή «στομάχι») του μέσου εντέρου (anterior midgut, stomach), το οπίσθιο τμήμα του μέσου εντέρου (posterior midgut) και το οπίσθιο έντερο (hindgut) (Εικ. 1.6). Ο τροφικός σωλήνας περιβάλλεται σ όλο το μήκος του με μια εξωκυτταρική μεμβράνη βάσης (basal lamina) η οποία εκκρίνεται από τα επιθηλιακά κύτταρα του εντέρου (Brault et al., 2007). Μετά την έναρξη της εισρόφησης οι Poleroιοί χρειάζονται περίπου ώρες για την ενεργό μεταφορά τους διαμέσω των επιθηλιακών Εικόνα 1.6: Κυκλοφορία των Polero ιών στο σώμα των αφίδων φορέων. κυττάρων του εντέρου έως την Τα προσροφημένα από το τροφικό κανάλι (fc) ιοσωμάτια (μαύρα απελευθέρωσή τους στην εξάγωνα), προσλαμβάνονται από το οπίσθιο μέσο έντερο (pmg), το οπίσθιο έντερο (hg) ή και τα δύο και περνούν στον αιμόλεμφο (he). Στη συνέχεια εισέρχονται στους βοηθητικούς σιελογόνους αδένες (asg) απ όπου απελευθερώνονται στα φυτά μέσω του αγωγού σίελου (sd). Fg: πρόσθιο έντερο, psg: πρωτεύοντες σιελογόνοι αδένες, sto: στομάχι (Brault et al., 2007). αιμόκοιλο (Garret, et al., 1996). Το εντερικό επιθήλιο δεν είναι ιδιαίτερα εκλεκτικό κατά την πρόσληψη των Polero ιών, καθώς οι περισσότεροι από αυτούς μπορούν να εισέλθουν στην αιμόκοιλο των αφίδων είτε είναι φορείς είτε όχι (Brault et al., 2007). Η μεταφορά των ιών διαμέσω του εντέρου γίνεται με έναν μηχανισμό τρανσκύττωσης. Τα ιοσωμάτια προσλαμβάνονται από την κοιλότητα του πεπτικού συστήματος (gut lumen) και απελευθερώνονται στον αιμόλεμφο διαπερνώντας κατά σειρά την κορυφαία (apical) κυτταρική μεμβράνη, το κυτόπλασμα, την βασική (basal) κυτταρική μεμβράνη και τέλος, τη μεμβράνη βάσης των επιθηλιακών κυττάρων. Η τρανσκύττωση λαμβάνει χώρα σε συγκεκριμένες περιοχές του πεπτικού σωλήνα που εξαρτώνται από το συνδυασμό ιού αφίδας (Brault et al., 2007). Το οπίσθιο τμήμα του μέσου εντέρου έχει αναφερθεί ως η περιοχή από την οποία εισέρχονται οι PLRV και BWYV, ενώ οι CYDV και BYDV προσλαμβάνονται από το οπίσθιο έντερο (Gray και Gildow, 2003). Ο CABYV είναι έως τώρα ο μοναδικός λουτεοϊός που έχει τη δυνατότητα να προσληφθεί και από τις δυο αυτές θέσεις (Reinbold et al., 2003). Αν και τα ιοσωμάτια προσλαμβάνονται από δύο διαφορετικές θέσεις του εντέρου, ο μηχανισμός τρανσκύττωσης φαίνεται να είναι παρόμοιος. Με βάση παρατηρήσεις υπερδομών, 23

37 Κεφ. 1 Εισαγωγή προτάθηκε ότι η πρόσληψη των λουτεοϊών από το έντερο πραγματοποιείται με έναν υποβοηθούμενο από κλαθρίνη (clathrin) ενδοκυττωτικό μηχανισμό, ενώ in situ πειράματα ανοσοσήμανσης αποκάλυψαν ότι τα ιοσωμάτια δεν βρίσκονται ποτέ ελεύθερα στο κυτταρόπλασμα (Garret et al., 1993, Gildow, 1999). (γ) Κατακράτηση Μετά την απελευθέρωση των ιοσωματίων στην αιμόκοιλο, ελάχιστα είναι γνωστά για τις αλληλεπιδράσεις των Polero ιών με τους ιστούς των αφίδων. Αν και δεν πολλαπλασιάζονται στις αφίδες φορείς τους, ούτε έχει παρατηρηθεί αύξηση του τίτλου (ιικού φορτίου) στις αφίδες, τα ιοσωμάτια διατηρούν τη μολυσματικότητά τους για πολλές εβδομάδες μέσα στο σώμα των φορέων. Θεωρητικά, ο περισσότερος από αυτόν το χρόνο δαπανείται στο εχθρικό περιβάλλον του αιμόλεμφου (Gray και Gildow, 2003). Οι αφίδες φιλοξενούν ενδοσυμβιωτικά βακτήρια του γένους Buchnera σε εξειδικευμένα κύτταρα τα οποία βρίσκονται στην κοιλιά τους και ονομάζονται μυκητοκύτταρα (mycetocytes) (Εικ. 1.7) (Ponsen, 1972). Αν και δεν είναι γνωστές όλες οι αλληλεπιδράσεις των βακτηρίων και των αφίδων, φαίνεται ότι παρέχουν βασικά αμινοξέα που οι αφίδες αδυνατούν να βιοσυνθέσουν (Baumann et al., 1995). Επιπλέον, τα βακτήρια παράγουν μεγάλες ποσότητες μιας πρωτεΐνης που Εικόνα 1.7: (a) Διάγραμμα της σχετικής θέσης του τροφικού καναλιού, του μυκητώματος (mycetome) και των σιελογόνων αδένων της αφίδας, καθώς και του μονοπατιού κυκλοφορίας των ιοσωματίων. (b) Ο υποθετικός ρόλος της συμβιονίνης στην κατακράτηση του ιού. (c) Ηλεκτρονική μικρογραφία των κυττάρων του Buchnera στο μυκήτωμα. Asg, psg: πρωτεύοντες και δευτερεύοντες σιελογόνοι αδένες αντιστοίχως, GroEl: συμβιονίνη, hg: οπίσθιο έντερο, m: μυκήτωμα, mg: μέσο έντερο, s: στομάχι, vp: ιοσωμάτια (van den Heuvel et al., 1999). ονομάζεται συμβιονίνη (symbionine), ενός ομολόγου της GroEL πρωτεΐνης της Escherichia coli (Baumann et al., 1995, Filichkin et al., 1997), που σχετίζεται με την αναδίπλωση πρωτεϊνών, τη διαμεμβρανική μεταφορά και την αποκατάσταση ζημιών από την καταπόνηση. Ενδιαφέρον παρουσιάζει το γεγονός ότι τα ομόλογα της συμβιονίνης από 24

38 Κεφ. 1 Εισαγωγή αφίδες φορείς και μη, έχουν την ικανότητα να προσδένονται σε καθαρισμένα ιοσωμάτια έξι διαφορετικών Luteo ιών (van Den Heuvel et al., 1999). Η ικανότητα πρόσδεσης δε σχετίζεται με την ικανότητα για μετάδοση ή την αποτελεσματικότητα αυτής, κάτι που οδηγεί στην υπόθεση ότι εάν η συμβιονίνη παίζει κάποιο ρόλο στην μετάδοση, σίγουρα δεν εμπλέκεται με την εξειδίκευση ως προς τον φορέα (van Den Heuvel et al., 1997). Αν η συμβιονίνη προσδένεται στα ιοσωμάτια in vivo δεν είναι ακόμη γνωστό. Εάν προσδένεται, τότε πιθανώς προστατεύει τον ιό από το ανοσοποιητικό σύστημα των αφίδων, ή δρα ως συνοδός, διατηρώντας ή τροποποιώντας το ιικό καψίδιο καθιστώντας έτσι δυνατή την είσοδό του στους βοηθητικούς σιελογόνους αδένες (Gray και Gildow, 2003). (δ) Μετάδοση Για να μεταδοθούν οι Polero ιοί πρέπει να περάσουν διαμέσω των σιελογόνων αδένων στο φλοίωμα των φυτών ξενιστών. Κατά την διάρκεια της τροφικής δραστηριότητας οι αφίδες εκκρίνουν σίελο μέσω των στιλέτων τους, μεταφέροντας και κατ επέκταση τα εν αιώρηση ιωσομάτια μέσα στα κύτταρα του φλοιώματος καθιστώντας τα ικανά για μόλυνση (Gray και Gildow, 2003). Το σιελογόνο σύστημα αποτελείται από δύο ζεύγη αδένων, τους πρωτεύοντες (primary salivary glands PSG) και τους βοηθητικούς (accessory salivary glands ASG), οι οποίοι βρίσκονται παράλληλα με κάθε πλευρά της κεφαλικής κάψας, ακριβώς πίσω από τους οπτικούς λοβούς του εγκεφάλου (Εικ 1.7) (Ponsen, 1972). Οι Polero ιοί που έχουν μελετηθεί, σχετίζονται εξειδικευμένα μόνο με τους ASG των αφίδων φορέων τους. Συγκεκριμένα, έχει παρατηρηθεί ότι τα ιοσωμάτια των απομονώσεων των Polero ιών που μεταδίδονται από αφίδες συσσωρεύονται στη μεμβράνη βάσης που περιβάλλει τους ASG. Ιοσωμάτια ελεύθερα στον αιμόλεμφο, ή προσδεμένα στη μεμβράνη βάσης άλλων οργάνων δεν έχουν παρατηρηθεί. Για την ολοκλήρωση της κυκλοφορίας στο σώμα του φορέα τα ιοσωμάτια πρέπει να διαπεράσουν την μεμβράνη βάσης και να προσδεθούν στην κυτταρική μεμβράνη των ASG απ όπου και θα μεταφερθούν, μεμονωμένα ή σε ομάδες, ενδοκυττωτικά έως τους σιελογόνους αγωγούς (salivary ducts). Σε αντίθεση με τις μεμβράνες του εντέρου, παρατηρείται υψηλή εξειδίκευση μεταξύ των Polero ιών και των ASG των αφίδων φορέων τους. Επιπλέον, έχουν χαρακτηριστεί δύο φράγματα για την μετάδοση αυτών, η εξωκυτταρική μεμβράνη βάσης που περιβάλει τους ASG και η κυτταρική μεμβράνη που γειτνιάζει με τον αιμόλεμφο (Peiffer et al., 1997). Η εξειδίκευση της μετάδοσης των Polero ιών ρυθμίζεται σε ποικίλα σημεία κατά το μονοπάτι κυκλοφορίας τους, με τα φράγματα της μετάδοσης να διαφέρουν για έναν ιό σε διαφορετικά είδη 25

39 Κεφ. 1 Εισαγωγή αφίδων, ή ακόμα και για διαφορετικές ιικές απομονώσεις σε ένα είδος φορέα. Αν λάβουμε υπόψη μας τα δεδομένα των μελετών που σχετίζονται με τα κυτταρικά φράγματα, μπορούμε να συμπεράνουμε ότι οι Polero ιοί έχουν εξελιχθεί ώστε να αναγνωρίζουν ποικίλες δομές των κυτταρικών επιφανειών των αφίδων και ότι πολλαπλές περιοχές του ιικού καψιδίου είναι πιθανόν να σχετίζονται με την αναγνώριση από τα κύτταρα των αφίδων (Gray και Gildow, 2003) Μηχανική μετάδοση Ένα από τα κύρια χαρακτηριστικά των ιών της οικογένειας Luteoviridae είναι ότι δεν μεταδίδονται μηχανικά με φυτικό εκχύλισμα (Waterhouse et al., 1988). Η συνήθης εξήγηση για αυτήν την αδυναμία είναι ότι, αν και οι λουτεοϊοί μπορούν να πολλαπλασιαστούν σε κύτταρα του μεσόφυλλου (ή τουλάχιστον σε πρωτοπλάστες που προέρχονται από κύτταρα του μεσόφυλλου), δεν είναι δυνατή η μετακίνησή τους από τα κύτταρα αυτά στο φλοίωμα (Taliansky και Barker, 1999). Πάραυτα έχουν αναφερθεί περιπτώσεις όπου μέλη του γένους Polerovirus εμφάνισαν την ικανότητα μηχανικής μετάδοσης με φυτικό εκχύλισμα. Οι Falk et al. (1979) ανέφεραν ότι σε περιπτώσεις μικτής μόλυνσης από τον BWYV και τον ιό της κηλιδωτής ποικιλοχλώρωσης του μαρουλιού (Lettuce speckles mottle virus LSMV, γένος Umbravirus), ήταν μερικές φορές δυνατή η μηχανική μετάδοση του BWYV με τη χρησιμοποίηση φυτικού εκχυλίσματος από αυτά. Επίσης, φυτά προσβεβλημένα από τον PLRV τα οποία στη συνέχεια μολύνθηκαν με τον ιό της ποικιλοχλώρωσης του καρότου (Carrot mottle virus CΜoV, γένος Umbravirus) παρουσίασαν μεγάλη αύξηση, τόσο της ποσότητας του ιού που μπορούσε να εξαχθεί από αυτά, όσο και του αριθμού των κυττάρων που δεν ανήκαν στο φλοίωμα και περιείχαν τον PLRV (Barker, 1989). Οι Mayo et al., (2000) θέλοντας να διερευνήσουν τις παραπάνω υποθέσεις πραγματοποίησαν πειράματα μηχανικής μετάδοσης δύο Polero ιών (PLRV, BMYV) με την βοήθεια δύο Umbra ιών, του PEMV 2 και του ιού της ροζέτας της αραχίδας (Groundnut rosette virus GRV). Τα αποτελέσματά τους έδειξαν ότι και οι δύο Polero ιοί μπορούσαν να μεταδοθούν μηχανικά κυρίως όταν ως βοηθητικός ιός χρησιμοποιήθηκε ο PEMV 2 και δευτερευόντως ο GRV. Επίσης, σε καμία περίπτωση δεν παρατηρήθηκε καψιδίωση του PEMV 2 στα ιοσωμάτια των Polero ιών. Αν και επιδημιολογικά στον αγρό η μηχανική μετάδοση των Polero ιών είναι ελάχιστης σημασίας, εντούτοις στο εργαστήριο μπορεί να διευκολύνει πρακτικές όπως τον καθαρισμό και διατήρηση αυτών, που υπό φυσιολογικές συνθήκες είναι αρκετά πιο επίπονες. 26

40 Κεφ. 1 Εισαγωγή Συμβιωτικές Σχέσεις Ένα πλήθος διαφορετικών ιών έχει εξελιχθεί με τέτοιο τρόπο ώστε να χρησιμοποιεί την ικανότητα για μετακαψιδίωση (transcapsidation) με μέλη της οικογένειας Luteoviridae ως το μοναδικό μέσο επίτευξης της μετάδοσής τους με αφίδες. Μικτές μολύνσεις αρκετών λουτεοϊών και ιών του γένους Umbravirus έχουν ως αποτέλεσμα την δημιουργία συγκεκριμένων συμπλόκων ασθενειών, με ενδιαφέροντα και κατά κάποιο τρόπο μοναδικά βιολογικά χαρακτηριστικά (Herrbach, 1999) Umbravirus Το όνομα του γένους Umbravirus προέρχεται από το λατινικό Umbra το οποίο κυριολεκτικά σημαίνει σκιά, ενώ μεταφορικά έχει την έννοια του φαντάσματος ή ενός απρόσκλητου επισκέπτη που συνοδεύει τον προσκαλεσμένο. Το όνομα αυτό αντικατοπτρίζει το γεγονός ότι οι ιοί αυτοί εξαρτώνται για την επιβίωσή τους στη φύση από έναν βοηθό ιό, που πάντοτε αποτελεί μέλος της οικογένειας Luteoviridae (Taliansky και Robinson, 2003). Οι Umbra ιοί διαφοροποιούνται από τους περισσότερους ιούς λόγω της απουσίας του γονιδίου της CP, γεγονός που έχει ως αποτέλεσμα την αδυναμία σχηματισμού συμβατικών ιοσωμάτιων (Syller, 2003). Ως εκ τούτου για την μετάδοσή τους είναι απαραίτητος ο σχηματισμός αφιδομεταδιδόμενων υβριδικών ιοσωματίων τα οποία αποτελούνται από το RNA τους ενκαψιδιωμένο στο πρωτεϊνικό καψίδιο του βοηθού λουτεοϊού (Taliansky et al., 2000). Στη φύση, κάθε Umbra ιός σχετίζεται με ένα συγκεκριμένο λουτεοϊό, αν και σε πειραματικές συνθήκες και άλλα μέλη της οικογένειας Luteoviridae μπορούν να αντικαταστήσουν τον φυσικό βοηθό ιό (Waterhouse και Murant, 1983, Cockbain et al., 1986). Η μετακαψιδίωση πάντως δεν είναι απαραίτητη για την συσσώρευση στα προσβεβλημένα φυτά, καθώς λειτουργίες όπως η προστασία και μετακίνηση του ιικού RNA δεν χρειάζονται την παρουσία των λουτεοϊών ή της CP τους (Demler et al., 1994). Επιπλέον, σε πειραματικές συνθήκες έχει αναφερθεί μηχανική μετάδοση των Umbra ιών χωρίς να είναι απαραίτητη η παρουσία του βοηθού ιού, επιτυγχάνοντας διασυστηματική μόλυνση χωρίς την ύπαρξη ιοσωματίων (Taliansky και Robinson, 2003). Μερικά παραδείγματα ασθενειών των φυτών που οφείλονται στην μικτή μόλυνση Polero και Umbra ιών φαίνονται στον Πίν RNAs που σχετίζονται με Polero ιούς (associated RNAs) Η ανάλυση των ιοσωματίων και του ιικού RNA κατά τον χαρακτηρισμό μιας απομόνωσης του BWYV (γνωστή ως BWYV ST9) που προερχόταν από ρεπάνι (Raphanus sativus) το οποίο 27

41 Κεφ. 1 Εισαγωγή παρουσίαζε χαρακτηριστικό κόκκινο μεταχρωματισμό, αποκάλυψε ότι εκτός από το γονιδίωμα του BWYV ST9 υπήρχε σε αφθονία ένα ακόμη RNA μεγέθους 2,8 kb (Falk και Duffus, 1984, Falk et al., 1989) το οποίο και ονομάστηκε ST9 σχετιζόμενο RNA (ST9 associated RNA ST9aRNA). Πίνακας 1.6: Ασθένειες που οφείλονται στην αλληλεπίδραση ιών του γένους Umbravirus και Polerovirus. Σύμπλεγμα Umbravirus Βοηθός Ιός Ασθένεια του νανισμού με ποικιλόχρωση του καρότου Carrot motley dwarf disease Ασθένεια της ροζέτας του καπνού Tobacco rosette disease Ασθένεια της θαμνώδους κορυφής του καπνού Tobacco bushy top disease Ασθένεια της κηλίδωσης του μαρουλιού Lettuce speckles disease Ιός της ποικιλοχλώρωσης του καρότου Carrot mottle virus (CMoV) Μιμητικός ιός της ποικιλοχλώρωσης του καρότου Carrot mottle mimic virus (CMoMV) Ιός της ποικιλοχλώρωσης του καπνού Tobacco mottle virus (TMoV) Ιός της θαμνώδους κορυφής του καπνού Tobacco bushy top virus (TBTV) Ιός της κηλιδωτής ποικιλοχλώρωσης του μαρουλιού Lettuce speckles mottle virus (LSMV) Βιβλιογραφική Αναφορά CtRLV Vercruysse et al., 2000 TVDV Smith, 1946 Mo et al., 2003 BWYV Falk et al., 1979 Η αλληλεπίδραση αυτή φαίνεται να αντιπροσωπεύει μια αμοιβαία ευεργετική σχέση μεταξύ του λουτεοϊού και του σχετιζόμενου με αυτόν RNA. Σε μικτές μολύνσεις ο BWYV προμηθεύει την CP για μετακαψιδίωση του ST9aRNA καθιστώντας το μόριο του αφιδομεταδιδόμενο και πιθανώς ικανό για διασυστηματική μετακίνηση στο φυτό. Με την σειρά του στις μικτές μολύνσεις το ST9aRNA προκαλεί αύξηση τόσο στην συγκέντρωση του γενωμικού RNA αλλά και της CP του BWYV στα κύτταρα. Αυτό έχει ως συνέπεια την ύπαρξη αρκετής CP για την ικανοποιητική καψιδίωση και των δυο παθογόνων, οδηγώντας στην αποτελεσματική μετάδοσή τους από την M. persicae (Herrbach, 1999). Το 1998 οι Watson et al. ανακάλυψαν ένα ακόμη RNA το οποίο σχετιζόταν με έναν Polero ιό και εμφάνιζε παρόμοια μοριακά και βιολογικά χαρακτηριστικά με το ST9aRNA. Το RNA αυτό βρέθηκε μαζί με τους CtRLV και CMoV στο σύμπλεγμα του διάστικτου νανισμού του καρότου στην Καλιφόρνια και ονομάστηκε σχετιζόμενο RNA με τον ιό των κόκκινων φύλλων του καρότου (Carrot red leaf virus associated RNA CRLVaRNA) (Watson και Falk, 1994, Watson et al., 1998). Σε κύτταρα με τριπλή μόλυνση, τα RNA των τριών παθογόνων καψιδιώνονται αποτελεσματικά από τη CP του βοηθού ιού CtRLV, καθιστώντας τα ικανά για αφιδομετάδοση (Herrbach, 1999). 28

42 Κεφ. 1 Εισαγωγή Δορυφορικά RNA που σχετίζονται με Polero ιούς Όπως είναι γνωστό δορυφορικά RNA συνοδεύουν αρκετούς σημαντικούς ιούς (Mayo et al., 1999). Όμως έως τώρα μόνο ένα πραγματικό δορυφορικό RNA (satrna) έχει βρεθεί να σχετίζεται με μέλη της οικογένειας Luteoviridae και πιο συγκεκριμένα του γένους Polerovirus. Αρχικά εντοπίστηκε μαζί με τον CYDV RPV απ όπου και πήρε το όνομα του RPV satrna. Έχει μέγεθος 322nt και παρουσιάζει παρόμοια μοριακά και βιολογικά χαρακτηριστικά με τα άλλα δορυφορικά RNA (Miller et al., 1991, Rasochova et al., 1997). Το RPV satrna έχει αρνητική επίδραση στον πολλαπλασιασμό του βοηθού ιού μειώνοντας τον τίτλο (ιικό φορτίο) του σε κύτταρα με μικτή μόλυνση, ενώ φαίνεται ότι, τουλάχιστον μερικώς, προστατεύει την βρώμη από τα σοβαρά συμπτώματα που προκαλεί η προσβολή από τον CYDV RPV (Rasochova και Miller, 1996). Ως βοηθός ιός του RPV satrna μπορεί να δράσει και ένα ακόμη μέλος του γένους Polerovirus. Μελέτες έδειξαν ότι ο BWYV μπορεί να στηρίξει την αναπαραγωγή του RPV satrna το οποίο έχει την ικανότητα να μετακαψιδιώνεται επιτυχώς, να μεταδίδεται από την M. persicae σε δικότυλα φυτά και στη συνέχεια να τα μολύνει μαζί με τον BWYV (Rasochova et al., 1997) Ιοειδή Αν και τα ιοειδή μεταδίδονται κυρίως μηχανικά (Diener, 1979), το ιοειδές των ατρακτοειδών κονδύλων της πατάτας (Potato spindle tuber viroid PSTVd) μπορεί να μεταδοθεί από την M. persicae μαζί με τον PLRV, από φυτά πατάτας ταυτόχρονα μολυσμένα με τα δύο παθογόνα. Με αυτόν τον τρόπο το PSTVd αποκτά την ικανότητα για μετάδοση από φυτό σε φυτό σε μεγάλες αποστάσεις (Syller et al., 1997) Μέθοδοι Διάγνωσης Για τη διάγνωση των ασθενειών που προκαλούν οι ιοί της Luteoviridae είναι απαραίτητη η εργαστηριακή εξέταση των υπόπτων φυτών καθώς παρόμοια συμπτώματα προκαλούν και άλλοι βιοτικοί ή αβιοτικοί παράγοντες. Οι κυριότερες μέθοδοι που χρησιμοποιούνται είναι οι εξής Βιολογικές Οι πρώτες τεχνικές που χρησιμοποιήθηκαν για την ανίχνευση και διάγνωση των ιών της οικογένειας Luteoviridae βασίζονταν κυρίως στη μετάδοσή τους με αφίδες. Στην περίπτωση αυτή μη ιοφόρα άτομα αφίδων τοποθετούνται σε συμπτωματικά φυτά για την πρόσληψη του ιού και στη συνέχεια μεταφέρονται σε υγιείς φυτοδείκτες για την μετάδοσή του. Το χρονικό διάστημα που 29

43 Κεφ. 1 Εισαγωγή απαιτείται για την πρόσληψη και μετάδοση του ιού είναι από λίγες ώρες έως μερικές μέρες. Τα συμπτώματα εκδηλώνονται συνήθως λίγες εβδομάδες μετά τη μόλυνση. Αν και οι αφίδομεταδόσεις είναι ακόμη σημαντικό μέσο για την ανίχνευση νέων ιών όπως νέων στελεχών αυτών, εντούτοις τα πολλά μειονεκτήματα της μεθόδου (απαραίτητη γνώση της βιολογίας του υπό εξέταση ιού, δοκιμές με πολλά είδη αφίδων, χρονοβόρος διαδικασία, κ.α.) την καθιστούν ακατάλληλη για το μαζικό έλεγχο δειγμάτων (D Arcy et al., 1999) Ορολογικές Τα πρώτα πολυκλωνικά αντισώματα (PAbs) για την ανίχνευση ιών της οικογένειας Luteoviridae παρήχθησαν την δεκαετία του 1970 (Paliwal, 1977), αν και δεν χρησιμοποιήθηκαν ευρέως για την ανίχνευση των φυτικών ιών παρά μετά την ανακάλυψη της ELISA (Clark και Adams, 1977). Η DAS ELISA έχει χρησιμοποιηθεί για την ανίχνευση και διάγνωση των Polero ιών σε διάφορα ιολογικά εργαστήρια (D Arcy et al., 1999), ενώ έχουν αναφερθεί και εφαρμογές της μεθόδου στην ανίχνευση του BWYV σε αφίδες (Herrbach, 1994). Παρόλα τα πλεονεκτήματα της μεθόδου, τα αποτελέσματα των ορολογικών δοκιμών με τη χρησιμοποίηση των PAbs πρέπει να αξιολογούνται προσεκτικά καθώς έχουν υπάρξει αναφορές για σταυροειδείς αντιδράσεις μεταξύ των μελών του γένους Polerovirus (D Arcy et al., 1999). Μονοκλωνικά αντισώματα (MAbs) ενάντια στους ιούς της οικογένειας Luteoviridae παρήχθησαν για πρώτη φορά στα μέσα της δεκαετίας του 1980 (Hsu et al., 1984). Έκτοτε έχουν χρησιμοποιηθεί εκτεταμένα για την ανίχνευση, προσδιορισμό, ακόμη και διαχωρισμό των στελεχών, κυρίως των BWYV, BMYV και PLRV, με την μέθοδο της TAS ELISA (D Arcy et al., 1999). Παρόλο το ότι είναι πιο εξειδικευμένη, έχει χαμηλότερο υπόβαθρο (background) σε σύγκριση με την DAS ELISA και τα δίνει πιο αξιόπιστα αποτελέσματα, έχουν αναφερθεί περιπτώσεις που δίνουν ισχυρές σταυροειδείς αντιδράσεις μεταξύ ειδών τόσο του ίδιου γένους όσο και διαφορετικών γενών της οικογένειας Luteoviridae (D Arcy et al., 1989) Μοριακές Η αλυσιδωτή αντίδραση της πολυμεράσης (polymerase chain reaction PCR) είναι σήμερα η πλέον διαδεδομένη μοριακή μέθοδος που χρησιμοποιείται ευρέως για την ανίχνευση των φυτικών ιών. Η εφαρμογή της για την ανίχνευση των ιών μελών της οικογένειας Luteoviridae έγινε για πρώτη φορά από τους Robertson et al. (1991). Η περιοχή που χρησιμοποιήθηκε περισσότερο για την ανάπτυξη των μεθόδων ανίχνευσης 30

44 Κεφ. 1 Εισαγωγή των μελών της οικογένειας είναι η CP, καθώς παρουσιάζει από τα υψηλότερα ποσοστά ομοιότητας μεταξύ αυτών. Η ομοιότητα αυτή όμως είχε ως αποτέλεσμα την αδυναμία διάκρισης κοντινών απομονώσεων και ως εκ τούτου οδήγησε τους ερευνητές στην επιλογή άλλων γονιδιακών περιοχών οι οποίες διαφοροποιούνται ανάμεσα στα είδη αυτά. Χαρακτηριστικό παράδειγμα είναι τα μέλη που σχετίζονται με τον ίκτερο των τεύτλων τα οποία ήταν αδύνατο να διαχωριστούν με βάση την αλληλουχία του γονιδίου της CP (Hauser et al., 2000a). Η επιλογή του ORF0 επιτρέπει την ειδική ανίχνευση των ιών αυτών (Hauser et al., 2000b, Vigano και Stevens, 2007). 31

45 Κεφ. 1 Εισαγωγή 1.3 Σκοπός της Εργασίας Η παρούσα εργασία είχε ως σκοπό την ανάπτυξη μιας μοριακής μεθόδου γενικής ανίχνευσης των μελών του γένους Polerovirus. Τα κριτήρια που επιλέχθηκαν για το σχεδιασμό αυτής ήταν η ικανότητα ανίχνευσης όσο το δυνατόν μεγαλύτερου εύρους διαφορετικών απομονώσεων σε συνδυασμό με την ευκολία και ταχύτητα εξαγωγής των αποτελεσμάτων. Επίσης, διερευνήθηκε η αιτιολογία του ίκτερου σε φυτά πιπεριάς και πραγματοποιήθηκαν προκαταρτικές μελέτες μοριακού χαρακτηρισμού ενός Polero ιού που ανιχνεύτηκε σε αυτά. 32

46 33

47 Κεφ.2 Ανάπτυξη Μοριακής Μεθόδου Γενικής Ανίχνευσης Polero ιών 2.1 Εισαγωγή Το γένος Polerovirus, μαζί με τα γένη Luteovirus και Enamovirus, ανήκει στην οικογένεια Luteoviridae. Εννέα ιοί έχουν καταταχθεί ως τακτικά μέλη στο γένος Polerovirus, ενώ 6 ακόμα έχουν προταθεί για ένταξη (Βλέπε Πιν. 1.3, 1.4, σελ. 10). Το γονιδίωμά τους αποτελείται από ένα γραμμικό μόριο +ssrna το οποίο κωδικοποιεί 6 ORFs (D Arcy και Domier, 2005). Η μετάδοσή τους γίνεται από αφίδες κατά τον έμμονο τρόπο μετάδοσης, με τις σχέσεις ιού φορέα να εμφανίζουν υψηλή εξειδίκευση (Gray και Gildow, 2003). Οι ιοί του γένους Polerovirus αποτελούν από τα πλέον επιβλαβή παθογόνα οικονομικώς σημαντικών καλλιεργειών όπως η πατάτα, τα ζαχαρότευτλα, το σακχαροκάλαμο, τα σιτηρά κ.α., καθώς επιφέρουν συχνά σημαντική μείωση στην παραγωγή (Loebenstein και Thottappilly, 2003, Stevens et al., 2004, Lehrer et al., 2009). Η διάγνωση των Polero ιών συχνά είναι δυσχερής λόγω των βιολογικών χαρακτηριστικών τους όπως ο εντοπισμός τους στο φλοίωμα, οι χαμηλές συγκεντρώσεις στους ιστούς των ασθενών φυτών και η αδυναμία μηχανικής μετάδοσης σε φυτοδείκτες, καθώς και της συμπτωματολογικής εικόνας η οποία παραπέμπει σε ποικίλα αίτια. Η ορολογική δοκιμή ELISA με τη χρησιμοποίηση μονοκλωνικών ή και πολυκλωνικών αντισωμάτων είναι η επικρατέστερη, μέχρι σήμερα, μέθοδος ανίχνευσης και ταυτοποίησης των Polero ιών. Εξαιτίας όμως της μεγάλης ομοιότητας των CPs των μελών της οικογένειας Luteoviridae, έχουν αναφερθεί πολυάριθμες περιπτώσεις σταυροειδών αντιδράσεων (D Arcy, et al., 1999), γεγονός που μειώνει την αξιοπιστία της. Η χρησιμοποίηση της PCR ως μεθόδου ανίχνευσης έχει μειώσει την ανάγκη για την εφαρμογή χρονοβόρων δοκιμών αφιδομετάδοσης ή πολλαπλών δοκιμών ELISA με διαφορετικά αντισώματα για την εξαγωγή αξιόπιστων αποτελεσμάτων. Η PCR εφαρμόστηκε για πρώτη φορά για την ανίχνευση των λουτεοϊών από τους Robertson et al. (1991). Η μέθοδος που αναπτύχθηκε χρησιμοποιούσε εκκινητές που υβριδοποιούνται στην περιοχή της CP και ήταν ικανή να ανιχνεύσει τους PLRV, BWYV και BYDV PAV. Έκτοτε έχουν αναπτυχθεί διάφορες μέθοδοι ειδικής ανίχνευσης μελών του γένους (Vercruysse et al., 2000, Hauser et al., 2000b, Malmstrom και Shu, 2004, Boubourakas et al., 2006, Vigano και Stevens, 2007, Beuve et al., 2008). Όμως, στην πλειονότητα αυτών οι εκκινητές υβριδοποιούνται στην περιοχή της CP, η οποία εμφανίζει μεγάλη ομοιότητα μεταξύ των μελών της οικογένειας Luteoviridae και η αλληλουχία της οποίας δεν μπορεί να χρησιμοποιηθεί για την ένταξη των απομονώσεων σε κάποιο γένος ή για τον προσδιορισμό του είδους στο οποίο ανήκουν (Mayo και D Arcy, 1999). 34

48 Κεφ.2 Ανάπτυξη Μοριακής Μεθόδου Γενικής Ανίχνευσης Polero ιών Μέχρι σήμερα δεν έχει αναπτυχθεί μοριακή μέθοδος ανίχνευσης του συνόλου των μελών του γένους Polerovirus. Αν λάβουμε υπόψη μας τη παγκόσμια γεωγραφική τους εξάπλωση, το πλήθος των ξενιστών τους, τη σημαντική μείωση της παραγωγής που προκαλούν και το γεγονός ότι η συμπτωματολογική εικόνα των προσβεβλημένων φυτών δεν είναι παθογνωμονική, καθίσταται απαραίτητη η ανάπτυξη μιας μεθόδου ικανή να ανιχνεύει γρήγορα και αξιόπιστα το σύνολο των Polero ιών ώστε να είναι εφικτή η ορθή διάγνωση του αιτίου μίας πιθανής προσβολής από τους ιούς αυτούς. 35

49 Κεφ.2 Ανάπτυξη Μοριακής Μεθόδου Γενικής Ανίχνευσης Polero ιών 2.2 Υλικά και Μέθοδοι Ιικές Απομονώσεις Για την ανάπτυξη της γενικής μεθόδου ανίχνευσης χρησιμοποιήθηκαν απομονώσεις 10 διαφορετικών ιών μελών (τακτικών και υπό ένταξη) του γένους Polerovirus, 2 μελών του γένους Luteovirus, 1 μέλους του γένους Enamovirus και 1 μέλους του γένους Sobemovirus. Αυτές περιλαμβάνουν είτε χαρακτηρισμένες απομονώσεις που στάλθηκαν στο εργαστήριο Φυτοπαθολογίας μετά από αίτημα που υποβλήθηκε σε εργαστήρια του εξωτερικού ή είναι ιοί που απομονώθηκαν στο εργαστήριο Φυτοπαθολογίας από προσβεβλημένα φυτά που εμφάνιζαν συμπτώματα προσβολής από Polero ιούς Χαρακτηρισμένες απομονώσεις Οι χαρακτηρισμένες απομονώσεις που χρησιμοποιήθηκαν στην παρούσα μελέτη δίνονται στον Πίν. 2.1 Πίνακας 2.1: Χαρακτηρισμένες απομονώσεις ιών που χρησιμοποιήθηκαν για την ανάπτυξη της γενικής μεθόδου ανίχνευσης. Ιός Απομόνωση Ξενιστής Προέλευση Κωδικός* BMYV 2ITB Beta vulgaris Lemaire, O. 1 BMYV BChV 2a B. vulgaris BChV ScYLV H Saccharum officinarum Komor, E. 2 ScYLV CpCSV ET fb Vicia faba Vetten, H. J. 3 CpCSV PLRV PV 0842 Solanum tuberosum PLRV PV 0601 Brassica napus BWYV DSMZ BLRV PV 0331 Pisum sativum BLRV PEMV 1 PEMV 1 RuCMV # Chenopodium quinoa MacFarlane, S. A. 4 RuCMV (*: Η κωδική ονομασία που χρησιμοποιείται στην παρούσα Η απομόνωση ανήκει στην ομάδα του BWYV, #: Ιός της χλωρωτικής ποικοιλοχλώρωσης των Rubus sp. Rubus chlorotic mottle virus. 1: Beuve et al., 2008, 2: Lehrer και Komor, 2008, 3: Abraham et al., 2006, 4: McGavin και MacFarlane, 2009) Απομονώσεις που εντοπίστηκαν στη χώρα μας Για τoν εντοπισμό απομονώσεων λουτεοϊών ελέγχθηκαν με RT PCR (reverse transcriptionpolymerase chain reaction αντίστροφη μεταγραφή αλυσυδωτή αντίδραση της πολυμεράσης) συνολικά 48 δείγματα τα οποία έφεραν τυπικά συμπτώματα προσβολής από μέλη της οικογένειας Luteoviridae. Τα είδη, ο αριθμός και η προέλευσή τους δίνονται αναλυτικά στον Πίν Οι απομονώσεις του CABYV ανιχνεύτηκαν σύμφωνα με την μέθοδο που αναπτύχθηκε από τους Boubourakas et al. (2006), ενώ για τον BYDV χρησιμοποιήθηκε η μέθοδος των Malmstrom και Shu (2004). 36

50 Κεφ.2 Ανάπτυξη Μοριακής Μεθόδου Γενικής Ανίχνευσης Polero ιών Πίνακας 2.2: Δείγματα που ελέχθησαν για την εύρεση απομονώσεων της οικογένειας Luteoviridae. Ξενιστής Αριθμός Περιοχή Επιστημονικό Όνομα Κοινό Όνομα Δειγμάτων Κωδικός* Έλεγχος Cucumis melo Πεπονιά Γλυκόβρυση Λακωνίας 1 CA1 Λεμεσός Κύπρου 5 CA2 6 CABYV Cucurbita pepo Κολοκυθιά Βασιλικά Ευβοίας 1 CA7 Daucus carota Άγριο Καρότο Ιεράπετρα Λασιθίου 1 RL1 Αριδαία Πέλλας 1 RL2 Anethum graveolens Άνηθος Ιεράπετρα Λασιθίου 1 RL3 CtRLV Apium graveolens Μαϊντανός Ν. Ιωνία Θεσ/νίκης 1 RL4 Petroselinum crispum Σέλινο Αριδαία Πέλλας 1 RL5 Fumaria officinalis Καπνόχορτο Ν. Ιωνία Θεσ/νίκης 1 BW1 Malva sylvestris Μολόχα Βοτανικός Αττικής 1 BW2 Papaver rhoeas Παπαρούνα Λιβανάτες Φθιώτιδας 1 BW3 Spinacia oleracea Σπανάκι Βασιλικά Θεσ/νίκης 1 BW4 Beta maritima Άγριο Τεύτλο Βασιλικά Θεσ/νίκης 1 BW5 Capsicum annuum Πιπεριά Λεχαινά Ηλείας 1 BW6 Ammi majus Ασπροκέφαλος Ν. Αρτάκη Ευβοίας 1 BW7 Beta vulgaris var. cicla Σέσκουλο Βόλος Μαγνησίας 1 BW8 Eruca sativa Ρόκα Άμμος Ημαθίας 1 BW9 BWYV Amaranthus sp. Βλήτο Καλαμάτα Μεσσηνίας 1 BW10 B.vulgaris var. esculenta Παντζάρι Μαραθώνας Αττικής 1 BW11 BMYV Sinapis arvensis Σινάπι Ψαχνά Ευβοίας 2 BW12 13 Capsella bursa pastoris Καψέλλα Ν. Ιωνία Θεσ/νίκης 1 BW14 TuYV # Lactuca sativa Μαρούλι Βέροια Ημαθίας 2 BW15 16 Brassica oleracea var. italica Μπρόκολο Ψαχνά Ευβοίας 2 BW17 18 Medicago sativa Μηδική Κατερίνη Πιερίας 1 BW19 Vicia faba Κουκιά Μαραθώνας Αττικής 2 BW20 21 Lens culinaris Φακή Λεπτή Έβρου 2 BW22 23 B. vulgaris var. saccharifera Ζαχαρότευτλο Βέροια Ημαθίας 12 BW24 35 Hordeum vulgare Κριθάρι Θεσ/νίκη 1 BY 1 BYDV [*: Η κωδική ονομασία που χρησιμοποιείται στην παρούσα μελέτη, #: Οι απομονώσεις BW1 23 είχαν βρεθεί θετικές για τον BWYV με τη δοκιμή ELISA (Dovas et al., 2001)] Για την ειδική ανίχνευση απομονώσεων των ιών CtRLV, BMYV, BWYV και TuYV σχεδιάστηκαν εκκινητές (Πίν. 2.3) που υβριδοποιούνται στην περιοχή της RdRp. Οι αλληλουχίες που χρησιμοποιήθηκαν για τον σχεδιασμό των εκκινητών και η γενικότερη μεθοδολογία αναφέρονται αναλυτικά στην παράγραφο Οι στοιχίσεις των αλληλουχιών και οι θέσεις των εκκινητών φαίνονται στην Εικ Για σύγκριση, ως προς την ικανότητα ανίχνευσης του CtRLV, χρησιμοποιήθηκε και η μέθοδος των Vercruysse et al. (2000). 37

51 Κεφ.2 Ανάπτυξη Μοριακής Μεθόδου Γενικής Ανίχνευσης Polero ιών Πίνακας 2.3: Αλληλουχίες εκκινητών για την ειδική ανίχνευση των CtRLV, BMYV, BWYV και TuYV και μέγεθος προβλεπόμενου προϊόντος. Ιός Εκκινητής Αλληλουχία 5 3 Προϊόν CtRLV CtRLV Up AAG TTA GAA ATM GCG CTT TGG AGA G* CtRLV Down CGA ARC CTG AGC ART CKG TSG G 175bp BMYV BMYV Up CGG ACA AGT CGT CGA TTT CAT GC BMYV Down GTA TCG ACT TAG GTC TGC ATC TAC AG 424bp BWYV BWYV Up ACC CTG CTY GCG CAG C BWYV Down GTA TTT CCC YAG GTC GGT GCT AAC TG 168bp TuYV TuYV Up GCA ATA GAC TTA CCA TCG ACC TCA ACC TuYV Down TTT GGG CTA AAA GGG TAC CAT CAC TC 114bp (*: Οι επεξηγήσεις των συμβόλων εκφυλισμού δίνονται στο παράρτημα Γ) Α Β 38

52 Κεφ.2 Ανάπτυξη Μοριακής Μεθόδου Γενικής Ανίχνευσης Polero ιών Γ Εικόνα 2.1: Στοίχιση νουκλεοτιδικών αλληλουχιών απομονώσεων των CtRLV (Α), BMYV (Β), BWYV (Γ) και TuYV (Δ). Τα τμήματα των στοιχίσεων που σκιάζονται παρουσιάζουν ομοιότητα άνω του 50%. Το κίτρινο και κόκκινο πλαίσιο δίνουν την θέση του ανοδικού και καθοδικού εκκινητή αντιστοίχως ενώ τα βέλη την φορά αυτών (5 3 ). Η αρίθμηση είναι σύμφωνη με το πλήρες γονιδίωμα του εκάστοτε ιού. Δ Εκχύλιση RNA Για την απομόνωση του ιικού RNA χρησιμοποιήθηκε μια μέθοδος ολικής εκχύλισης RNA η οποία βασίζεται στη χρήση γουανιδίνης ως χαοτροπικής ουσίας σε συνδυασμό με φίλτρα ινών γυαλιού (glass fiber GF) για την πρόσδεση των νουκλεϊκών οξέων (Δοβας, προσωπική επικοινωνία). Λόγω του εντοπισμού των Polero ιών στο φλοίωμα των ξενιστών τους, για την εκχύλιση του RNA χρησιμοποιήθηκαν μίσχοι φύλλων με τυπικά συμπτώματα προσβολής από λουτεοϊούς καθώς και το κατώτερο τέταρτο του ελάσματος. 39

53 Κεφ.2 Ανάπτυξη Μοριακής Μεθόδου Γενικής Ανίχνευσης Polero ιών Επιλογή των Εκκινητών Γενικής Ανίχνευσης Επιλογή της περιοχής υβριδοποίησης των εκκινητών Το σημαντικότερο βήμα στην ανάπτυξη μιας μοριακής μεθόδου ανίχνευσης ενός γένους ιών είναι ο σχεδιασμός των εκκινητών οι οποίοι θα αναγνωρίζουν το σύνολο ή όσον το δυνατόν περισσότερες απομονώσεις των διαφόρων ιών μελών του γένους. Για το σκοπό αυτό επιλέγονται περιοχές των οποίων η γονιδιακή αλληλουχία είναι συντηρημένη ανάμεσα στα είδη του γένους. Για τους Polero ιούς τα ORFs που εμφανίζουν το υψηλότερο ποσοστό ομοιότητας είναι αυτά τα οποία κωδικοποιούν την RdRp και την CP (ORFs 2 και 3, αντιστοίχως) (Mayo και Miller, 1999). Στην παρούσα μελέτη για τον σχεδιασμό των εκκινητών επιλέχθηκε η περιοχή της RdRp. Η προτίμηση της RdRp έναντι της CP οφείλεται στο γεγονός ότι, παρότι και οι δύο εμφανίζουν υψηλά ποσοστά συντήρησης, εντούτοις τα ORFs που βρίσκονται στο 3 άκρο του γονιδιώματος, όπως αυτό της CP, παρουσιάζουν μεγάλη ομοιότητα μεταξύ των Polero ιών και των Luteo ιών (Mayo και Miller, 1999). Συνεπώς η επιλογή της CP πιθανώς να οδηγούσε στην ανίχνευση και ιών εκτός του γένους Polerovirus. Επίσης, η ταξινομική κατάταξη των λουτεοϊών σε γένη με τη χρησιμοποίηση μόνο της αλληλουχίας της CP δεν είναι αξιόπιστη, με αποτέλεσμα να ορίζονται οι απομονώσεις για της οποίες έχει αλληλουχηθεί μόνο η CP, ως μη καταταχθέντα είδη της οικογένειας Luteoviridae (Mayo και D Arcy, 1999). Επιπλέον, υπάρχουν περιπτώσεις ανασυνδυασμένων λουτεοϊών όπως οι ScYLV, SbDV και BLRV, των οποίων η ένταξη σε κάποιο γένος δεν ήταν αρχικά δυνατή εξαιτίας της ομοιότητας ορισμένων τμημάτων του γονιδιώματός τους με μέλη του γένους Polerovirus και άλλων με αυτά του γένους Luteovirus. Στις περιπτώσεις αυτές η οργάνωση του 5 τμήματος του γονιδιώματός τους που εμφανίζει σαφή διαφοροποίηση ανάμεσα στα δυο γένη και κατ επέκταση η ομοιότητα της αλληλουχίας της RdRp με μέλη ενός εκ των δυο γενών αποτέλεσε τον βασικό κριτήριο ένταξής τους στο ένα ή το άλλο γένος (Rathjen et al., 1994, Moonan et al., 2000, Smith et al., 2000, Domier et al., 2002). Από το σύνολο του γονιδίου της RdRp το πλέον κατάλληλο τμήμα για τον σχεδιασμό των εκκινητών είναι αυτό που εμπεριέχει την αλληλουχία του «πυρήνα» της ικανότητας πολυμερισμού GDD, η οποία πλαισιώνεται από τέσσερα υψηλά συντηρημένα μοτίβα αμινοξέων παρόντα στο σύνολο των ιικών πολυμερασών (Poch et al., 1989, Bruenn, 1991) Σχεδιασμός των εκκινητών Για τον σχεδιασμό των εκκινητών επιλέχθηκαν 94 νουκλεοτιδικές αλληλουχίες μελών του γένους Polerovirus, 16 μελών του Sobemovirus και 2 του γένους Enamovirus (Πίν. 2.5) από την 40

54 Κεφ.2 Ανάπτυξη Μοριακής Μεθόδου Γενικής Ανίχνευσης Polero ιών διαδικτυακή βάση δεδομένων NCBI (http://www.ncbi.nlm.nih.gov/), οι οποίες και στοιχήθηκαν χρησιμοποιώντας τον αλγόριθμο ClustalX2 (Larkin et al., 2007). Αλληλουχίες του γένους Luteovirus δεν συμπεριλήφθηκαν στη στοίχιση λόγω της χαμηλής ομοιότητάς και διαφορετικής «προέλευσης» τους (βλέπε παράγραφο 1.1.3, σελ. 6) από αυτές των Polero ιών. Οι εκκινητές σχεδιάστηκαν με τις εξής προϋποθέσεις α) την ενίσχυση ενός τμήματος μεγαλύτερου των 500bp ώστε να παρέχονται όσο το δυνατόν περισσότερες πληροφορίες κατά την αλληλούχιση του προϊόντος, β) την επιλογή των υψηλότερα συντηρημένων περιοχών ώστε να έχουμε την μεγαλύτερη πιθανότητα ανίχνευσης γενετικά απομακρυσμένων στελεχών ή ιών, γ) την ικανοποιητική διαφοροποίηση στις περιοχές αυτές με τους Sobemo ιούς και Enamo ιούς ώστε να ελαχιστοποιήσουμε την πιθανότητα μη ειδικών αντιδράσεων και δ) την αποφυγή, εάν είναι δυνατόν, του σχηματισμού δομών φουρκέτας (hairpins) η αυτο υβριδοποίησης (self annealing). Οι εκκινητές που επιλέχθηκαν και πληρούν τα παραπάνω κριτήρια δίνονται στον Πίν Για την Πίνακας 2.4: Εκκινητές που επιλέχθηκαν για την ανάπτυξη της γενικής ανίχνευσης Polero ιών. Εκκινητής Αλληλουχία 5 3 PolGenRT AGG AAT GGC GAG G* PolGenDown1 ACC TCG ACY TTR AAN CC PolGenDown2 ACC TCG ACT TTR AAR CC PolGenUp1 GAY CAA YTG GTA GCC MG PolGenUp2 GAT GAR GGT CGY TAC CG (*: Οι επεξηγήσεις των συμβόλων εκφυλισμού δίνονται στο παράρτημα Γ) εύρεση της θερμοκρασίας τήξης και των ιδιοτήτων αυτών χρησιμοποιήθηκε το υπολογιστικό πρόγραμμα OligoCalc (http://www.basic.northwestern.edu/biotools/olig ocalc.html) (Kibbe, 2007). H θέση τους σε σχέση με το ORF2 φαίνεται στην Εικ Η στοίχιση που προέκυψε (χρησιμοποιώντας ενδεικτικά μια μόνο απομόνωση από κάθε ιό) καθώς και οι θέσεις που υβριδοποιούνται οι εκκινητές που σχεδιάστηκαν φαίνονται στην Εικ Εικόνα 2.2: Θέση των εκκινητών του Πίν. 2.5 σε σχέση με το ORF2. Τα πλαίσια αναπαριστούν ORFs και η μαύρη γραμμή RNA. Το πράσινο βέλος δηλώνει την θέση του PolGenUp1, το κόκκινο του PolGenUp2, το κίτρινο των PolGenDown1+2 και το μπλε τον PolGenRt. Επίσης, δίνεται η θέση του μοτίβου GDD. 41

55 Κεφ.2 Ανάπτυξη Μοριακής Μεθόδου Γενικής Ανίχνευσης Polero ιών Πίνακας 2.5: Απομονώσεις ιών που χρησιμοποιήθηκαν για τον σχεδιασμό εκκινητών γενικής ανίχνευσης. Ιός Πλήθος Κωδικός Αριθμός Γένος BChV 2 AF352024, AF BMYV 3 X83110, DQ132996, EF BWYV 7 EF051249, EF051250, EF051251, EF051252, EF051253, DQ886589, AF473561, EU091151, EU091150, EU091149, EU091148, EF488997, CABYV 17 EF488996, EU000535, EF063705, X76931, EF063708, EF063707, EF063704, EF063706, DQ , EF488996, DQ973123, EF CLRDV 3 GQ379224, EU871570, EU CpCSV 1 AY CtRLV 6 AY695933, AY325507, AY325504, AY325506, AY325503, AY CYDV RPS 1 AF CYDV RPV 5 L25299, EF521827, EF521830, EF521848, EF Polerovirus MABYV 1 EU AF453388, AF453389, AF453391, AF453392, AF453394, PLRV 13 AF453390, AF453393, AB001894, AY138970, X74789, Y07496, AF220151, EU AJ491141, AY236971, AJ491147, AF157029, AJ491144, AJ491132, AJ491138, AJ491135, AJ491133, AM072753, ScYLV 21 AM072751, AM072750, AM072755, AM072752, AJ491142, AJ491139, AJ491136, AM072754, AM085306, AJ249447, AM TuYV 10 X13063, EF126150, DQ973125, EF079903, EF079904, EF079905, EF079906, EF079907, EF079908, EF TVDV 3 EF529624, AJ704819, AF WYDV GPV 1 FM COMV 1 2 FJ669143, Z36903 LTSV 2 1 U31286 RGMoV 3 2 EF091714, DQ RuCMV 1 NC_ RYMV 4 2 AJ877020, AJ SBMV 5 2 AF055887, DQ Sobemovirus SCMoV 6 2 AY376451, AY SCPMV 7 1 M23021 SeMV 8 1 AY TRoV 9 1 AY PEMV 1 2 NC_003629, L04573 Enamovirus [1: Ιός της ποικιλοχλώρωσης της δακτυλίδας (Cocksfoot mottle virus), 2: Ιός της παροδικής ράβδωσης της μηδικής (Lucerne transient streak virus), 3: Ιός της ποικιλοχλώρωσης της ήρας (Ryegrass mottle virus), 4: Ιός της κίτρινης ποικιλοχλώρωσης του ρυζιού (Rice yellow mottle virus), 5: Ιός του μωσαϊκού του νότιου φασολιού (Southern bean mosaic virus), 6: Ιός της ποικιλοχλώρωσης του υπόγειου τριφυλλιού (Subterranean clover mottle virus), 7: Ιός του μωσαϊκού του νότιου μαυρομάτικου φασολιού (Southern cowpea mosaic virus), 8: Ιός του μωσαϊκού του είδους Sesbania grandiflora (Sesbania mosaic virus), 9: Ιός της ροζέτας του γογγυλιού (Turnip rosette virus)] 42

56 Κεφ.2 Ανάπτυξη Μοριακής Μεθόδου Γενικής Ανίχνευσης Polero ιών 43

57 Κεφ.2 Ανάπτυξη Μοριακής Μεθόδου Γενικής Ανίχνευσης Polero ιών 44

58 Κεφ.2 Ανάπτυξη Μοριακής Μεθόδου Γενικής Ανίχνευσης Polero ιών Εικόνα 2.3: Στοίχιση νουκλεοτιδικών αλληλουχιών της περιοχής της RdRp των Polero, Sobemo και Enamo ιών. Τα τμήματα των στοιχίσεων που σκιάζονται παρουσιάζουν ομοιότητα άνω του 50%. Το κόκκινο, πράσινο, κίτρινο και μπλε πλαίσιο δίνουν την θέση των PolGenUp1, PolGenUp2, PolGenDown1+2 και PolGenRt αντιστοίχως, ενώ τα βέλη την φορά αυτών (5 3 ). Η αρίθμηση είναι σύμφωνη με το πλήρες γονιδίωμα του PLRV. 45

59 Κεφ.2 Ανάπτυξη Μοριακής Μεθόδου Γενικής Ανίχνευσης Polero ιών Σχεδιασμός Βέλτιστου Πρωτοκόλλου RT PCR Η RT PCR επιλέχθηκε να αναπτυχθεί σε δυο χωριστά στάδια, αρχικά πραγματοποιώντας την RT και στη συνέχεια την PCR. Οι εκκινητές που σχεδιάστηκαν περιλάμβαναν δυο ανοδικούς (PolGenUp1+2) και δυο καθοδικούς (PolGenDown1+2) οι οποίοι προορίζονταν για την χρησιμοποίηση τους στην PCR και έναν καθοδικό αποκλειστικά για την RT (PolGenRT). Για την βελτιστοποίηση του πρωτοκόλλου έγιναν οι εξής δοκιμές. 1. Επιλογή πραγματοποίησης της RT με τον καθοδικό εκκινητή PolGenRT ή με τον καθοδικό ο οποίος θα χρησιμοποιηθεί στη συνέχεια και στην PCR. 2. Επιλογή βέλτιστης συγκέντρωσης του εκκινητή στην RT καθώς και θερμοκρασία στην οποία θα πραγματοποιηθεί αυτή. 3. Επιλογή καταλληλότερου συνδυασμού εκκινητών στην PCR και συγκέντρωσης αυτών. 4. Επίδραση των προσθετικών [DMSO, μπεταΐνη (Betaine)] και του συμπαράγοντα χλωριούχο μαγνήσιο (MgCl 2 ) στην εξειδίκευση της μεθόδου. 5. Επιλογή του καταλληλότερου θερμικού προφίλ στην PCR και μορφή αυτού [κλιμακωτή θερμοκρασία υβριδοποίησης (ramped annealing), (touch down PCR)] Ανάλυση των Προϊόντων της PCR με Ηλεκτροφόρηση Η ανάλυση των προϊόντων της PCR πραγματοποιήθηκε σε συσκευή οριζόντιας ηλεκτροφόρησης με μέσο διαχωρισμού πηκτή αγαρόζης 1,5% w/v σε διάλυμα ηλεκτροφόρησης 1x TAE (Tris Acetate EDTA: 0,04M Tris Acetate, 0,001M EDTA). Η πηκτή παρασκευάστηκε με τη διάλυση UltraPure αγαρόζης (Invitrogen, The Netherlands) σε 1x ΤΑΕ και θέρμανσης μέχρι βρασμού, στη συνέχεια το διάλυμα αποχύθηκε στην τράπεζα ηλεκτροφόρησης και αφέθηκε να κρυώσει σε θερμοκρασία δωματίου. 10μl προϊόντος της PCR αναμείχθηκαν με 1μl διαλύματος φόρτωσης [loading buffer: 50% γλυκερόλη, 0,01Μ NaH 2 PO 4 (ph 7,0), 0,4% κυανούν της βρωμοφαινόλης] και τοποθετήθηκαν στα φρεάτια της πηκτής. Για τον προσδιορισμό του μεγέθους των προϊόντων της PCR συμπεριλήφθηκε στην ηλεκτροφόρηση και ένας δείκτης μοριακού βάρους (Μ.Β) (100bp DNA Ladder, New England Biolabs). Η τάση που εφαρμόστηκε ήταν περίπου 5 volt για κάθε εκατοστό απόστασης των ηλεκτροδίων, ενώ αφέθηκε να «τρέχει» έως ότου η χρωστική μεταναστεύσει (η ταχύτητα μετανάστευσής της σε πηκτή αγαρόζης 1,5% είναι παρόμοια με DNA μεγέθους 200bp) κοντά στην άκρη της πηκτής αγαρόζης (Sambrook και Russell, 2001). Μετά το πέρας της ηλεκτροφόρησης η πηκτή εμβαπτίστηκε σε υδατικό διάλυμα βρωμιούχου αιθιδίου (0,5mg/ml) για 46

60 Κεφ.2 Ανάπτυξη Μοριακής Μεθόδου Γενικής Ανίχνευσης Polero ιών 30 λεπτά σε θερμοκρασία δωματίου. Στη συνέχεια, η πηκτή τοποθετήθηκε σε τράπεζα φθορισμού υπεριώδους (UV transiluminator) για την απεικόνιση των φθοριζουσών ζωνών (bands) του DNA Αλληλούχιση Προϊόντων PCR Για την αλληλούχιση των προϊόντων πραγματοποιήθηκε αρχικά μια PCR όπου πολλαπλασιάστηκε η αλληλουχία στόχος σε 5 διαφορετικούς μικροσωλήνες. Στη συνέχεια, το σύνολο του διαλύματος των μικροσωλήνων τοποθετήθηκε σε μια θέση στην πηκτή αγαρόζης και ηλεκτροφορήθηκε όπως περιγράφεται στην παράγραφο Κατά την απεικόνιση στο υπεριώδες η φθορίζουσα ζώνη αφαιρέθηκε με νυστέρι και ακολούθησε η εξαγωγή του DNA με το κιτ καθαρισμού NucleoTrap purification kit (Macherey Nagel, Duren, Germany) σύμφωνα με τις οδηγίες του παρασκευαστή. Το καθαρό πλέον DNA στάλθηκε για αλληλούχιση στη GATC Biotech AG (Konstanz, Germany) Φυλογενετική Ανάλυση Για την μελέτη της ικανότητας εξαγωγής σωστών φυλογενετικών υποθέσεων από την αλληλουχία που ενισχύεται με την γενική μέθοδο ανίχνευσης, πραγματοποιήθηκε κατασκευή φυλογενετικών δέντρων της τμηματικής αλληλουχίας αυτής και του συνόλου της προβλεπόμενης αλληλουχίας της P2 πρωτεΐνης, τα οποία και συγκρίθηκαν μεταξύ τους. Οι απομονώσεις των ιών που χρησιμοποιήθηκαν για τις φυλογενετικές αναλύσεις δίνονται στον Πίν Αρχικά οι προβλεπόμενες αμινοξικές αλληλουχίες στοιχήθηκαν με τη χρήση του αλγόριθμου MAFFT έκδοση 6 (http://align.bmr.kyushu u.ac.jp/mafft/online/server/) (Katoh και Toh, 2009). Στη συνέχεια, εκτιμήθηκε το πλέον κατάλληλο μοντέλο αντικατάστασης αμινοξέων με βάση το πρόγραμμα ProtTest έκδοση 2.4 (Abascal et al., 2005), χρησιμοποιώντας το BIC (Bayesian Information Criterion) στατιστικό κριτήριο για την εύρεση του μοντέλου που περιγράφει καλύτερα τα δεδομένα. Τέλος, τα φυλογενετικά δέντρα υπολογίστηκαν με τη μέθοδο της μέγιστης πιθανοφάνειας (Maximum Likelihood, ML) με τη βοήθεια του προγράμματος PhyML έκδοση 3.0 (Guindon και Gascuel, 2003). Για την εκτίμηση της αξιοπιστίας της φυλογενετικής υπόθεσης χρησιμοποιήθηκε η δοκιμή του κατά προσέγγιση πηλίκου πιθανοφανειών (approximate Likelihood Ratio Test alrt) (Anisimova και Gascuel, 2006) σύμφωνα με την μη παραμετρική διαδικασία των Shimodaira Hasegawa (SH). Λόγω του ότι η εκτίμηση σύμφωνα με το SH alrt κριτήριο τείνει να είναι συντηρητική, χρησιμοποιήθηκε η υπόθεση των Buzan et al. (2008) σύμφωνα με την οποία οι κλάδοι με τιμές από 80 90% αναπαριστούν μια μετρίως επεξηγημένη φυλογένεια, ενώ με τιμές >90% μια καλώς επεξηγημένη φυλογένεια. 47

61 Κεφ.2 Ανάπτυξη Μοριακής Μεθόδου Γενικής Ανίχνευσης Polero ιών Για τις συγκρίσεις των αλληλουχιών ως προς την ομοιότητα των αμινοξικών αλληλουχιών τους, χρησιμοποιήθηκε η παράμετρος p distance του φυλογενετικού πακέτου MEGA έκδοση 4,0 (Tamura et al., 2007, Kumar et al., 2008). Το φυλογενετικό περιεχόμενο της περιοχής ενίσχυσης εκτιμήθηκε ως προς την δυνατότητα ανακατασκευής των σωστών φυλογενετικών σχέσεων με τη βοήθεια της μεθόδου Likelihood Mapping του προγράμματος TREEPUZZLE έκδοση 5.2 (Strimmer και von Haeseler, 1997). Πίνακας 2.6: Απομονώσεις ιών που χρησιμοποιήθηκαν για την κατασκευή φυλογενετικών δέντρων της P2. Ιός Απομόνωση Κωδικός Αριθμός Ιός Απομόνωση Κωδικός Αριθμός BChV BChV 2a AF MABYV EU BChV CR AF Fr1 AF45339 IPP DQ Noir AF BMYV Broom's Barn EF PLRV Zim13 AF ITB X83110 Australia D13953 BWYV USA AF VIRUBRA 1/047 EU CHN EU REU YL1a AM CABYV N X76931 CHN YL1 AM ScYLV CLRDV PV1* GQ PER YL1b AM CpCSV Et fb am1 AY BRA YL1 AM CtRLV UK1 AY TuYV BWYV FL1 X RPV EF Baoshan* AF TVDV 092 EF Longlin EF CYDV RPV NY RPV L25299 WYDV GPV FM EF PEMV 1 WSG NC_ CYDV RPS RPV Mex 1 AF (*: Οι απομονώσεις αυτές δεν χρησιμοποιήθηκαν στο δέντρο τις συνολικής P2 πρωτεΐνης λόγω της ύπαρξης τμηματικής μόνο αλληλουχίας) 48

62 Κεφ.2 Ανάπτυξη Μοριακής Μεθόδου Γενικής Ανίχνευσης Polero ιών 2.3 Αποτελέσματα Συζήτηση Ιικές Απομονώσεις Το πρωτόκολλο που επιλέχθηκε για την ειδική ανίχνευση των CtRLV, BWYV, BMYV και TuYV είναι το ακόλουθο: Η RT PCR αναπτύχθηκε σε δύο στάδια. Το πρώτο στάδιο της RT πραγματοποιήθηκε σε μικροσωλήνα των 0,2ml στον οποίο προστέθηκε διάλυμα αντίδρασης όγκου 20μl, το οποίο συνίστατο από ρυθμιστικό διάλυμα 1x [50mM Tris HCl (ph 8,3), 75mM KCl, 3mM MgCl 2 ], 50u M MLV αντίστροφη μεταγραφάση (Invitrogen, The Netherlands), 15u αναστολέα ριβονουκλεασών (RNase inhibitor) (RNaseOUT, Invitrogen, The Netherlands), 10mM DTT, 0,25mM από κάθε dntp, 1μM από τον PolGenDown2, 2μl δείγματος από ολικό εκχύλισμα RNA και νερό που έχει μεταχειριστεί με DEPC έως τελικού όγκου. Το θερμικό προφίλ που χρησιμοποιήθηκε για το σύνολο των ιών ήταν 60 στους 45 o C και στη συνέχεια 10 στους 95 o C. Η PCR έγινε σε μικροσωλήνα των 0,2ml στον οποίο προστέθηκε διάλυμα αντίδρασης όγκου 20μl, το οποίο συνίστατο από ρυθμιστικό διάλυμα 1x [10mM Tris HCl (ph 8,8), 50mM KCl, 1,5mM MgCl 2, 0,1% Triton X 100], 1u Platinum Taq DNA πολυμεράσης (Invitrogen, The Netherlands), 0,2mM από κάθε dntp, x μm από τον ανοδικό εκκινητή και y μm από τον καθοδικό (οι τιμές x και y για κάθε ιό αναγράφονται στον Πίν. 2.7), 2μl cdna από την RT και νερό που έχει μεταχειριστεί με DEPC έως τελικού όγκου. Το θερμικό προφίλ που χρησιμοποιήθηκε για το σύνολο των ιών ήταν, αποδιάταξη του εκμαγείου για 5 στους 95 o C, ακολούθησαν 40 κύκλοι αποτελούμενοι από τρία στάδια: i) αποδιάταξη του εκμαγείου στους 95 o C για 30 ii) υβριδοποίηση των εκκινητών με το εκμαγείο στους 60 o C για 20 iii) επέκταση των αλυσίδων στους 72 o C για 30 και η αντίδραση ολοκληρώθηκε με επώαση για 5 στους 72 o C. Όλες οι αντιδράσεις πραγματοποιήθηκαν στον θερμοκυκλοποιητή LabCycler (SensoQuest GmbH, Germany). Πίνακας 2.7: Συγκεντρώσεις και Tm εκκινητών που χρησιμοποιήθηκαν για την ανίχνευση των CtRLV, BMYV, BWYV, TuYV. Εκκινητής Συγκέντρωση (μμ) Tm ( o C) CtRLV Up 0, CtRLV Down 0, BMYV Up 0,2 60 BMYV Down 0,2 58 BWYV Up 0,4 59 BWYV Down 0,4 61 TuYV Up 0,2 60 TuYV Down 0,2 59 Στην RT επιλέχθηκε ο εκκινητής PolGenDown2 έναντι των καθοδικών εκκινητών κάθε ιού, για την αύξηση της εξειδίκευσης των αντιδράσεων και την εξάλειψη των παραπροϊόντων που εμφανίζονταν στην ανίχνευση του CtRLV, εξαιτίας των εκφυλισμένων εκκινητών. Επίσης, με τη συγκεκριμένη πρακτική 49

63 Κεφ.2 Ανάπτυξη Μοριακής Μεθόδου Γενικής Ανίχνευσης Polero ιών περιορίζεται η ανάγκη πολλαπλών RT, χρησιμοποιώντας μία μόνο αρχική αντίδραση για την μετέπειτα γενική και ειδική ανίχνευση των Polero ιών. Από τα 7 δείγματα που εξετάστηκαν συνολικά για τον CABYV μόνο 4 έδωσαν θετική αντίδραση για τον ιό (Εικ. 2.4), ενώ το δείγμα που εξετάστηκε για την ύπαρξη του BYDV έδωσε Εικόνα 2.4: Ηλεκτοφόρημα δειγμάτων που βρέθηκαν θετικά για προσβολή από τον CABYV, ενισχύοντας το προβλεπόμενο τμήμα των 484bp. (Με L δηλώνεται ο δείκτης του μοριακού βάρους και με B το δείγμα χωρίς εκμαγείο). εκτός από το προβλεπόμενο προϊόν των 830bp και ένα παραπροϊόν περίπου 300bp (Εικ. 2.5), το οποίο είναι χαρακτηριστικό των απομονώσεων του BYDV PAV (Malmstrom και Shu, 2004). Οι εκκινητές που σχεδιάστηκαν για την ανίχνευση του CtRLV σε συνδυασμό με το πρωτόκολλο που αναπτύχθηκε κατέστησαν δυνατή την ανίχνευση του συνόλου των απομονώσεων (RL1 RL5) που προέρχονταν διαφορετικούς ξενιστές, χωρίς να εμφανίζουν μη ειδική ανίχνευση του PLRV (Εικ. 2.6A). Αντίθετα, η μέθοδος των Vercruysse et al. (2000) δεν ανιχνεύει τις απομονώσεις από μαϊντανό, σέλινο και άνηθο, ενώ ανιχνεύει μη ειδικά και τον PLRV (Εικ. 2.6Β) (όπως βέβαια αναφέρεται και στην δημοσίευσή τους, καθώς οι εκκινητές σχεδιάστηκαν αρχικά από απομονώσεις του CtRLV του PLRV). Επιπλέον, ενισχύθηκε ένα παραπροϊόν μεγέθους ~550bp το οποίο ήταν παρών στο σύνολο των απομονώσεων (σε κόκκινο κύκλο στην Eικ. 2.6Β). Εικόνα 2.5: Ηλεκτροφόρημα του δείγματος ΒΥ 1 όπου φαίνεται το προβλεπόμενο προϊόν των 830bp και το παραπροϊόν των ~300bp. (Με L δηλώνεται ο δείκτης μοριακού βάρους, με Μ ο αρνητικός μάρτυρας και με Β το δείγμα χωρίς εκμαγείο). Α Β Εικόνα 2.6: Ηλεκτροφορήματα θετικών δειγμάτων, για τον CtRLV, που ανιχνεύτηκαν με τους εκκινητές CtRLV Up και CtRLV Down (Α) και με την μέθοδο των Vercruysse et al. (2000) (Β). Με L δηλώνεται ο δείκτης μοριακού βάρους, με Β το δείγμα χωρίς εκμαγείο, τα βέλη δίνουν τη θέση και το μέγεθος του προβλεπόμενου προϊόντος. Σε κόκκινο κύκλο δίνονται μη ειδικές αντιδράσεις. 50

64 Κεφ.2 Ανάπτυξη Μοριακής Μεθόδου Γενικής Ανίχνευσης Polero ιών Από τα 35 συνολικά δείγματα που ελέχθησαν για τους τρεις ιούς που σχετίζονται με τον ίκτερο των τεύτλων, μόνο επτά βρέθηκαν θετικά με την μέθοδο που αναπτύχθηκε στην παρούσα μελέτη (Εικ. 2.7). Αναλυτικά, ανιχνεύτηκε ο BMYV στο δείγμα BW8, ο BWYV στα δείγματα BW4, BW6, BW10 και BW11 και ο TuYV στα δείγματα BW1, BW3, BW4 και BW8. Στα δείγματα BW4 και Α Β Γ Εικόνα 2.7: Ηλεκτροφορήματα δειγμάτων που βρέθηκαν θετικά για έναν τουλάχιστον ιό από τους BMYV (A), BWYV (B) και TuYV (Γ). Με L δηλώνεται ο δείκτης μοριακού βάρους, με Β το δείγμα χωρίς εκμαγείο, τα βέλη δίνουν τη θέση και το μέγεθος του προβλεπόμενου προϊόντος. BW8 ανιχνεύτηκαν μικτές μολύνσεις με παραπάνω από ένα μέλος του συμπλόκου, το οποίο όμως είναι ένα κοινό φαινόμενο στον αγρό (Vigano και Stevens, 2007, Beuve et al., 2008). Αξιολογώντας την ικανότητα ειδικής ανίχνευσης κάθε ιού στόχου της μεθόδου που αναπτύχθηκε, παρατηρούμε ότι αφενός δεν υπήρχε καμία μη ειδική αντίδραση με τις δυο χαρακτηρισμένες απομονώσεις (BMYV, BChV) και αφετέρου, η πλειονότητα των απομονώσεων έδωσε προϊόν για έναν μόνο ιό. Επιπλέον, το υψηλό ποσοστό συντήρησης, σε επίπεδο είδους, των σημείων που υβριδοποιούνται οι εκκινητές, σε συνδυασμό με την διαφοροποίησή τους μεταξύ των ιών του συμπλόκου των τεύτλων μειώνει ακόμα περισσότερο την πιθανότητα μη ειδικής ανίχνευσης. Η αδυναμία παραγωγής προϊόντος στις υπόλοιπες από τις απομονώσεις BW1 BW23, στις οποίες είχε ανιχνευτεί ορολογικώς (ELISA) o BWYV, πιθανώς οφείλεται στις μη ειδικές αντιδράσεις που εμφανίζουν οι ορολογικές μέθοδοι με άλλα μέλη της οικογένειας Luteoviridae. Η αδυναμία ανίχνευσης κάποιου Polero ιού από τα τεύτλα BW24 BW35 που εκδήλωναν ίκτερο προφανώς οφείλεται στο γεγονός ότι στη μεσογειακή λεκάνη τo κύριο παθογόνο που προκαλεί ίκτερο στα 51

65 Κεφ.2 Ανάπτυξη Μοριακής Μεθόδου Γενικής Ανίχνευσης Polero ιών τεύτλα είναι ο BYV, εν αντιθέσει με την βόρεια και δυτική Ευρώπη όπου υπερισχύει ο BMYV (Stevens et al., 2005b). Το σύνολο των απομονώσεων που χρησιμοποιήθηκαν για την ανάπτυξη της γενικής μεθόδου ανίχνευσης δίνονται στον Πίν Πίνακας 2.8: Απομονώσεις που χρησιμοποιήθηκαν για την ανάπτυξη της γενικής μεθόδου ανίχνευσης Polero ιών. Ιός Απομόνωση* Ιός Απομόνωση BChV BChV ScYLV ScYLV BMYV BMYV, BW8 TuYV BW1, BW3, BW4, BW8, BWYV BW4, BW6, BW10, BW11 PeYV # PY CABYV CA1, CA4, CA5, CA7 PEMV 1 PEMV 1 CpCSV CpCSV BLRV BLRV CtRLV RL1, RL2, RL3, RL4, RL5, BYDV BY 1 PLRV PLRV RuCMV RuCMV (*: Οι απομονώσεις δίνονται με τους κωδικούς τους, όπως αυτοί ορίζονται στους πίνακες 2.1 και 2.3, #: Κεφάλαιο Η απομόνωση BWYV όπως ορίζεται στον Πιν. 2.1) Ανάπτυξη Γενικής Μεθόδου Ανίχνευσης Polero ιών Ο πλέον κατάλληλος συνδυασμός εκκινητών για την PCR ήταν αυτός του PolGenDown2 και PolGenUp2 καθώς η χρησιμοποίηση του PolGenUp1 είχε ως αποτέλεσμα την αδυναμία ανίχνευσης ορισμένων απομονώσεων του CABYV καθώς και των CpCSV και BChV, ενώ ο PolGenDown1 παρήγαγε πολλά παραπροϊόντα πιθανότατα εξαιτίας του εκφυλισμού N στην τελευταία τριπλέτα του 3 άκρου (δεδομένα δεν παρουσιάζονται). Η RT έδωσε καλύτερα αποτελέσματα με τη χρησιμοποίηση του PolGenDown2 παρά του PolGenRT, καθώς αν και ο δεύτερος έκανε πιο καθαρές τις ζώνες του DNA χωρίς την παρουσία smear, εντούτοις παρήγαγε πολλά παραπροϊόντα και δεν ανιχνεύει την απομόνωση PY (Εικ. 2.8). Η βέλτιστη θερμοκρασία για την αντίδραση βρέθηκε ότι είναι στους 45 o C, ισοσταθμίζοντας την αύξηση της εξειδίκευσης σε υψηλότερες θερμοκρασίες, με την αναστολή που προκαλείται λόγω ανάσχεσης Εικόνα 2.8: Ηλεκτροφόρημα PCR γενικής ανίχνευσης Polero ιών, η RT της οποίας έγινε με τον PolGenRT. Η PCR πραγματοποιήθηκε με τις βέλτιστες συνθήκες. Με L δηλώνεται ο δείκτης μοριακού βάρους, με Β το δείγμα χωρίς εκμαγείο, το βέλος δίνει τη θέση και το μέγεθος του προβλεπόμενου προϊόντος. της δράσης του ενζύμου (η M MLV έχει βέλτιστη θερμοκρασία λειτουργίας τους 37 o C). Η συγκέντρωση του εκκινητή στην αντίδραση 52

66 Κεφ.2 Ανάπτυξη Μοριακής Μεθόδου Γενικής Ανίχνευσης Polero ιών ορίστηκε στο 1μΜ (Tm=45 50 o C). Από τα δύο προσθετικά (DMSO και μπεταΐνης) που εξετάστηκαν, μόνο η προσθήκη 5% DMSO εμφάνισε σαφή βελτίωση της αντίδρασης αυξάνοντας κυρίως την ποσότητα του πολλαπλασιαζόμενου DNA (Εικ. 2.9). Το DMSO είχε ελάχιστη και ίσως αρνητική επίδραση στην εξειδίκευση της μεθόδου καθώς, αν και γενικώς υπήρξε μια μικρή μείωση των παραπροϊόντων, παρατηρήθηκε η εμφάνιση δυο ζωνών στις απομονώσεις BW1 και BMYV (σε κόκκινο και κίτρινο κύκλο αντίστοιχα στην Εικ. 2.9Β) οι οποίες όμως ενισχύονται μόνο στις συγκεκριμένες απομονώσεις αφού δεν εντοπίστηκαν σε άλλες απομονώσεις του ίδιου ή άλλων ιών. Η προσθήκη DMSO πέραν του 5% είχε ανασταλτική επίδραση κυρίως για την ανίχνευση του BMYV και την απόδοση της αντίδρασης συνολικά (Εικ. 2.9Γ). Α Β Γ Εικόνα 2.9: Ηλεκτροφορήματα αντιδράσεων στις οποίες διαφοροποιείται η συγκέντρωση του DMSO ως εξής: 0% (Α), 5% (Β) και 10% (Γ). Όλοι οι υπόλοιποι παράγοντες στην RT και την PCR παρέμειναν σταθεροί. Με L δηλώνεται ο δείκτης μοριακού βάρους, με Β το δείγμα χωρίς εκμαγείο, το βέλος δίνει τη θέση και το μέγεθος του προβλεπόμενου προϊόντος. Η συγκέντρωση του MgCl 2 που χρησιμοποιείται είναι συνήθως 1,5mM αν και διαφέρει ανάλογα από τον συνδυασμό εκκινητών, την αλληλουχία στόχο και τη θερμοκρασία. Στη παρούσα μέθοδο αξιολογήθηκαν 3 διαφορετικές συγκεντρώσεις (1,0, 1,5 και 2,0mM) (Εικ. 2.10) και η συγκέντρωση που έδωσε τα καλύτερα αποτελέσματα ως προς την εξειδίκευση της μεθόδου ήταν αυτή του 1,0mM. Αν και οι υψηλότερες συγκεντρώσεις προκάλεσαν αύξηση της απόδοσης της αντίδρασης (λόγω αύξησης της ενεργότητας της πολυμεράσης), η σταθεροποίηση των εκκινητών και σε θέσεις με εσφαλμένο ταίριασμα βάσεων (mismatch) είχε ως αποτέλεσμα την παραγωγή πολλαπλών παραπροϊόντων. Η προσθήκη 1,0mM MgCl 2 έδωσε αρκετά ικανοποιητικό 53

67 Κεφ.2 Ανάπτυξη Μοριακής Μεθόδου Γενικής Ανίχνευσης Polero ιών ηλεκτροφόρημα, όμως τα δυο παραπροϊόντα που εμφανίζονται στις απομονώσεις BW1 και BMYV δεν απαλείφτηκαν. Η ενδιάμεση συγκέντρωση του 1,3mM έδωσε παρόμοια εικόνα με αυτή του 1,5mM (δεδομένα δεν παρουσιάζονται). Α Β Γ Εικόνα 2.10: Ηλεκτροφορήματα αντιδράσεων στις οποίες διαφοροποιείται η συγκέντρωση του MgCl 2 ως εξής: 1,0mM (Α), 1,5mM (Β) και 2,0mM (Γ). Όλοι οι υπόλοιποι παράγοντες στην RT και την PCR παρέμειναν σταθεροί. Με L δηλώνεται ο δείκτης μοριακού βάρους, με Β το δείγμα χωρίς εκμαγείο, το βέλος δίνει τη θέση και το μέγεθος του προβλεπόμενου προϊόντος. Οι συγκεντρώσεις των εκκινητών οι οποίες έδιναν την μεγαλύτερη απόδοση σε συνδυασμό με την ικανότητα ανίχνευσης όλων των απομονώσεων και τη μικρότερη δυνατή παραγωγή παραπροϊόντων ήταν 0,8μM (Tm=49 54 o C) για τον PolGenUp2 και 1,0μM (Tm=45 50 o C) για τον PolGenDown2. Εξαιτίας του μεγάλου εύρους θερμοκρασιών που εμφάνιζαν οι εκκινητές στις συγκεντρώσεις που χρησιμοποιήθηκαν στην αντίδραση, το θερμικό προφίλ που επιλέχθηκε περιλαμβάνει αντί για μία συγκεκριμένη θερμοκρασία υβριδοποίησης, μια κλιμακωτή υβριδοποίηση η οποία αρχίζει από τους 58 o C και μειώνεται σταδιακά στους 52 o C. Με τον τρόπο αυτό οι εκκινητές με υψηλότερο Tm «αναγκάζονται» να υβριδοποιηθούν στις σωστές θέσεις, παράγοντας και κατ επέκταση λιγότερα παραπροϊόντα, ενώ στην συνέχεια η θερμοκρασία μειώνεται ώστε να μπορέσουν να υβριδοποιηθούν και οι εκκινητές με μικρότερο Tm. Θερμοκρασίες άνω των 58 o C δεν βελτίωσαν την εξειδίκευση της μεθόδου, ενώ σε θερμοκρασίες κάτω των 52 o C υπήρχαν εμφανή παραπροϊόντα. Η εισαγωγή κύκλων σε υψηλότερη θερμοκρασία (π.χ. 60 o C) πριν από το βασικό θερμικό προφίλ δεν εμφάνισε καμία ουσιαστική διαφοροποίηση (δεδομένα δεν παρουσιάζονται). 54

68 Κεφ.2 Ανάπτυξη Μοριακής Μεθόδου Γενικής Ανίχνευσης Polero ιών Αναλυτικά τα πρωτόκολλα που σχεδιάστηκαν είναι τα εξής: H RT πραγματοποιήθηκε σε μικροσωλήνα των 0,2ml στον οποίο προστέθηκε διάλυμα αντίδρασης όγκου 20μl, το οποίο συνίστατο από ρυθμιστικό διάλυμα 1x [50mM Tris HCl (ph 8,3), 75mM KCl, 3mM MgCl 2 ], 50u M MLV αντίστροφη μεταγραφάση (Invitrogen, The Netherlands), 15u αναστολέα ριβονουκλεασών (RNase inhibitor) (RNaseOUT, Invitrogen, The Netherlands), 10mM DTT, 0,25mM από κάθε dntp, 1μM από τον PolGenDown2, 2μl δείγματος από ολικό εκχύλισμα RNA και νερό που έχει μεταχειριστεί με DEPC έως τελικού όγκου. Το θερμικό προφίλ που χρησιμοποιήθηκε ήταν 60 στους 45 o C και στη συνέχεια 10 στους 95 o C. Μετά το πέρας της RT ακολούθησε PCR σε μικροσωλήνα των 0,2ml στον οποίο προστέθηκε διάλυμα αντίδρασης όγκου 20μl, το οποίο συνίστατο από ρυθμιστικό διάλυμα 1x [20mM Tris HCl (ph 8,4), 50mM KCl], 1u Platinum Taq DNA πολυμεράσης (Invitrogen, The Netherlands), 1,0mM MgCl 2, 0,2mM από κάθε dntp, 0,8μM από τον ανοδικό εκκινητή PolGenUp2, 1μM από τον καθοδικό PolGenDown2, 5% DMSO, 2μl cdna από την RT και νερό που έχει μεταχειριστεί με DEPC έως τελικού όγκου. Το θερμικό προφίλ που επιλέχθηκε ήταν, αποδιάταξη του εκμαγείου για 5 στους 95 o C, ακολούθησαν 40 κύκλοι αποτελούμενοι από πέντε στάδια: i) αποδιάταξη του εκμαγείου στους 95 o C για 30 ii iv) κλιμακωτή υβριδοποίηση των εκκινητών με το εκμαγείο αρχικά στους 58 o C για 10, στη συνέχεια στους 54 o C για 10 και τελικά στους 52 o C για 10 v) επέκταση των αλυσίδων στους 72 o C για 30 και η αντίδραση ολοκληρώθηκε με επώαση για 5 στους 72 o C. Όλες οι αντιδράσεις πραγματοποιήθηκαν στον θερμοκυκλοποιητή LabCycler (SensoQuest GmbH, Germany) Αξιολόγηση Μεθόδου Για την αξιολόγηση της μεθόδου ως προς το εύρος ανίχνευσης και την εξειδίκευσή της, πραγματοποιήθηκε RT PCR στις συνθήκες που περιγράφονται στην παράγραφο για το σύνολο των ιικών απομονώσεων (Πίν. 2.8). Το ηλεκτροφόρημα με τις απομονώσεις των Polero ιών φαίνεται στην Εικ και των υπολοίπων γενών στην Εικ Σύμφωνα με τα αποτελέσματα, η μέθοδος που αναπτύχθηκε ανιχνεύει τουλάχιστον 10 διαφορετικούς ιούς και τις απομονώσεις τους οι οποίες μπορεί να διαφέρουν γεωγραφικά (CA1 CA4, RL1 RL2), ή να προέρχονται από διαφορετικούς ξενιστές όπως στις περιπτώσεις των CABYV, CtRLV και των ιών του συμπλόκου των τεύτλων (BChV, BMYV, BWYV, TuYV). Επιπλέον, δεν εμφανίζεται καμία μη ειδική ανίχνευση μελών από τα συγγενικά γένη Enamovirus και Luteovirus 55

69 Κεφ.2 Ανάπτυξη Μοριακής Μεθόδου Γενικής Ανίχνευσης Polero ιών Εικόνα 2.11: Ηλεκτροφόρημα όλων των απομονώσεων των Polero ιών που χρησιμοποιήθηκαν στην παρούσα μελέτη. Η PCR πραγματοποιήθηκε σύμφωνα με το πρωτόκολλο της παραγράφου Οι αγκύλες δίνουν τους ιούς στους οποίους ανήκουν (όταν υπάρχει πάνω από μια απομόνωση). Ο αστερίσκος, το θαυμαστικό και ή δίεση δείχνουν τις απομονώσεις των TuYV, BWYV και BMYV αντιστοίχως, όπως αυτές προσδιορίστηκαν στην παράγραφο Με L δηλώνεται ο δείκτης μοριακού βάρους, με Β το δείγμα χωρίς εκμαγείο, το βέλος δίνει τη θέση και το μέγεθος του προβλεπόμενου προϊόντος. και κυρίως από το γένος Sobemovirus του οποίου η RdRP εμφανίζει υψηλά ποσοστά ομοιότητας με αυτήν του Polerovirus Φυλογενετική Ανάλυση Για την διερεύνηση του φυλογενετικού περιεχόμενου της αλληλουχίας που ενισχύεται με το πρωτόκολλο της RT PCR που παρουσιάστηκε στην παράγραφο 2.3.2, κατασκευάστηκαν τρία φυλογενετικά δέντρα, i) της πρωτεΐνης P2, ii) του Εικόνα 2.12: Ηλεκτροφόρημα απομονώσεων των γενών Luteovirus, Enamovirus και Sobemovirus. Η PCR πραγματοποιήθηκε σύμφωνα με το πρωτόκολλο της παραγράφου Με L δηλώνεται ο δείκτης μοριακού βάρους, με Β το δείγμα χωρίς εκμαγείο, το βέλος δίνει τη θέση και το μέγεθος του προβλεπόμενου προϊόντος, ο ScYLV χρησιμοποιήθηκε ως θετικός μάρτυρας. ενισχυμένου τμήματος και iii) του ενισχυμένου τμήματος μαζί με τις αλληλουχίες των ελληνικών απομονώσεων BW1, BW6, RL1, CA1, και PY (Παράρτημα Α), τα οποία δίνονται στις Εικ. 2.13, 2.14 και 2.15 αντιστοίχως. Τα μοντέλα εξέλιξης που περιγράφουν καλύτερα τα δεδομένα είναι το LG+I+G+F για το δέντρο της P2 και το LG+I+G για τα δύο δέντρα που κατασκευάστηκαν με την αλληλουχία που ενισχύεται από την γενική μέθοδο ανίχνευσης. Το φυλογενετικό δέντρο που προέκυψε από την συνολική αμινοξική αλληλουχία της P2 θεωρήθηκε ότι αναπαριστά την σωστή φυλογενετική ιστορία του ORF2 (αφού προέκυψε από το σύνολο της αλληλουχίας αυτού) και με βάση την τοπολογία τού αξιολογήθηκαν τα δέντρα που προήλθαν από την αλληλουχία που ενισχύεται με τη μέθοδο που αναπτύχθηκε στο κεφάλαιο

70 Κεφ.2 Ανάπτυξη Μοριακής Μεθόδου Γενικής Ανίχνευσης Polero ιών Εικόνα 2.13: Φυλογενετικό δέντρο μέγιστης πιθανοφάνειας αμινοξικών αλληλουχιών της P2 του γένους Polerovirus. Ως taxon αναφοράς (outgroup) χρησιμοποιήθηκε ο PEMV 1. Οι ιοί που περιλαμβάνονται δίνονται στον Πίν Οι τιμές πάνω από κάθε κλάδο υποδηλώνουν την στήριξη αυτού σύμφωνα με την μη παραμετρική ανάλυση SH alrt. Παρουσιάζονται μόνο τιμές >80%. Το μήκος των βραχιόνων είναι ανάλογο της γενετικής απόστασης. Η κλίμακα δίνει τον αριθμό αντικαταστάσεων/θέση. 57

71 Κεφ.2 Ανάπτυξη Μοριακής Μεθόδου Γενικής Ανίχνευσης Polero ιών Εικόνα 2.14: Φυλογενετικό δέντρο μέγιστης πιθανοφάνειας αμινοξικών αλληλουχιών του τμήματος που ενισχύεται με τη γενική μέθοδο ανίχνευσης. Ως taxon αναφοράς (outgroup) χρησιμοποιήθηκε ο PEMV 1. Με πράσινο πλαίσιο σημειώνονται οι κλάδοι που έχουν ίδια τοπολογία με το δέντρο της P2 και με κόκκινο χρώμα οι βραχίονές τους που έχουν λανθασμένη τοπολογία. Οι ιοί που περιλαμβάνονται δίνονται στον Πίν Οι τιμές πάνω από κάθε κλάδο υποδηλώνουν την στήριξη αυτού σύμφωνα με την μη παραμετρική ανάλυση SH alrt. Παρουσιάζονται μόνο τιμές >80%. Το μήκος των βραχιόνων είναι ανάλογο της γενετικής απόστασης. Η κλίμακα δίνει τον αριθμό αντικαταστάσεων/θέση. 58

72 Κεφ.2 Ανάπτυξη Μοριακής Μεθόδου Γενικής Ανίχνευσης Polero ιών Εικόνα 2.15: Φυλογενετικό δέντρο μέγιστης πιθανοφάνειας αμινοξικών αλληλουχιών του τμήματος που ενισχύεται με τη γενική μέθοδο ανίχνευσης σε συνδυασμό με τις απομονώσεις που βρέθηκαν στην παρούσα μελέτη (έντονη γραφή). Ως taxon αναφοράς (outgroup) χρησιμοποιήθηκε ο PEMV 1. Οι ιοί που περιλαμβάνονται δίνονται στον Πίν Οι τιμές πάνω από κάθε κλάδο υποδηλώνουν την στήριξη αυτού σύμφωνα με την μη παραμετρική ανάλυση SH alrt. Παρουσιάζονται μόνο τιμές >80%. Το μήκος των βραχιόνων είναι ανάλογο της γενετικής απόστασης. Η κλίμακα δίνει τον αριθμό αντικαταστάσεων/θέση. 59

73 Κεφ.2 Ανάπτυξη Μοριακής Μεθόδου Γενικής Ανίχνευσης Polero ιών Το φυλογενετικό δέντρο της P2 διαχωρίζει το σύνολο των απομονώσεων σε δυο διακριτές ομάδες (I και II) εκ των οποίων η πρώτη περιλαμβάνει τις απομονώσεις των TVDV, CABYV, MABYV, CpCSV και της ομάδας του BWYV και η δεύτερη τους PLRV, ScYLV, CYDV RPV, CYDV RPS και WYDV GPV. Ο CtRLV σχηματίζει μια τρίτη μονοειδική ομάδα. Τα αποτελέσματα αυτά συμφωνούν με προηγούμενες μελέτες σχετικά με τις φυλογενετικές σχέσεις ειδών της οικογένειας Luteoviridae (Stevens et al., 2005a, Abraham et al., 2006, Beuve et al., 2008, Xiang et al., 2008a). Το γεγονός ότι οι περισσότεροι κλάδοι του δέντρου φέρουν ποσοστό SH alrt άνω του 90% είναι ιδιαίτερα σημαντικό και ενισχύει ακόμα περισσότερο την ορθότητα της φυλογενετικής υπόθεσης. Το φυλογενετικό δέντρο που προήλθε από την ενισχυόμενη αλληλουχία διατήρησε την σωστή τοπολογία ορισμένων μόνο κλάδων (σε πράσινο πλαίσιο στην Εικ. 2.14) και κυρίως αυτών που ανήκουν στην ομάδα ΙΙ οι οποίοι παρέμειναν σχεδόν αναλλοίωτοι (οι λάθος τοπολογίες δίνονται με κόκκινους βραχίονες). Επίσης, η ανάλυση έδωσε χαμηλή στήριξη στον κόμβο που ενώνει τους κλάδους του PLRV και των CYDV s (κόκκινο βέλος). Σημαντική διαφοροποίηση ήταν και η προσθήκη του CtRLV σε εσωτερικό κλάδο αν και αυτός δεν υποστηριζόταν από υψηλή τιμή SHaLRT. Η αδυναμία εξαγωγής μίας πλήρως επεξηγημένης φυλογένειας πιθανώς οφείλεται στην συντηρημένη φύση της περιοχής καθώς η διαειδική γενετική απόσταση (όπως αυτή δίνεται από την παράμετρο p distance) κυμαίνεται από 66 86% (με την πλειονότητα αυτών να βρίσκεται στο 80 83%), αγγίζοντας ακόμη και το 92% στην περίπτωση των ιών που σχετίζονται με τους CYDVs. Τα δεδομένα αυτά συμφωνούν και με τα αποτελέσματα του Likelihood Mapping τα οποία έδειξαν ότι ένα μεγάλο ποσοστό των τετράδων ανήκαν στην αστεροειδή περιοχή καθιστώντας την αλληλουχία αυτή ακατάλληλη για ένα πλήρως επεξηγημένο φυλογενετικό δέντρο (Strimmer και von Haeseler, 1997). Η ομαδοποίηση των απομονώσεων σε είδη ήταν σωστή σε όλες τις περιπτώσεις και υποστηριζόταν από υψηλές τιμές στήριξης των κλάδων ακόμα και όταν συμπεριλήφθηκαν οι ενισχυόμενες αλληλουχίες των απομονώσεων που ανιχνεύθηκαν στην παρούσα μελέτη. Όμως και εδώ υπήρχε η περίπτωση της ομαδοποίησης της απομόνωσης PY με τον TVDV, όπου παρόλο το υψηλό ποσοστό ομοιότητας (97,8%) πιθανώς ανήκει σε ένα συγγενικό αλλά διαφορετικό είδος (Κεφ. 3). 60

74 Κεφ.2 Ανάπτυξη Μοριακής Μεθόδου Γενικής Ανίχνευσης Polero ιών 2.4 Συμπεράσματα Οι Polero ιοί αποτελούν αναμφίβολα μια σημαντική ομάδα παθογόνων των καλλιεργούμενων φυτών παγκοσμίως. Η ορολογική τους ανίχνευση συχνά καταλήγει σε διφορούμενα και αναξιόπιστα αποτελέσματα (D Arcy et al., 1999), ενώ οι διαθέσιμες μοριακές μέθοδοι ανίχνευσης περιορίζονται στην ανίχνευση ενός (ή πολύ συγγενών) είδους ιού (Vercruysse et al., 2000, Hauser et al., 2000b, Malmstrom και Shu, 2004, Boubourakas et al., 2006, Vigano και Stevens, 2007, Beuve et al., 2008). Η μέθοδος που αναπτύχθηκε στην παρούσα μελέτη είναι ικανή να ανιχνεύσει εξειδικευμένα και γρήγορα την πλειονότητα (και πιθανώς το σύνολο) των ιών μελών του γένους Polerovirus και μπορεί να αποτελέσει ένα σημαντικό εργαλείο στην μελέτη των ιών της οικογένειας Luteoviridae. Η περιοχή που κωδικοποιεί την ιική RdRp έχει χρησιμοποιηθεί για την ανάπτυξη μεθόδων ανίχνευσης μελών που ανήκουν σε ποικίλα ιικά γένη όπως τα Fovea και Vitivirus (Dovas, και Katis, 2003) Tobamovirus (Dovas et al., 2004), Nepovirus (Maliogka et al., 2004) και Ilarvirus (Maliogka et al., 2007). Η επιλογή αυτή οφείλεται στο γεγονός ότι η αλληλουχία που αντιστοιχεί στην παλαμοειδή δομή της RdRp που περιέχει το ενεργό κέντρο του ενζύμου, είναι αρκετά συντηρημένη και μπορεί να αποτελέσει ένα ανεκτίμητο εργαλείο στις δομικές, λειτουργικές και φυλογενετικές αναλύσεις των ιικών πρωτεϊνών (O Reilly and Kao, 1998). Οι εκκινητές που σχεδιάστηκαν βρίσκονται ανοδικά του μοτίβου Α και μεταξύ των C και D και αντιστοιχούν σε 2 εξάδες αμινοξέων οι οποίες εμφάνιζαν τα υψηλά συντηρημένα μοτίβα D(E)EGRYR και GF(L)KVEV(Ε) για τους PolGenUp2 και PolGenDown2 αντιστοίχως. Μολονότι υπήρχαν διαφοροποιήσεις σε αυτά (αμινοξέα σε παρενθέσεις), αυτές αφορούν ελάχιστους ιούς μόνο (1 ή 2) και οφείλονται σε σημειακές μεταλλαγές ενός μόνο νουκλεοτιδίου. Λόγω του εκφυλισμού του γενετικού κώδικα, ο εκφυλισμός των εκκινητών που θα ήταν απαραίτητος για να συμπεριλάβει όλους τους πιθανούς συνδυασμούς θα ήταν της τάξης του 4096 για τον ανοδικό και για τον καθοδικό, γεγονός που καθιστά τον σχεδιασμό τους ουσιαστικά αδύνατο. Όμως οι τριπλέτες των νουκλεοτιδίων που εμφανίζονται στα γονιδιώματα των Polero ιών είναι σαφώς πιο συντηρημένες από τους συνδυασμούς αυτούς, όπως είναι εμφανές και από την στοίχιση στην Εικ. 2.3, γεγονός που μας επέτρεψε να μειώσουμε τον εκφυλισμό στο 4 και για τους δυο εκκινητές. Παρατηρώντας ότι η νουκλεοτιδική αυτή αλληλουχία έχει παραμείνει σταθερή σε πάνω από 15 ιούς οι οποίοι είναι γεωγραφικά απομακρυσμένοι, προσβάλλουν ένα μεγάλο αριθμό διαφορετικών ξενιστών ποικίλων οικογενειών και υπόκεινται σε συνεχή εξελικτική πίεση και 61

75 Κεφ.2 Ανάπτυξη Μοριακής Μεθόδου Γενικής Ανίχνευσης Polero ιών επιλογή, θεωρούμε ότι η μέθοδος που αναπτύχθηκε μπορεί να παραμείνει αξιόπιστη για ένα μεγάλο χρονικό διάστημα και ικανή να ανιχνεύσει το μεγαλύτερο μέρος των μελών του γένους Polerovirus. Η φυλογενετική ανάλυση του ενισχυόμενου προϊόντος των 186aa αδυνατεί να επεξηγήσει πλήρως την φυλογενετική εξέλιξη του ORF2 καθώς το δέντρο που εξήχθη με την αλληλουχία αυτή ήταν τμηματικά μόνο σωστό. Το γεγονός αυτό δεν μας επιτρέπει να προτείνουμε την χρησιμοποίηση της αλληλουχίας αυτής για φυλογενετικές μελέτες καθώς δεν μπορούν να αποδοθούν οι πραγματικές εξελικτικές σχέσεις μέσα στο γένος. Πάραυτα η ομαδοποίηση των απομονώσεων στους κλάδους μόνο με μέλη του ίδιου ιού υποδηλώνει ότι η σύγκριση της αλληλουχίας αυτής με ήδη κατατεθειμένες μπορεί να μας δώσει χρήσιμες πληροφορίες για την κατάταξη μιας απομόνωσης. Επιπλέον, η δυνατότητα συνδυασμού της RT από την γενική μέθοδο ανίχνευσης με την ειδική ανίχνευση ιών (όπως περιγράφεται στην παράγραφο 2.3.1) μπορεί να μας κατευθύνει προς την ταυτοποίηση του είδους αυτής. Βέβαια ως γνωστόν, οι Polero ιοί ανήκουν σε ένα πολυδύναμο γένος που χαρακτηρίζεται από την ύπαρξη ανασυνδυασμών (ScYLV), την διαφοροποίηση ορολογικώς και γενετικώς συγγενών ειδών εξαιτίας της εξειδίκευσή τους προς τους φορείς (CYDVs), το εύρος ξενιστών (ομάδα του BWYV) ή την συμπτωματολογική τους εικόνα (CYDV RPV/CYDV RPS) και ότι καμία τμηματική αλληλουχία ενός γονιδιακού προϊόντος δεν δίνει μια ολοκληρωμένη εκτίμηση για το σύνολο του γονιδιώματος μιας δεδομένης απομόνωσης. 62

76 63

77 Κεφ.3 Μερικός Χαρακτηρισμός Ενός Polero ιού Που Σχετίζεται Με Τον Ίκτερο Της Πιπεριάς 3.1 Εισαγωγή Η καλλιέργεια της πιπεριάς (Capsicum sp.) αποτελεί μια από τις πλέον σημαντικές καλλιέργειες παγκοσμίως, καλύπτοντας το 2007 περισσότερα από 30 εκατομμύρια στρέμματα καλλιεργούμενων εκτάσεων (FAOSTAT 2009). Στην Ελλάδα, για το έτος 2007, η παραγωγή ανήλθε στους τόνους σε σύνολο στρεμμάτων. Η πιπεριά είναι ιδιαίτερα ευπαθής στις ιώσεις καθώς έχουν καταγραφεί πάνω από 65 ιικά παθογόνα, τα οποία ανήκουν σε 25 γένη. Η μείωση της παραγωγής εξαιτίας των ιολογικών προσβολών μπορεί να ξεπεράσει το 50%, ενώ σε μερικές περιπτώσεις μπορεί να ανέλθει έως και στο 100% (Pernezny et al., 2003). Από τους ιούς της οικογένειας Luteoviridae την πιπεριά προσβάλλουν οι PLRV (σε πειραματικές συνθήκες μόνο) (Natti et al., 1953) και BWYV (Timmerman et al., 1985). Όμως το 1990, αναφέρθηκε στην Αυστραλία από τους Gunn και Pares ένας πιθανά νέος λουτεϊός που σχετιζόταν με την εμφάνιση συμπτωμάτων ίκτερου σε θερμοκηπιακές καλλιέργειες πιπεριάς, του οποίου δόθηκε το όνομα ιός του ίκτερου της πιπεριάς (Capsicum yellows virus CYV), χωρίς ωστόσο να αποδεχθεί ότι ο ιός αυτός διαφέρει ορολογικά από τον PLRV. Λίγο αργότερα (Yonaha et al., 1995), ένας νέος λουτεϊός, ο ιός του ίκτερου των νεύρων της πιπεριάς (Pepper vein yellows virus PeVYV) εντοπίστηκε σε καλλιέργειες πιπεριάς στην Ιαπωνία. Ο PeVYV διαφέρει ορολογικά από τους PLRV, BWYV και BYDV, ενώ εμφανίζει περιορισμένο εύρος ξενιστών. Ωστόσο η ICTV δεν έχει υιοθετήσει την ύπαρξη των CYV και PeVYV ως διακριτά είδη. Το 2008 παρατηρήθηκαν συμπτώματα ίκτερου σε καλλιέργειες πιπεριάς στην Αττάλεια της Τουρκίας. Από τα φυτά αυτά ελήφθησαν δείγματα τα οποία ελέγχθηκαν με την μέθοδο που αναπτύχθηκε στο κεφάλαιο 2 και διαπιστώθηκε η ύπαρξη ενός Polero ιού η αλληλουχία του οποίου διέφερε σημαντικά από τους PLRV και BWYV. Στη συνέχεια, αλληλουχήθηκε ένα μεγαλύτερο τμήμα του γονιδιώματος με στόχο τον μοριακό χαρακτηρισμό του νέου ιού. 64

78 Κεφ.3 Μερικός Χαρακτηρισμός Ενός Polero ιού Που Σχετίζεται Με Τον Ίκτερο Της Πιπεριάς 3.2 Υλικά και Μέθοδοι Φυτικό Υλικό Τα δείγματα πιπεριάς προήλθαν από θερμοκηπιακές καλλιέργειες στην περιοχή της Αττάλειας της Τουρκίας και εμφάνιζαν χαρακτηριστικά συμπτώματα ίκτερου. Αρχικά ελέγχτηκαν με την ορολογική μέθοδο ELISA για τους πλέον διαδεδομένους ιούς της πιπεριάς (AMV, CMV, PVY, TSWV) και βρέθηκαν αρνητικά για το σύνολο αυτών. Στη συνέχεια, στα δείγματα αυτά ανιχνεύτηκε μοριακά ένα μέλος του γένους Polerovirus (με την RT PCR που αναπτύχθηκε στην παρούσα μελέτη και περιγράφεται στο κεφάλαιο 2). Τέλος, για την αλληλούχιση του γονιδιώματος του ιού έγινε ολική εκχύλιση RNA από ένα φυτό πιπεριάς. Στην ιική απομόνωση αυτή δόθηκε ο κωδικός PY (pepper yellows) ο οποίος και θα χρησιμοποιείται εφεξής. Ως αρνητικός μάρτυρας, χρησιμοποιήθηκε εκχύλισμα RNA φυτού πιπεριάς που προήλθε από πιστοποιημένο σπόρο και αναπτύχθηκε σε θάλαμο ανάπτυξης στο εργαστήριο Εκχύλιση RNA Η εκχύλιση RNA πραγματοποιήθηκε όπως περιγράφεται στην παράγραφο Αλληλούχιση Τμήματος του Γονιδιώματος της Απομόνωσης PY Επιλογή περιοχών υβριδοποίησης των εκκινητών Αν και η αλληλούχιση του τμήματος που ενισχύεται με την γενική μέθοδο ανίχνευσης μας έδωσε μια αρχική εικόνα για την κατάταξη της απομόνωσης PY (Εικ. 2.15), εντούτοις ο σχεδιασμός των εκκινητών δεν μπορούσε να στηριχθεί μόνο σε αυτά τα δεδομένα και να γίνει με βάση την αλληλουχία του πλησιέστερου μόνο είδους. Ακόμα και οι μικρές διαφοροποιήσεις στην αλληλουχία μεταξύ των απομονώσεων, όπως και η ύπαρξη ανασυνδυασμών οι οποίοι παρατηρούνται μετά την διαγονιδιακή αμετάφραστη περιοχή δεν θα επέτρεπαν την ενίσχυση του θεμιτού προϊόντος. Η ορθότερη μέθοδολογία ήταν ο σχεδιασμός εκκινητών που θα μπορούσαν να ενισχύσουν το επιθυμητό τμήμα για την πλειονότητα των Polero ιών ώστε να έχουμε μεγαλύτερη πιθανότητα ενίσχυσης του τμήματος αυτού και για την PY. Το πλησιέστερο προς το 3 άκρο τμήμα του γονιδιώματος που εμφάνιζε υψηλό βαθμό συντήρησης είναι αυτό που υβριδοποιείται ο PolGenUp2. Το γεγονός αυτό σε συνδυασμό με την μικρή ομοιότητα που εμφανίζουν οι Polero ιοί μεταξύ τους μετά το πέρας του ORF3 και προς το 5 65

79 Κεφ.3 Μερικός Χαρακτηρισμός Ενός Polero ιού Που Σχετίζεται Με Τον Ίκτερο Της Πιπεριάς άκρο, μας οδήγησαν στη προσπάθεια αλληλούχισης του τμήματος από τον PolGenUp2 έως και το ORF Σχεδιασμός εκκινητών Εξαιτίας του μεγάλου τμήματος που θέλαμε να ενισχύσουμε (>1000bp) και την ενδεχόμενη ανταγωνιστική δράση του sgrna για τη δέσμευση των καθοδικών εκκινητών πιθανώς προκαλώντας μειωμένη απόδοση της αντίδρασης, επιλέχθηκε η ανάπτυξη μιας εστιασμένης (nested) RT PCR. Οι εκκινητές που σχεδιάστηκαν περιλάμβαναν δύο καθοδικούς για την RT και την PCR στην περιοχή της CP, ή έναν που θα εξυπηρετούσε τον διττό αυτό ρόλο, με Tm στο εύρος λειτουργίας του PolGenUp2. Για την εστιασμένη PCR χρειαζόμασταν ένας ζεύγος εκκινητών που θα υβριδοποιούνταν, ο ανοδικός στην RdRp (μέσα στην περιοχή ενίσχυσης της γενικής μεθόδου ανίχνευσης) και ο καθοδικός στην CP. Για τον σχεδιασμό των εκκινητών στοιχήθηκαν, με την βοήθεια του αλγόριθμου ClustalX2 (Larkin et al., 2007), νουκλεοτιδικές αλληλουχίες των ORFs της CP (Πίν. 3.1) και της P5 (Πίν. 3.2) προερχόμενες από μέλη του γένους Polerovirus. Η επιλογή των αλληλουχιών έγινε από την διαδικτυακή βάση δεδομένων NCBI (http://www.ncbi.nlm.nih.gov/). Για την RdRp χρησιμοποιήθηκε η στοίχιση που δίνεται στην παράγραφο (Εικ. 2.3). Πίνακας 3.1: Απομονώσεις ιών του γένους Polerovirus που χρησιμοποιήθηκαν για τον σχεδιασμό εκκινητών στην CP. Ιός Αριθμός Απομονώσεων Κωδικός Αριθμός BChV 6 EU022490, EU022491, AF167485, AF352025, AF167483, AF BMYV 6 EU022506, EU022496, EU022497, EF107543, DQ132996, EU BWYV 7 AY397614, AY397615, AF473561, DQ886589, L39967, L39974, L39971 CABYV 17 EU030629, EU091148, EU091149, EU091150, EU091151, DQ973123, EF063705, DQ973124, EF063704, EF063706, EF063707, EF063708, EF187338, EF187339, EF187346, X76931, EU CLRDV 5 GQ379224, EU871545, EU871540, EU871551, EU CpCSV 2 AY956384, AY CtRLV 1 AY CYDV RPS 1 AF CYDV RPV 7 DQ910730, EF521848, DQ988107, DQ115527, DQ988093, DQ115534, EF MABYV 1 EU PLRV 6 EF063711, DQ309064, AY079210, GQ376029, AF453390, AF ScYLV 6 AM072750, AM072751, AM072752, AM072756, AJ249447, AF TuYV 6 EF126150, X13063, AF167486, EF079908, DQ973125, EU TVDV 5 AF402621, AJ575129, EF529624, AM411003, AJ

80 Κεφ.3 Μερικός Χαρακτηρισμός Ενός Polero ιού Που Σχετίζεται Με Τον Ίκτερο Της Πιπεριάς Πίνακας 3.2: Απομονώσεις ιών του γένους Polerovirus που χρησιμοποιήθηκαν για τον σχεδιασμό εκκινητών στην P5. Ιός Αριθμός Απομονώσεων Κωδικός Αριθμός BChV 3 AF352025, AF352024, EU BMYV 4 EU148510, EF107543, DQ132996, X83110 BWYV 2 AF473561, X13062 CABYV 2 X76931, EU CLRDV 1 GQ CpCSV 1 AY CtRLV 1 AY CYDV RPS 1 AF CYDV RPV 3 EF521839, EF521827, EF MABYV 1 EU PLRV 4 AF453394, AF453388, X77321, AY ScYLV 4 AY236971, AM072750, AM072751, AF TuYV 1 X13063 TVDV 1 EF Για την εύρεση της θερμοκρασίας τήξης και των ιδιοτήτων αυτών χρησιμοποιήθηκε το υπολογιστικό πρόγραμμα OligoCalc (http://www.basic.northwestern.edu/biotools/oligocalc.html) (Kibbe, 2007). Για την αλληλούχιση του τμήματος από την RdRp έως την CP σχεδιάστηκαν συνολικά 4 νέοι εκκινητές (Πίν. 3.3), οι 3 (ένας για την RT και την PCR και ένα ζεύγος για την εστιασμένη PCR) ενσωματώθηκαν σε ένα σύστημα εστιασμένη RT PCR μαζί με τον PolGenUp2 και ο τέταρτος σε συνδυασμό με τον καθοδικό από την RT χρησιμοποιήθηκαν σε μια νέα PCR για την αλληλούχιση του συνόλου του γονιδίου της CP. Ο PY Up σχεδιάστηκε από την αλληλουχία που προήλθε από το προϊόν της εστιασμένης PCR και είναι ειδικός για την απομόνωση PY. Πίνακας 3.3: Εκκινητές που χρησιμοποιήθηκαν για την αλληλούχιση της απομόνωσης PY. Εκκινητής Αλληλουχία 5 3 Αντίδραση Προιόν PY Up ACG CCC ACG ACA GGT TCG* PCR # 562bp PolGenP5Down GBC GYC TAC CTA TTT NGG RT/PCR PolGenUp2 GAT GAR GGT CGY TAC CG PCR! PolGenCpDown GAT YTT ATA YTC ATG GTA GGC YTT GAG εστιασμένη PCR ~1100bp PolGenUpNest GAY TGC TCH GGT TTY GAY TGG εστιασμένη PCR (*: Οι ερμηνείες των συμβόλων εκφυλισμού δίνονται στο παράρτημα Γ, #: Η PCR γίνεται σε συνδυασμό με τον PolGenP5Down από την RT που σχεδιάστηκε για την nested RT PCR,!: Η PCR του PolGenUp2 με τον PolGenP5Down δεν παράγει ανιχνεύσιμο προϊόν) Οι στοιχίσεις των αλληλουχιών των ORFs 2, 3 και 5 και η θέση των εκκινητών φαίνονται στην Εικ. 3.1 Η θέση που υβριδοποιούνται οι εκκινητές σε σχέση με το γονιδίωμα των Polero ιών και τα προϊόντα των αντίστοιχων PCR φαίνονται στην Εικ

81 Κεφ.3 Μερικός Χαρακτηρισμός Ενός Polero ιού Που Σχετίζεται Με Τον Ίκτερο Της Πιπεριάς Α Β 68

82 Γ Κεφ.3 Μερικός Χαρακτηρισμός Ενός Polero ιού Που Σχετίζεται Με Τον Ίκτερο Της Πιπεριάς Εικόνα 3.1: Στοίχιση νουκλεοτιδικών αλληλουχιών της περιοχής της P5(A), CP(B) και RdRp(Γ) απομονώσεων μελών του γένους Polerovirus. Τα τμήματα των στοιχίσεων που σκιάζονται παρουσιάζουν ομοιότητα άνω του 50%. Το κίτρινο, μωβ, ροζ και μπλε πλαίσιο δίνουν την θέση των PolGenP5Down, PolGenCpDown PolGenUp2 και PolGenUpNest αντιστοίχως ενώ τα βέλη την φορά αυτών (5 3 ). Η αρίθμηση είναι σύμφωνη με το πλήρες γονιδίωμα του PLRV. 69

83 Κεφ.3 Μερικός Χαρακτηρισμός Ενός Polero ιού Που Σχετίζεται Με Τον Ίκτερο Της Πιπεριάς Εικόνα 3.2: Σχετική θέση εκκινητών και προϊόντα των PCR που χρησιμοποιήθηκαν για την αλληλούχιση της απομόνωσης PY. (Τα πλαίσια αναπαριστούν ORFs και οι μαύρες γραμμές RNA. Το ροζ, πράσινο, πορτοκαλί, κίτρινο, μπλε και μωβ βέλη δείχνουν την θέση και φορά (5 3 ) των εκκινητών PolGenUp2, PolGenDown2, PY Up, PolGenP5Down, PolGenUpNest και PolGenCpDown αντιστοίχως. Η μαύρη, κόκκινη και μπλε διακεκομμένη γραμμή δίνουν τα προϊόντα που στάλθηκαν για αλληλούχιση από τις PCR των PolGenUp2/PolGenDown2, PolGenUpNest/PolGenCpDown και PY Up/PolGenP5Down αντιστοίχως) Πρωτόκολλο θερμοκυκλοποίησης Η nested RT PCR αναπτύχθηκε σε τέσσερα στάδια τα οποία αναλυτικά είναι: Αρχικά πραγματοποιήθηκε η RT σε μικροσωλήνα των 0,2ml στον οποίο προστέθηκε διάλυμα αντίδρασης όγκου 20μl, το οποίο συνίστατο από ρυθμιστικό διάλυμα 1x [50mM Tris HCl (ph 8,3), 75mM KCl, 3mM MgCl 2 ], 50u M MLV αντίστροφη μεταγραφάση (Invitrogen, The Netherlands), 15u αναστολέα ριβονουκλεασών (RNase inhibitor) (RNaseOUT, Invitrogen, The Netherlands), 10mM DTT, 0,25mM από κάθε dntp, 1μM από τον PolGenP5Down, 2μl δείγματος από ολικό εκχύλισμα RNA και νερό που έχει μεταχειριστεί με DEPC έως τελικού όγκου. Το θερμικό προφίλ που χρησιμοποιήθηκε ήταν, 60 στους 45 o C και στη συνέχεια 10 στους 95 o C. Μετά το πέρας της RT ακολούθησε ενζυματική αποικοδόμηση του RNA από το υβρίδιο RNA:DNA με την προσθήκη 4u Ribonuclease H (Takara Bio Inc, Japan)/μικροσωλήνα και επώαση στους 37 o C για 20 ακολουθούμενου από 15 στους 80 o C. Η προσθήκη της RNase H μετά την RT βελτιώνει την ευαισθησία και την απόδοση της PCR που ακολουθεί (Kitabayashi και Esaka, 2003). Στη συνέχεια, πραγματοποιήθηκε PCR σε μικροσωλήνα των 0,2ml στον οποίο προστέθηκε διάλυμα αντίδρασης όγκου 20μl, το οποίο συνίστατο από ρυθμιστικό διάλυμα 1x [10mM Tris HCl (ph 8,8), 50 mm KCl, 1,5 mm MgCl 2, 0,1 % Triton X 100], 1u Platinum Taq DNA πολυμεράσης (Invitrogen, The Netherlands), 0,2mM από κάθε dntp, 0,8μM από τον ανοδικό εκκινητή PolGenUp2 (Tm=49 54 o C), 0,8μM από τον καθοδικό PolGenP5Down (Tm=43 53 o C), 2 μl cdna από την RT και νερό που έχει μεταχειριστεί με DEPC έως τελικού όγκου. Το θερμικό προφίλ που επιλέχθηκε ήταν, αποδιάταξη του εκμαγείου για 5 στους 95 o C, ακολούθησαν 40 κύκλοι 70

84 Κεφ.3 Μερικός Χαρακτηρισμός Ενός Polero ιού Που Σχετίζεται Με Τον Ίκτερο Της Πιπεριάς αποτελούμενοι από τρία στάδια: i) αποδιάταξη του εκμαγείου στους 95 o C για 30 ii) υβριδοποίηση των εκκινητών με το εκμαγείο στους 48 o C για 20 iii) επέκταση των αλυσίδων στους 72 o C για 1 και η αντίδραση ολοκληρώθηκε με επώαση για 5 στους 72 o C. Τελικά πραγματοποιήθηκε εστιασμένη PCR σε μικροσωλήνα των 0,2ml στον οποίο προστέθηκε διάλυμα αντίδρασης όγκου 20μl, το οποίο συνίστατο από ρυθμιστικό διάλυμα 1x [10mM Tris HCl (ph 8,8), 50mM KCl, 1,5mM MgCl 2, 0,1 % Triton X 100], 1u Platinum Taq DNA πολυμεράσης (Invitrogen, The Netherlands), 0,2mM από κάθε dntp, 0,8μM από τον ανοδικό εκκινητή PolGenUpNest (Tm=55 60 o C), 0,8μM από τον καθοδικό PolGenCPDown (Tm=58 60 o C), 2μl DNA από την PCR και νερό που έχει μεταχειριστεί με DEPC έως τελικού όγκου. Το θερμικό προφίλ που επιλέχθηκε ήταν, αποδιάταξη του εκμαγείου για 5 στους 95 o C, ακολούθησαν 40 κύκλοι αποτελούμενοι από τρία στάδια: i) αποδιάταξη του εκμαγείου στους 95 o C για 30 ii) υβριδοποίηση των εκκινητών με το εκμαγείο στους 62 o C για 20 iii) επέκταση των αλυσίδων στους 72 o C για 1 και η αντίδραση ολοκληρώθηκε με επώαση για 5 στους 72 o C. Για την συμπλήρωση της αλληλουχίας έως το τέλος της CP πραγματοποιήθηκε PCR σε μικροσωλήνα των 0,2ml στον οποίο προστέθηκε διάλυμα αντίδρασης όγκου 20μl, το οποίο συνίστατο από ρυθμιστικό διάλυμα 1x [10mM Tris HCl (ph 8,8), 50mM KCl, 1,5mM MgCl 2, 0,1 % Triton X 100], 1u Platinum Taq DNA πολυμεράσης (Invitrogen, The Netherlands), 0,2mM από κάθε dntp, 0,2μM από τον ανοδικό εκκινητή PY Up (Tm=55 60 o C), 0,8μM από τον καθοδικό PolGenP5Down (Tm=43 53 o C), 2μl cdna από την RT της προηγούμενης μεθόδου και νερό που έχει μεταχειριστεί με DEPC έως τελικού όγκου. Το θερμικό προφίλ που επιλέχθηκε ήταν, αποδιάταξη του εκμαγείου για 5 στους 95 o C, ακολούθησαν 40 κύκλοι αποτελούμενοι από τρία στάδια: i) αποδιάταξη του εκμαγείου στους 95 o C για 30 ii) υβριδοποίηση των εκκινητών με το εκμαγείο στους 51 o C για 20 iii) επέκταση των αλυσίδων στους 72 o C για 30 και η αντίδραση ολοκληρώθηκε με επώαση για 5 στους 72 o C. Όλες οι αντιδράσεις πραγματοποιήθηκαν στον θερμοκυκλοποιητή LabCycler (SensoQuest GmbH, Germany) Ανάλυση των Προϊόντων της PCR με Ηλεκτροφόρηση Η ανάλυση των προϊόντων πραγματοποιήθηκε όπως περιγράφεται στην παράγραφο Αλληλούχιση Προϊόντων PCR Η αλληλούχιση των προϊόντων πραγματοποιήθηκε όπως περιγράφεται στην παράγραφο

85 Κεφ.3 Μερικός Χαρακτηρισμός Ενός Polero ιού Που Σχετίζεται Με Τον Ίκτερο Της Πιπεριάς Φυλογενετική Ανάλυση Η φυλογενετική ανάλυση πραγματοποιήθηκε όπως περιγράφεται στην παράγραφο Για την κατασκευή των φυλογενετικών δέντρων της CP και της MP χρησιμοποιήθηκαν οι αμινοξικές αλληλουχίες των απομονώσεων που δίνονται στον Πίν. 3.4 και για το καρβοξυτελικό τμήμα της RdRP αυτές του Πίν Το φυλογενετικό δέντρο της MP αντιστοιχεί στο σύνολο της πρωτεϊνικής αλληλουχίας αυτής, ενώ από την CP παραλείπονται τα τελευταία δυο αμινοξέα, καθώς αυτά περιλαμβάνονται στην περιοχή που υβριδοποιείται ο εκκινητής PolGenP5Down. Πίνακας 3.4: Απομονώσεις ιών της οικογένειας Luteoviridae που χρησιμοποιήθηκαν στην κατασκευή των φυλογενετικών δέντρων της CP και MP. Ιός Απομόνωση Κωδικός Αριθμός Ιός Απομόνωση Κωδικός Αριθμός BChV 2a AF CYDV RPV RPV12P4o04 DQ BChV BChV CR AF CYDV RPS RPV Mex 1 AF M26 EU MABYV EU N13 EU CU87 AF IPP DQ Noir AF BMYV Broom's Barn EF PLRV Yunnan 157 FJ ITB X83110 Australia D13953 N32 EU Polish X74789 USA AF AY L39975 REU YL1a AM BWYV 3a2 L39969 CHN YL1 AM ScYLV 29 L39952 PER YL1b AM N X76931 BRA YL1 AM CABYV CHN EU TN IND 2 FJ AY TuYV BWYV FL1 X13063 S7 EF BSh5 AM CLRDV PV1 GQ SDi AJ CpCSV Et fb am1 AY TVDV Baoshan AF Et cp am* AY BSh4 AJ CtRLV UK1 AY Longlin EF NY RPV L25299 WYDV GPV FM CYDV RPV 046 EF NC_ BYDV PAV 092 EF EF RPV51P3o04 DQ (*: Η απομόνωση Et cp am δεν συμπεριλαμβάνεται στην κατασκευή του δέντρου της MP καθώς υπάρχει τμηματική μόνο αλληλουχία) 72

86 Κεφ.3 Μερικός Χαρακτηρισμός Ενός Polero ιού Που Σχετίζεται Με Τον Ίκτερο Της Πιπεριάς 3.3 Αποτελέσματα Συζήτηση Αλληλούχιση της Απομόνωσης PY Η εστιασμένη RT PCR που σχεδιάστηκε ενίσχυσε ένα τμήμα ~1100bp για την απομόνωση PY. Στην PCR συμπεριλήφθησαν και οι χαρακτηρισμένες απομονώσεις BMYV, PLRV, ScYLV και CpCSV ως θετικοί μάρτυρες καθώς και υγιής πιπεριά ως αρνητικός μάρτυρας (Εικ. 3.3). Η PCR με τον ειδικό για την απομόνωση PY εκκινητή ενίσχυσε το επιθυμητό προϊόν των 562bp έως το πέρας του ORF3 (Εικ. 3.4). Τα προϊόντα αυτά εξήχθησαν από την πηκτή αγαρόζης και αλληλουχήθηκαν όπως περιγράφεται στην παράγραφο Οι δύο αυτές αλληλουχίες σε συνδυασμό με το τμήμα που προήλθε από την γενική μέθοδο ανίχνευσης, μετά την απομάκρυνση των εκκινητών, μας έδωσαν την τελική αλληλουχία της απομόνωσης PY μεγέθους 1630nt (Παράρτημα Α) η οποία στη συνέχεια χρησιμοποιήθηκε για τις φυλογενετικές αναλύσεις. Η αλληλουχία των 1630nt περιλαμβάνει 820nt από το καρβοξυτελικό άκρο του ORF2, τη διαγονιδιακή αμετάφραστη περιοχή μήκους 198nt και 620 από τα 629nt του ORF3. Εξαιτίας της πλήρους αλληλοεπικάλυψης του ORF4 με το ORF3 μπορέσαμε να εξάγουμε και το σύνολο της πρωτεϊνικής αλληλουχίας της MP. Εικόνα 3.3: Ηλεκτροφόρημα των προϊόντων της εστιασμένης RT PCR. (Με L δηλώνεται ο δείκτης μοριακού βάρους, με Μ ο αρνητικός μάρτυρας και με Β το δείγμα χωρίς εκμαγείο. Τα βέλη δίνουν τη θέση και το μέγεθος του προβλεπόμενου προϊόντος). Εικόνα 3.4: Ηλεκτροφόρημα των προϊόντων της PCR για την ενίσχυση του ORF3 της PY. (Με L δηλώνεται ο δείκτης μοριακού βάρους και με Β το δείγμα χωρίς εκμαγείο. Τα βέλη δίνουν τη θέση και το μέγεθος του προβλεπόμενου προϊόντος) Φυλογενετική Ανάλυση Τα αποτελέσματα της φυλογενετικής ανάλυσης με βάση τις αμινοξικές αλληλουχίες του καρβοξυτελικού άκρου της RdRp, της CP και της MP (Εικ. 3.5, 3.6 και 3.7 αντιστοίχως) παρουσιάζουν ενδιαφέρον ως προς την κατάταξη της PY. Πιο συγκεκριμένα η απομόνωση PY και στα τρία φυλογενετικά δέντρα ομαδοποιείται μαζί με τις απομονώσεις των μελών του γένους 73

87 Κεφ.3 Μερικός Χαρακτηρισμός Ενός Polero ιού Που Σχετίζεται Με Τον Ίκτερο Της Πιπεριάς Εικόνα 3.5: Φυλογενετικό δέντρο μέγιστης πιθανοφάνειας αμινοξικών αλληλουχιών του καρβοξυτελικού τμήματος της RdRp. Ως taxon αναφοράς (outgroup) χρησιμοποιήθηκε ο BYDV PAV. Οι ιοί που περιλαμβάνονται δίνονται στον πίνακα 3.4. Με κόκκινο δίνονται οι κλάδοι η τοπολογία των οποίων διαφέρει από το δέντρο της P2. Οι τιμές πάνω από κάθε κλάδο υποδηλώνουν την στήριξη αυτού σύμφωνα με την μη παραμετρική ανάλυση SH alrt. Παρουσιάζονται μόνο τιμές >80%. Το μήκος των βραχιόνων είναι ανάλογο της γενετικής απόστασης. Η κλίμακα δίνει τον αριθμό αντικαταστάσεων/θέση. 74

88 Κεφ.3 Μερικός Χαρακτηρισμός Ενός Polero ιού Που Σχετίζεται Με Τον Ίκτερο Της Πιπεριάς Εικόνα 3.6: Φυλογενετικό δέντρο μέγιστης πιθανοφάνειας αμινοξικών αλληλουχιών της MP. Ως taxon αναφοράς (outgroup) χρησιμοποιήθηκε ο BYDV PAV. Οι ιοί που περιλαμβάνονται δίνονται στον πίνακα 3.4. Οι κόκκινοι βραχίονες και τα βέλη δείχνουν τις διαφορές στην τοπολογία από το δέντρο της CP. Οι τιμές πάνω από κάθε κλάδο υποδηλώνουν την στήριξη αυτού σύμφωνα με την μη παραμετρική ανάλυση SH alrt. Παρουσιάζονται μόνο τιμές >80%. Το μήκος των βραχιόνων είναι ανάλογο της γενετικής απόστασης. Η κλίμακα δίνει τον αριθμό αντικαταστάσεων/θέση. 75

89 Κεφ.3 Μερικός Χαρακτηρισμός Ενός Polero ιού Που Σχετίζεται Με Τον Ίκτερο Της Πιπεριάς Εικόνα 3.7: Φυλογενετικό δέντρο μέγιστης πιθανοφάνειας αμινοξικών αλληλουχιών της CP. Ως taxon αναφοράς (outgroup) χρησιμοποιήθηκε ο BYDV PAV. Οι ιοί που περιλαμβάνονται δίνονται στον πίνακα 3.4. Σε κίτρινο πλαίσιο σημειώνεται ο κλάδος που κατατάσσεται η PY. Οι τιμές πάνω από κάθε κλάδο υποδηλώνουν την στήριξη αυτού σύμφωνα με την μη παραμετρική ανάλυση SH alrt. Παρουσιάζονται μόνο τιμές >80%. Το μήκος των βραχιόνων είναι ανάλογο της γενετικής απόστασης. Η κλίμακα δίνει τον αριθμό αντικαταστάσεων/θέση. 76

90 Κεφ.3 Μερικός Χαρακτηρισμός Ενός Polero ιού Που Σχετίζεται Με Τον Ίκτερο Της Πιπεριάς Polerovirus και πιο συγκεκριμένα με τον TVDV. Αυτό οφείλεται στην μεγαλύτερη ομοιότητα της PY με τον TVDV απ ότι με τους υπόλοιπους ιούς (Πίν. 3.5) Αξιολόγηση φυλογενετικών δέντρων Το μοντέλο εξέλιξης που ερμηνεύει καλύτερα τα δεδομένα σύμφωνα με το πρόγραμμα ProtTest ήταν το LG+G. Η τοπολογία που προέκυψε για το καρβοξυτελικό τμήμα της RdRP (μεγέθους 278aa) σχεδόν ταυτίζεται με αυτή του φυλογενετικού δέντρου που προέκυψε από το σύνολο των αμινοξέων της P2 (με την εξαίρεση των κόμβων που δίνουν τη θέση για τις απομονώσεις των CYDV RPS, WYDV GPV, BWYV και MABYV), ενώ παράλληλα οι κλάδοι υποστηρίζονται από υψηλές τιμές SH alrt. Θεωρούμε λοιπόν ότι η τμηματική αυτή αλληλουχία δίνει, κατά προσέγγιση τουλάχιστον, την φυλογενετική ιστορία του συνόλου του ORF2. Τα φυλογενετικά δέντρα της CP και MP εφόσον αφορούν αλληλεπικαλυπτόμενα (overlapped) ORFs συγκρίθηκαν αρχικά μεταξύ τους για να διαπιστώσουμε ποιο από τα δύο απεικονίζει τις πραγματικές φυλογενετικές σχέσεις των Polero ιών. Τα μοντέλα εξέλιξης για την CP και MP που επιλέχτηκαν από το πρόγραμμα ProtTest, ήταν τα JTT+G+F και HIVb+G αντιστοίχως. Όπως έχει αναφερθεί σε περιπτώσεις αλληλεπικαλυπτόμενων ORFs (Fuji et al., 2001, Hughes et al., 2001, Guyader και Ducray, 2002, Pavesi, 2006), είναι σύνηθες το φαινόμενο κατά το οποίο ένα από τα δυο ORF υπόκειται σε αρνητική/εκαθαριστική επιλογή (negative/purifying selection) και το άλλο σε θετική επιλογή (positive selection) ή εξέλιξη προσαρμογής (adaptive evolution). Αυτό έχει ως αποτέλεσμα στις περιοχές αλληλοεπικάλυψης να παρατηρείται υψηλός βαθμός συντήρησης ανάμεσα στα ιικά είδη (ή τις απομονώσεις) στο ένα ORF και χαμηλός στο άλλο. Ένα μέτρο που χρησιμοποιείται για την εύρεση της επιλογής που ασκείται σε μια γονιδιακή περιοχή είναι ο λόγος μη συνώνυμων/συνώνυμων νουκλεοτιδικών αντικαταστάσεων (Ω=d N /d S ), ο οποίος δίνει τιμές >1,0 στο γονίδιο που υπόκειται σε θετική επιλογή και <1,0 σε αυτό που υπόκειται σε εκκαθαριστική (Holmes, 2008). Στην περίπτωση του PLRV το ORF3 είναι περισσότερο συντηρημένο από το ORF4 (Guyader και Ducray, 2002), αν και τα ποσοστά συντήρησης του ιού είναι γενικώς υψηλότερα σε σύγκριση με άλλα μέλη του γένους. Ο υψηλότερος βαθμός ομοιότητας στην CP έναντι της MP ήταν εμφανής (στην παρούσα μελέτη) ακόμα και από τις στοιχίσεις των αμινοξέων καθώς η MP εμφάνιζε σαφώς λιγότερες θέσεις με ομόλογα αμινοξέα απ ότι η πρώτη. Τα φυλογενετικά δέντρα που προέκυψαν εμφάνιζαν αρκετές ομοιότητες αλλά και ουσιαστικές διαφορές. Και στα δύο φυλογενετικά δέντρα υπήρχε σαφής διαχωρισμός των αλληλουχιών του ScYLV και ομαδοποίηση μαζί με τον BYDV PAV που χρησιμοποιήθηκε ως taxon 77

91 Κεφ.3 Μερικός Χαρακτηρισμός Ενός Polero ιού Που Σχετίζεται Με Τον Ίκτερο Της Πιπεριάς αναφοράς (outgroup), το οποίο συμφωνεί με την ανασυνδυασμένη φύση του ιού (Moonan et al., 2000). Οι υπόλοιποι Polero ιοί κατατάχθηκαν σε τρείς ομάδες οι οποίες ήταν παρόμοιες για τις δύο πρωτεΐνες και περιελάμβαναν η πρώτη τον CLRDV και το σύνολο των απομονώσεων της ομάδας του BWYV, η δεύτερη τους CpCSV, MABYV και CABYV και η τρίτη τους CYDVs και PLRV. Οι διαφορές εντοπίστηκαν στον κλάδο του TVDV ο οποίος στο φυλογενετικό δέντρο της CP ομαδοποιείται με την τρίτη ομάδα, ενώ σ αυτό της MP με τη δεύτερη (κόκκινο βέλος, Εικ. 3.6). Επίσης, στο φυλογενετικό δέντρο της MP έχουμε μια επιπλέον ομαδοποίηση της πρώτης με τη δεύτερη ομάδα (κίτρινο βέλος) κάτι που δεν εμφανίζεται στην CP. Τέλος, υπάρχει και μια διαφορά όσον αφορά τις σχέσεις των ιών του κλάδου των CYDVs (οι βραχίονες σημειώνονται με κόκκινο χρώμα). Η ύπαρξη των ομάδων I, II, και III υποστηρίζεται και από προηγούμενες μελέτες (Abraham et al., 2006). Επιπλέον, το σύνολο των κόμβων της CP στηρίζεται από υψηλές τιμές SH alrt κάτι που δεν ισχύει στο φυλογενετικό δέντρο της MP. Με βάση τα παραπάνω δεδομένα σε συνδυασμό με το γεγονός ότι η CP υπόκειται σε αρνητική επιλογή, που έχει ως αποτέλεσμα την διατήρηση της αλληλουχίας σταθερότερη με το πέρασμα του χρόνου, θεωρούμε ότι οι σωστές εξελικτικές σχέσεις δίνονται μέσα από την φυλογενετική ανάλυση της αλληλουχίας της CP Γενετικές αποστάσεις της απομόνωσης PY με τα υπόλοιπα μέλη του γένους Polerovirus Οι γενετικές αποστάσεις που προέκυψαν από τον λόγο p distance δίνονται στον Πίν Πίνακας 3.5: Διαφορές % σε επίπεδο αμινοξέων της απομόνωσης PY σε σύγκριση με ιούς του γένους Polerovirus. Ιός* Γονίδιο RdRp CP MP BChV 25,5 26, ,5 57,9 59,9 BMYV 26,5 26, ,9 58,6 BWYV 24, ,9 CABYV 23,6 24,3 42,1 42,6 48,3 51 CLRDV 21,7 40,7 58,9 CpCSV 29,2 43,9 57,6 CtRLV 26, ,8 CYDV RPV 29 29,8 41,5 42,5 56,4 57,7 CYDV RPS 30, ,1 MABYV 25,7 42,9 54 PLRV 27,9 28,3 45, ,4 ScYLV 30,7 31,1 55,2 55,7 73,3 74,7 TuYV 18, ,6 TVDV 3,7 10,8 11, ,7 WYDV GPV 31,3 47,2 58,4 (*: Η PY συγκρίθηκε με ιούς που έχουν κατατεθειμένες (τουλάχιστον τμηματικές) αλληλουχίες της CP, MP και της RdRP) 78

92 Κεφ.3 Μερικός Χαρακτηρισμός Ενός Polero ιού Που Σχετίζεται Με Τον Ίκτερο Της Πιπεριάς Ταξινόμηση της PY Στη φυλογενετική ανάλυση που έγινε με βάση το καρβοξυτελικό άκρο της RdRp παρατηρήθηκε διχοτόμηση των απομονώσεων στον κλάδο που τοποθετείται η PY. Αυτό οφείλεται εν μέρει στις διαφοροποιήσεις που υπάρχουν μεταξύ της PY με τις Baoshan και Longlin, αλλά κυρίως στην ταύτιση της αλληλουχίας των δύο τελευταίων. Οι ενδοειδικές διαφορές μεταξύ των απομονώσεων κυμαίνονται από 0,4% (PLRV) έως 3,3 % (ScYLV). Η διαφοροποίηση της PY με την Longlin (πλήρες γονιδίωμα του TVDV) είναι οριακά μεγαλύτερη (3,7%), αλλά η έλλειψη περισσοτέρων απομονώσεων του TVDV δεν επιτρέπει την εξαγωγή ασφαλών συμπερασμάτων. Συγκριτικά, η μικρότερη διαειδική διαφορά είναι της τάξης του 9,9% μεταξύ των CYDV RPV και WYDV GPV. Στον κλάδο του φυλογενετικού δέντρου της CP που περιλαμβάνεται η απομόνωση PY (σε κίτρινο πλαίσιο, Εικ. 3.7) παρατηρήθηκε τριχοτομία των απομονώσεων η οποία υποδεικνύει την ύπαρξη σημαντικών διαφορών μέσα στον κλάδο. Εξετάζοντας τις γενετικές αποστάσεις (pdistance) των 6 απομονώσεων παρατηρούμε ότι εμφανίζονται και εδώ τρεις διακριτές ομάδες (Πίν. 3.6). Η πρώτη αποτελείται από τις απομονώσεις Longlin, Baoshan και BSh4 με τις διαφορές τους να κυμαίνονται από 0,5 1,0%, η δεύτερη από τις SDi και BSh5 (οι οποίες είναι πανομοιότυπες) και η τρίτη από την PY. Οι διαφορές μεταξύ της πρώτης και της δεύτερης ομάδας είναι 9,4 9,9%, μεταξύ της πρώτης και τρίτης 10,8% 11,8%, ενώ μεταξύ της δεύτερης και τρίτης 8,8%. Δεδομένου ότι η πρώτη ομάδα περιέχει και την απομόνωση Longlin, της οποίας έχει αλληλουχηθεί πλήρως το γονιδίωμά της, βλέπουμε ότι η PY υπερβαίνει το 10% που έχει οριστεί ως όριο για τον διαχωρισμό των ειδών μέσα στην οικογένεια (D Arcy και Domier, 2005). Παρόμοια αποτελέσματα έχουμε και όταν συγκρίνουμε τις αλληλουχίες της MP, με τη δεύτερη και τρίτη ομάδα να διαφέρουν από την πρώτη περισσότερο από 15% (Πίν. 3.6). Πίνακας 3.6: Διαφορές % σε επίπεδο αμινοξέων των απομονώσεων του TVDV και της PY στην CP (έντονη γραφή) και MP (πλάγια γραφή). Απομόνωση PY BSh5 SDi BSh4 Baoshan Longlin PY 9,6 9, ,7 16,7 BSh5 8,8 0 15, SDi 8,8 0 15, BSh4 11,3 9,9 9,9 0,6 0,6 Baoshan 10,8 9,4 9,4 0,5 0 Longlin 11,8 9,4 9,4 0,5 1 Συγκριτικά, μέσα στο γένος Polerovirus οι ενδοειδικές διαφορές που παρατηρούνται για το γονίδιο της CP είναι στην πλειονότητά τους της τάξης του 1 6,1% με τις δύο απομονώσεις του BChV όμως να αγγίζουν το 9%, αλλά σε καμία περίπτωση δεν ήταν μεγαλύτερες του 10%. Οι 79

93 Κεφ.3 Μερικός Χαρακτηρισμός Ενός Polero ιού Που Σχετίζεται Με Τον Ίκτερο Της Πιπεριάς διαειδικές διαφορές εμφανίζουν μεγάλο εύρος τιμών καθώς στην περίπτωση ιών της ομάδας του BWYV είναι έως και 1,5% (BWYV USA/BChV CR). Για την MP όπως ήταν φυσικό εξαιτίας της θετικής επιλογής στην οποία υπόκειται, οι ενδοειδικές διαφορές είναι υψηλότερες και ανέρχονται στην περίπτωση του CABYV στο 9,9%, όμως και εδώ δεν υπερβαίνουν το 10%. Διαειδικώς έχουμε πάλι ποικίλα αποτελέσματα με το μικρότερο ποσοστό να εμφανίζεται και σε αυτό το ORF μεταξύ των απομονώσεων BWYV USA και BChV CR (2,3%). 80

94 Κεφ.3 Μερικός Χαρακτηρισμός Ενός Polero ιού Που Σχετίζεται Με Τον Ίκτερο Της Πιπεριάς 3.4 Συμπεράσματα Η ταυτοποίηση της απομόνωσης PY βασίστηκε σε μια αλληλουχία μεγέθους 1630nt η οποία μας έδωσε πληροφορίες σχετικά με τρία ORFs που αυτή κωδικοποιεί. Με πρώτο κριτήριο το γεγονός ότι η ανίχνευσή της έγινε με την γενική μέθοδο που αναπτύχθηκε στην παρούσα μελέτη, η οποία είναι εξειδικευμένη για το γένος Polerovirus, η απομόνωση «κατατάχθηκε» αρχικά στο γένος αυτό. Η αλληλούχιση του ενισχυόμενου προϊόντος έδειξε υψηλή ομοιότητα με το είδος TVDV αλλά, όπως αναφέρθηκε και στο κεφάλαιο 2, το τμήμα αυτό δεν είναι αρκετό για την εξαγωγή απόλυτα ορθών αποτελεσμάτων και κρίθηκε αναγκαία η περαιτέρω διερεύνηση. Η αλληλούχιση του τμήματος των 1630nt, η σύγκρισή του με άλλους ιούς και η φυλογενετική ανάλυση μας αποκάλυψε ότι η PY είναι ένα ακόμη μέλος της οικογένειας Luteoviridae και πιθανώς του γένους Polerovirus. Οι διαπιστώσεις αυτές βασίζονται στο γεγονός ότι οι τρείς πρωτεΐνες που εξετάστηκαν (RdRP, CP, MP) εμφανίζουν μεγάλη ομοιότητα με μέλη του γένους αυτού (Πίν. 3.5), τα ORFs που χαρακτηρίστηκαν παρουσιάζουν την τυπική οργάνωσή του (Mayo και Miller, 1999), ενώ η διαγονιδιακή αμετάφραστη περιοχή που ενώνει την RdRp με την CP είναι μεγέθους 198nt, το οποίο είναι ένα χαρακτηριστικό ταξινομικό γνώρισμα διάκρισης των Luteo και Polero ιών (D Arcy και Domier, 2005). Επίσης, η ύπαρξη του ORF που κωδικοποιεί την MP αποκλείει την ένταξή του στο γένος Enamovirus. Οι φυλογενετικές αναλύσεις έδειξαν ότι και τα τρία ORFs που εξετάστηκαν σχετίζονται στενά με το γένος Polerovirus, γεγονός που ενισχύει την αρχική υπόθεσή μας και επιπλέον μειώνει την πιθανότητα ύπαρξης ανασυνδυασμών με μέλη του γένους Luteovirus καθώς αυτοί εντοπίζονται κυρίως μετά την διαγονιδιακή αμετάφραστη περιοχή (Moonan et al., 2000, Domier et al., 2002), αν και έχουν αναφερθεί περιπτώσεις ανασυνδυασμών και μετά το σημείο υπερανάγνωσης (Abraham et al., 2006). Για τη βέβαιη όμως κατάταξη της PY στο γένος Polerovirus πρέπει να πληρωθούν δυο ακόμη κριτήρια, η ύπαρξη του ORF0 και του εκτεταμένου τμήματος αλληλεπικαλύψης των ORFs 1 και 2. Η κατάταξη της PY σε συγκεκριμένο είδος περιπλέκεται αρκετά λόγω της φύσης των κατατεθειμένων απομονώσεων που υπάρχουν. Στο φυλογενετικό δέντρο της RdRp αν και υπάρχει σαφής διαχωρισμός μεταξύ των απομονώσεων, εντούτοις οι γενετικές αποστάσεις είναι αρκετά μικρές για την υποστήριξη διαφοροποίησης από το είδος TVDV. Η κατάσταση αλλάζει όμως όταν λάβουμε υπόψη μας τα φυλογενετικά δέντρα των CP και MP στις οποίες συμπεριλήφθησαν επιπλέον τρεις απομονώσεις οι οποίες όμως μας δίνουν την αλληλουχία μόνο των CP και MP. Η τριχοτομία που εμφανίζεται αντικατοπτρίζει τις διαφορές μεταξύ των απομονώσεων, καθώς αν ληφθεί ως μέσο αναφοράς η απομόνωση Longlin (της οποίας είναι γνωστή η πλήρης αλληλουχία 81

95 Κεφ.3 Μερικός Χαρακτηρισμός Ενός Polero ιού Που Σχετίζεται Με Τον Ίκτερο Της Πιπεριάς του γονιδιώματός της) οι υπόλοιπες απομονώσεις κατατάσσονται σε δύο ομάδες, σ αυτές που είναι πολύ κοντινές (Baoshan/BSh4) και στις υπόλοιπες που διαφοροποιούνται ουσιαστικά (PY/BSh5/SDi), που επίσης με τη σειρά τους διαφέρουν μεταξύ τους. Δυστυχώς, δεν υπάρχουν άλλα στοιχεία για τις κατατεθειμένες απομονώσεις, εκτός από την περιοχή προέλευσής τους (Κίνα) γεγονός που μας εμποδίζει από το να διατυπώσουμε μια υπόθεση σχετικά με ένα πιθανό εξελικτικό μονοπάτι που έχουν ακολουθήσει. Η γνώση του εύρους ξενιστών τους θα αποτελούσε σημαντικό στοιχείο, καθώς μια αδυναμία προσβολής της πιπεριάς θα μας κατεύθυνε στην αποδοχή ύπαρξης ενός φαινομένου της στενωπού (bottleneck event) που πιθανώς θα είχε προέλθει από την «μεταπήδηση» μιας αρχικής απομόνωσης σε ένα νέο ξενιστή. Εάν δεχτούμε την υπόθεση ότι όλες αυτές είναι απομακρυσμένες απομονώσεις ενός μόνο είδους ιού, τότε παραβαίνουμε έναν από τους βασικούς κανόνες της ταξινόμησης που ορίζει ότι διαφορές σε οποιοδήποτε γονιδιακό προϊόν άνω του 10% υποστηρίζουν την ύπαρξη ενός νέου είδους (D Arcy και Domier, 2005). Αν και η διαφορά στην αλληλουχία του γονίδιου της CP είναι οριακά μεγαλύτερη και μόνο για την PY, στην περιοχή της MP υπερβαίνει το 15% και για τις BSh5/SDi. Εν τέλει, με βάση το κριτήριο της διαφοροποίησης άνω του 10% στις αμινοξικές αλληλουχίες των γονιδιακών προϊόντων της CP και της MP, σε σύγκριση με όλες τις πλήρεις αλληλουχίες που έχουν κατατεθεί, προτείνουμε την ένταξη της απομόνωσης PY στo γένος Polerovirus της οικογένειας Luteoviridae με το όνομα ιός του ίκτερου της πιπεριάς Pepper yellows virus (PeYV). Βεβαίως είναι απαραίτητες περαιτέρω μελέτες οι οποίες θα ενισχύσουν την υπόθεσή μας αυτή. Η πλήρης αλληλούχιση του γονιδιώματός της θα μας προσφέρει τα απαραίτητα δεδομένα για την ύπαρξη ανασυνδυασμών καθώς και την αλληλουχία του ORF0 το οποίο είναι γνωστό ότι διαφέρει σημαντικά ακόμα και σε «συγγενή» στην περιοχή της CP είδη (Beuve et al., 2008). Επίσης, η πραγματοποίηση δοκιμών αφιδομετάδοσης και διερεύνησης του εύρους ξενιστών της θα μας δώσει επιπλέον στοιχεία σχετικά με τη βιολογία του ιού, ώστε η ταυτοποίησή του να βασίζεται όχι μόνο σε επίπεδο νουκλεοτιδικής αλληλουχίας αλλά και στην αλληλεπίδρασή του με τους ξενιστές και τους φορείς του στο περιβάλλον. 82

96 83

97 Κεφ. 4 Γενική Συζήτηση Kαι Συμπεράσματα Η ταχεία και αξιόπιστη διάγνωση ενός παθογόνου είναι το σημαντικότερο στάδιο για τη μελέτη της επιδημιολογίας του και την καταπολέμησή του. Για τη διάγνωση των φυτικών ιών η συμπτωματολογική τους εικόνα (με εξαίρεση ελάχιστων περιπτώσεων) σπανίως είναι παθογνωμονική. Στην περίπτωση των Polero ιών εξαιτίας του εντοπισμού τους στο φλοίωμα τα συμπτώματα που προκαλούν μπορούν να αποδοθούν σε διάφορα, βιολογικά και μη αίτια που διαταράζουν τη σωστή λειτουργία αυτού. Η ανοσοενζυμική δοκιμή ELISA η οποία χρησιμοποιείται συχνά για τη διάγνωση και ταυτοποίηση των Polero ιών είναι αναξιόπιστη εξαιτίας της εμφάνισης σταυροειδών αντιδράσεων (D Arcy et al., 1999). Η μοναδική γενική μέθοδος ανίχνευσης που έχει αναπτυχθεί για ιούς μέλη της οικογένειας Luteoviridae είναι αυτή των Robertson et al. (1991) η οποία όμως έχει αξιολογηθεί για ελάχιστους ιούς και ανιχνεύει απομονώσεις Polero και Luteo ιών. Η μοριακή μέθοδος ανίχνευσης που αναπτύχθηκε στην παρούσα διατριβή είναι ικανή να ανιχνεύσει απομονώσεις τουλάχιστον 10 ιών του γένους Polerovirus. Το μεγάλο εύρος ανίχνευσης και η εξειδίκευσή της οφείλονται στην επιλογή της RdRp ως περιοχής στόχου των εκκινητών. Τα συντηρημένα μοτίβα της RdRp (Poch et al., 1989, Bruenn, 1991) επέτρεψαν τον σχεδιασμό εκκινητών οι οποίοι εν δυνάμει ανιχνεύουν το σύνολο των ιών του γένους ελαχιστοποιώντας παράλληλα την μη ειδική ανίχνευση μελών των συγγενών γενών Enamovirus, Luteovirus καθώς και αυτών του γένους Sobemovirus. Επιπλέον, αναπτύχθηκε μία μέθοδος ειδικής ανίχνευσης των BMYV, BWYV, TuYV και CtRLV η οποία είναι ικανή να ανιχνεύσει διάφορες απομονώσεις των ιών αυτών. Προηγούμενες μέθοδοι που αναπτύχθηκαν για την ειδική ανίχνευση των ιών της ομάδας του BWYV και είχαν ως αλληλουχία στόχο την CP αδυνατούσαν να διαχωρίσουν μεταξύ των μελών αυτών, ενώ η μέθοδος των Vercruysse et al. (2000) για την ανίχνευση του CtRLV εμφανίζει μη ειδική ανίχνευση του PLRV και δεν ανιχνεύει το σύνολο των απομονώσεων από τους διαφορετικούς ξενιστές τους. Η ικανότητα συνδυασμού των δυο μεθόδων γενικής και ειδικής ανίχνευσης (όπως δίνεται σχηματικά στο παράρτημα Β) μας δίνει την ικανότητα ταχείας και εξειδικευμένης ανίχνευσης των Polero ιών αυτών. Η αλληλουχία της RdRp χρησιμοποιήθηκε, για τον διαχωρισμό και ταξινόμηση απομονώσεων φυτικών ιών σε είδη, επιτυχώς σε προηγούμενες μελέτες (Dovas, και Katis, 2003, Dovas et al., 2004, Maliogka et al., 2004, Maliogka et al., 2007). Η φυλογενετική ανάλυση που προήλθε από την αλληλουχία του ενισχυόμενου προϊόντος της γενικής μεθόδου ανίχνευσης δεν έδωσε την ορθή φυλογενετική ιστορία του ORF2 καθώς ένας αριθμός των κλάδων του φυλογενετικού δέντρου 84

98 Κεφ. 4 Γενική Συζήτηση Kαι Συμπεράσματα διέφεραν ουσιαστικά από αυτό της συνολικής αλληλουχίας της P2. Εντούτοις, η σύγκριση της αλληλουχίας του προϊόντος με κατατεθειμένες αλληλουχίες μπορεί να μας δώσει μια αρχική εκτίμηση του ιικού είδους στο οποίο κατατάσσεται αυτή καθώς στις περισσότερες περιπτώσεις οι κλάδοι του δέντρου αποτελούνταν μόνο από απομονώσεις του ίδιου είδους. Κατά τον έλεγχο δειγμάτων που έφεραν χαρακτηριστικά συμπτώματα προσβολής από μέλη της οικογένειας Luteoviridae με τη μέθοδο που αναπτύχθηκε στην παρούσα μελέτη εντοπίστηκε σε φυτά πιπεριάς ένας Polero ιός. Η σύγκριση της αλληλουχίας του ενισχυόμενου προϊόντος έδειξε την ύπαρξη ενός ιού διαφορετικού από τους BWYV και PLRV που επίσης προσβάλλουν την πιπεριά (Natti et al., 1953, Timmerman et al., 1985). Για την διερεύνηση του αιτίου πραγματοποιήθηκε ένας μερικός χαρακτηρισμός αυτής που περιλάμβανε την τμηματική αλληλούχιση των ORFs 2 και 3 και την πλήρη του ORF4. Οι φυλογενετικές αναλύσεις των αμινοξικών αλληλουχιών και η σύγκριση αυτών με κατατεθειμένες αλληλουχίες ιών της οικογένειας Luteoviridae ανέδειξε την σαφή διαφοροποίηση της απομόνωσης PY κυρίως στο ORF4 που κωδικοποιεί την MP και δευτερευόντως στο ORF3 της CP. Οι διαφοροποιήσεις αυτές σε συνδυασμό με το όριο του 10% που θέτει η ICTV για τον διαχωρισμό ειδών μέσα στην οικογένεια (D Arcy και Domier, 2005) μας οδήγησε στο να προτείνουμε την δημιουργία του νέου είδους ιού με όνομα ιός του ίκτερου της πιπεριάς (Pepper yellows virus PeYV) μέσα στο γένος Polerovirus της οικογένειας Luteoviridae. Στο μέλλον θα έπρεπε να σχεδιαστούν ειδικοί εκκινητές για το σύνολο των ιών του γένους Polerovirus οι οποίοι θα μπορούν να συνδυαστούν με την γενική μέθοδο για την ταχεία ταυτοποίηση των Polero ιών χωρίς να είμαστε υποχρεωμένοι να καταφύγουμε στην αλληλούχιση του ενισχυόμενου προϊόντος της γενικής μεθόδου. Επίσης, ενδιαφέρουσα είναι και η διερεύνηση του παθογόνου αιτίου στα δειγμάτων τα οποία είχαν βρεθεί προσβεβλημένα από τον BWYV (παράγραφος , Πιν. 2.2), αλλά δεν ήταν δυνατόν να ανιχνευθεί κάποιος από τους BMYV, BWYV και TuYV με την χρησιμοποίηση ειδικών εκκινητών. Επιπλέον, κρίνεται απαραίτητη η αλληλούχιση του πλήρους γονιδιώματος του PeYV ώστε να έχουμε μια συνολική εικόνα της οργάνωσής του και των πρωτεϊνών που κωδικοποιούνται από αυτό, ώστε να οριστικοποιηθεί η κατάταξή του. Τέλος, θα έπρεπε να πραγματοποιηθούν δοκιμές αφιδομετάδοσης για την διερεύνηση του είδους του φορέα καθώς και του εύρους ξενιστών του νέου αυτού ιού. Συνοψίζοντας, στην παρούσα μελέτη αναπτύχθηκε μια γενική μέθοδος ανίχνευσης για τα μέλη του γένους Polerovirus και μια ειδική για τους ιούς BMYV, BWYV, TuYV και CtRLV οι οποίες μπορούν να χρησιμοποιηθούν για επιδημιολογικές μελέτες και για τον εμπλουτισμό της βάσης δεδομένων με πληροφορίες αλληλουχιών γνωστών ή νέων Polero ιών. Επίσης, εντοπίστηκε η 85

99 Κεφ. 4 Γενική Συζήτηση Kαι Συμπεράσματα ύπαρξη ενός νέου μέλους του γένους Polerovirus το οποίο σχετίζεται με τον ίκτερο της πιπεριάς ενώ προσδιορίστηκαν για πρώτη φορά η ύπαρξη του CtRLV σε Άνηθο, Μαϊντανό και Σέλινο καθώς και η παρουσία των BMYV και TuYV, στην Ελλάδα. 86

100 87

101 Βιβλιογραφία Abascal, F., Zardoya, R. and Posada, D. (2005) ProtTest: Selection of best fit models of protein evolution. Bioinformatics 21: Abou Jawdah, Y., Sobh, H., Fayyad, A. and Lecoq, H. (1997) First report of Cucurbit aphid borne yellows luteovirus in Lebanon. Plant Disease 81:1331. Abraham, A. D., Menzel, W., Varrelmann, M. and Vetten, H. J. (2009) Molecular, serological and biological variation among Chickpea chlorotic stunt virus isolates from five countries of North Africa and West Asia. Archives of Virology 154: Abraham A. D, Menzel, W., Lesemann D. E., Varrelmann M. and Vetten, H. J. (2006) Chickpea chlorotic stunt virus: a new Polerovirus infecting cool season food legumes in Ethiopia. Phytopathology 96: Abu Ahmad, Y., Royer, M., Daugrois, J. H., Costet, L., Lett, J. M., Victoria, J. I., Girard, J. C., and Rott, P. (2006b) Geographical distribution of four Sugarcane yellow leaf virus genotypes. Plant Disease 90: Abu Ahmad, Y., Rassaby, L., Royer, M., Borg, Z., Braithwaite, K. S., Mirkov, E., Irey, M. S., Perrier, X., Smith, G. R., and Rott, P. (2006a) Yellow leaf of sugarcane is caused by at least three different genotypes of sugarcane yellow leaf virus, one of which predominates on the Island of Reunion. Archives of Virology. 151: Anisimova, M. and Gascuel, O. (2006) Approximate Likelihood Ratio Test for Branches: A Fast, Accurate, and Powerful Alternative. Systematic Biology 55: Ashoub, A., Rohde, W. and Prufer, D. (1998) In planta transcription of a second subgenomic RNA increases the complexity of the subgroup 2 luteovirus genome. Nucleic Acids Research 26: Bananej, K., Desbiez, C., Wipf Scheibel, C., Vahdat, I., Kheyr Pour, A., Ahoonmanesh A. and Lecoq H. (2006) First Report of Cucurbit aphid borne yellows virus in Iran Causing Yellows on Four Cucurbit Crops. Plant Disease 90:526. Barker, H. (1989) Specificity of the effect of sap transmissible viruses in increasing the accumulation of luteoviruses in co infected plants. Annals of Applied Biology 115: Baumann, P., Baumann, L., Lai, C., Rouhbakhsh, D., Moran, N. A. and Clark, M. A. (1995) Genetics, physiology and evolutionary relationships of the genus Buchnera: intracellular symbionts of aphids. Annual Review of Microbiology 49:

102 Βιβλιογραφία Beuve, M., Stevens, M., Liu, H. Y., Wintermantel, W. M., Hauser, S. and Lemaire, O., (2008) Biological and molecular characterization of an american sugar beet infecting Beet western yellows virus isolate. Plant Disease 92: Bjorling, K. and Nilsson, B. (1966) Observations on the host range and vector relations of Beet mild yellowing virus. Socker 21:1 14. Boubourakas, I. N., Avgelis, A. D., Kyriakopoulou, P. E. and Katis, N. I. (2006) Occurrence of yellowing viruses (Beet pseudo yellows virus, Cucurbit yellow stunting disorder virus and Cucurbit aphid borne yellows virus) affecting cucurbits in Greece. Plant Pathology 55: Brault, V., Herrbach, E. and Reinbold, C. (2007) Electron microscopy studies on luteovirid transmission by aphids. Micron 38: Brault, V., van den Heuvel, J. F. J. M., Verbeek, M., Ziegler Graff, V., Reutenauer, A., Herrbach, E., Garaud, J. C., Guilley, H., Richards, K. and Jonard, G. (1995) Aphid transmission of Beet western yellows luteovirus requires the minor capsid read through protein P74. EMBO Journal 14: Bruenn, J. A. (1991) Relationships among the positive strand and double strand RNA viruses as viewed through their RNA dependent RNA polymerases. Nucleic Acids Research 19: Buzan, E., Krystufek, B., Hänfling, B. and Hutchinson, W. F. (2008) Mitochondrial phylogeny of Arvicolinae based on comprehensive taxonomic sampling yields new insights. Biological Journal of the Linnean Society 94: Clark, M. F. and Adams, A. N. (1977) Characteristics of the microplate method of enzyme linked immunosorbent assay for the detection of plant viruses. Journal of General Virology 34: Cockbain, A. J., Jones, P. and Woods, R. D. (1986) Transmission characteristics and some other properties of Bean yellow vein banding virus, and its association with Pea enation mosaic virus. Annals of Applied Biology 108: Correa, R. L., Silva, T. F., Simoes Araujo, J. L., Barroso, P. A., Vidal, M. S. and Vaslin, M. F. (2005) Molecular characterization of a virus from the family Luteoviridae associated with cotton blue disease. Archives of Virology 150: Costa, A. S., Duffus, J. E. and Bardin, R. (1959) Malva yellows, an aphid transmitted virus disease. Journal of the American Society of Sugar Beet Technologists 10:

103 Βιβλιογραφία D Arcy, C. J. (1995) Symptomatology and host range of Barley yellow dwarf. In: Barley Yellow Dwarf 40 Years of Progress, pp Edited by D Arcy, C. J. and Burnett, P. A. St. Paul, Minnesota: APS Press. D Arcy, C. J., and Domier, L. L. (2005) Family Luteoviridae. In: Virus Taxonomy: Eighth Report of the International Committee on Taxonomy of Viruses, pp Edited by Fauquet, C. M., Mayo, M. A., Maniloff, J., Desselberger, U. and Ball, L. A. Elsevier Academic Press. D'Arcy, C. J., Torrance, L. and Martin, R. R. (1989) Discrimination among luteoviruses and their strains by monoclonal antibodies and identification of common epitopes. Phytopathology 79: D Arcy, C. J., Domier, L. L. and Torrance, L. (1999) Detection and Diagnosis of Luteovirues. In: The Luteoviridae, pp Edited by Smith, H. G. and Barker, H. Wallingford, UK: CAB International. D Arcy, C. J., Domier, L. L. and Mayo, M. A. (2000) Family Luteoviridae. In: Virus Taxonomy: Seventh Report of the International Committee on Taxonomy of Viruses, pp Edited by van Regenmortel, M. H. V., Fauquet, C. M., Bishop, D. H. L., Carstens, E. B., Estes, M. K., Lemon, S. M., Maniloff, J., Mayo, M. A., McGeoch, D. J., Pringle, C. R. and Wickner, R. B. San Diego: Academic Press. de Bokx, J. A. (1967) The callose test for the detection of leaf roll virus in potato tubers. European Potato Journal 10: de Miranda, J. R., Stevens, M., de Bruyne, E., Smith, H. G., Bird, C., and Hull, R. (1995) Sequence comparison and classification of beet luteovirus isolates. Archives of Virology 40: Demler, S. A. and De Zoeten, G. A. (1991) The nucleotide sequence and luteovirus like nature of RNA 1 of an aphid non transmissible strain of Pea enation mosaic virus. Journal of General Virology 72: Demler, S. A., Rucker, D. G. and de Zoeten, G. A. (1993) The chimeric nature of the genome of Pea enation mosaic virus: the independent replication of RNA 2. Journal of General Virology 74:1 14. Demler, S. A., Borkhsenious, O. N., Rucker, D. G. and de Zoeten, G. A. (1994) Assessment of the autonomy of replicative and structural functions encoded by the luteo phase of Pea enation mosaic virus. Journal of General Virology 75: Diener, T. O. (1979) Viroids and Viroid Diseases John Wiley and Sons, NewYork, 252 pp. 90

104 Βιβλιογραφία Domier, L. L., McCoppin, N. K., Larsen, R. C. and D Arcy, C. J. (2002) Nucleotide sequence shows that Bean leafroll virus has a Luteovirus like genome organization. Journal of General Virology 83: Dovas, C. I. and Katis, N. I. (2003) A spot nested RT PCR method for the simultaneous detection of members of the Vitivirus and Foveavirus genera in grapevine. Journal of Virological Methods 107: Dovas, C. I., Efthimiou, K. and Katis, N. I. (2004) Generic detection and differentiation of tobamoviruses by a spot nested RT PCR RFLP using di containing primers along with homologous dg containing primers. Journal of Virological Methods 117: Dovas, C., Theoharopoulos, A., Loumbourdis, I., Smyrnioudis, E., Sklavounos, P. A., Kyriakopoulou, P. E. and Katis, N. I. (2001) Beet western yellows virus (BWYV) in Greece. Phytopathologia Mediterranea 40:193. Duffus, J. E. (1960) Radish yellows: a disease of radish, sugar beet and other crops, Phytopathology 50: Duffus, J. E. (1964) Host relationships of Beet western yellows virus strains. Phytopathology 54: Duffus, J. E. (1977) Aphids, viruses and the yellow plague. In: Aphids as Virus Vectors, pp Edited by Harris, K. F. and Maramorosch, K. New York: Academic Press. Duffus, J. E., (1973) The yellowing virus disease of beet. Advances in Virus Research 18: Esau, K. (1957) Phloem degeneration in the Gramineae affected by the Barley yellow dwarf virus. American Journal of Botany 44: Falk, B. W., Duffus, J. E. (1984) Identification of small single and double stranded RNAs associated with severe symptoms in Beet western yellows virus infected Capsella bursa pastoris. Phytopathology 74: Falk, B. W., Duffus, J. E. and Morris, T. J. (1979) Transmission, host range, and serological properties of the viruses that cause lettuce speckles disease. Phytopathology 69: Falk, B. W., Chin, L. S. and Duffus, J. E. (1989) Complementary DNA cloning and hybridization analysis of Beet western yellows luteovirus RNAs. Journal of General Virology 70: Fenner, F. (1976) The classification and nomenclature of viruses. Virology 71: Filichkin, S. A., Brumfield, S., Filichkin, T. P. and Young, M. J. (1997) In vitro interactions of the aphid endosymbiotic syml with Barley yellow dwarf virus. Journal of Virology 71:

105 Βιβλιογραφία Francki, R. I. B., Fauquet, C. M., Knudson, D. L. and Brown, F. (1991) Classification and nomenclature of viruses. Fifth Report of the International Committee on Taxonomy of Viruses. Archives of Virology Supplement 2. Fuji, Y., Kiyotani, K., Yoshida, T. and Sakaguchi, T. (2001) Conserved and non conserved regions in the Sendai virus genome: evolution of a gene possessing overlapping reading frames. Virus Genes 22: Garret, A., Kerlan, C. and Thomas, D. (1993) The intestine is a site of passage for Potato leafroll virus from the gut lumen into the haemocoel in the aphid vector, Myzus persicae Sulz. Archives of Virology 131: Garret, A., Kerlan, C. and Thomas, D. (1996) Ultrastructural study of acquisition and retention of Potato leafroll luteovirus in the alimentary canal of its aphid vector, Myzus persicae Sulz. Archives of Virology 141: Gates, L. F. (1962) A virus causing axillary bud sprouting of tobacco in Rhodesia and Nyasaland. Annals of Applied Biology 50: Gibbs, M. J., Cooper, J. I. and Waterhouse, P. M. (1996a) The genome organization and affinities of an Australian isolate of Carrot mottle umbravirus. Virology 224: Gibbs, M. J., Ziegler, A., Robinson, D. J., Waterhouse, P. M. and Cooper, J. I. (1996b) Carrot mottle mimic virus (CMoMV): a second umbravirus associated with carrot motley dwarf disease recognised by nucleic acid hybridisation. Molecular Plant Pathology On Line [http://www.bspp.org.uk/mppol/1996/1111gibbs/]. Gildow, F. E. (1993) Evidence for receptor mediated endocytosis regulating luteovirus acquisition by aphids. Phytopathology 83: Gildow, F. E. (1999) Luteovirus transmission and mechanisms regulating vector specificity. In: The Luteoviridae, pp Edited by Smith, H. G., Barker, H. Wallingford, UK: CAB International. Gill, C. C. (1967) Transmission of Barley yellow dwarf virus isolates from Manitoba by five species of aphids. Phytopathology 57: Gill, C. C. and Chong, J. (1976) Differences in cellular ultrastructural alterations between variants of Barley yellow dwrf virus. Virology 75: Gray, S. M., (1996) Plant virus proteins involved in natural vector transmission. Trends in Microbiology 4:

106 Βιβλιογραφία Gray, S. M. and Gildow, F. E. (2003) Luteovirus aphid interactions. Annual Review of Phytopathology 41: Guilley, H., Richards, K. E., and Jonard G. (1995) Nucleotide sequence of Beet mild yellowing virus RNA. Archives of Virology 140: Guilley, H., Wipf Scheibel, C., Richards, K., Lecoq, H., and Jonard, G. (1994) Nucleotide sequence of Cucurbit aphid borne luteovirus. Virology 202: Guindon, S. and Gascuel, O. (2003) A simple, fast, and accurate algorithm to estimate large phylogenies by maximum likelihood. Systematic Biology 52: Gunn, L. V. and Pares, R. D. (1990) Capsicum Yellows A disease induced by a Luteovirus in glasshouse peppers (Capsicum annuum) in Australia. Journal of Phytopathology 129: Guyader, S. and Ducray, D. G (2002) Sequence analysis of Potato leafroll virus isolates reveals genetic stability, major evolutionary events and differential selection pressure between overlapping reading frame products. Journal of General Virology 83: Harrison, B. D. (1999) Steps in the development of luteovirology. In: The Luteoviridae, pp Edited by Smith, H. G., Barker, H. Wallingford, UK: CAB International. Hauser, S., Stevens, M., Beuve, M., and Lemaire, O. (2002) Biological properties and molecular characterization of Beet chlorosis virus (BChV) Archives of Virology 147: Hauser, S., Weber, C., Vetter, G., Stevens, M., Beuve, M. and Lemaire, O. (2000b) Improved detection and differentiation of poleroviruses infecting beet or rape by multiplex RT PCR. Journal of Virological Methods 89: Hauser, S., Stevens, M., Mougel, C., Smith, H. G., Fritsch, C., Herrbach E., and Lemaire, O., (2000a) Biological, serological and molecular variability suggest three distinct Polerovirus species infecting beet or rape. Phytopathology 90: Herrbach, E. (1994) Serological detection of Beet western yellows luteovirus in the non vector, Brevicoryne brassicae (Homoptera, Aphididae). Journal of Phytopathology 142: Herrbach, E. (1999) Vector Virus Interactions. In The Luteoviridae, pp Edited by Smith, H. G., Barker, H. Wallingford, UK: CAB International. Holmes, E. C. (2008) Comparative Studies of RNA Virus Evolution. In: Origin and evolution of viruses, pp Edited by Domingo, E., Parrish, C. R. and Holland, J. J. Elsevier Academic Press. Hsu, H. T., Aebig, J. and Rochow, W. F. (1984) Differences among monoclonal antibodies to barley yellow dwarf viruses. Phytopathology 74:

107 Βιβλιογραφία Huang, L. F., Naylor, M., Pallett, D. W., Reeves, J., Cooper, J. I. and Wang, H. (2005) The complete genome sequence, organization and affinities of Carrot red leaf virus. Archives of Virology 150: Hughes, A. L., Westover, K., da Silva, J., O Connor, D. H. and Watkins, D. I. (2001) Simultaneous positive and purifying selection on overlapping reading frames of the tat and vpr genes of Simian Immunodeficiency virus. Journal of Virology 75: Jensen, S. G. (1969) Occurrence of virus particles in the phloem tissue of BYDV infected barley. Virology 38: Juarez, M. (2004) First report of Cucurbit aphid borne yellows virus in Spain. Plant Disease 88:907. Juszczuk, M., Paczkowska, E., Sadowy, E., Zagorski, W. and Hulanicka, D. M. (2000) Effect of genomic and subgenomic leader sequences of Potato leafroll virus on gene expression. FEBS Letters 484: Katoh, K. and Toh, H (2008) Recent developments in the MAFFT multiple sequence alignment program. Briefings in Bioinformatics 9: Kibbe, W. A. (2007) OligoCalc: an online oligonucleotide properties calculator. Nucleic Acids Research 35:W43 W46. Kitabayashi, M and Esaka, M. (2003) Improvement of reverse transcription PCR by RNase H. Bioscience, Biotechnology, and biochemistry 67: Kojima, M., Shikata, E., Sugawara, M. and Murayama, D. (1968) Isolation and electron microscopy of Potato leafroll virus from plants. Virology 35: Kumar, S., Nei, M., Dudley, J. and Tamura, K. (2008) MEGA: a biologistcentric software for evolutionary analysis of DNA and protein sequences. Briefings in Bioinformatics 9: Lamb, J. W., Duncan, G. H., Reavy, B., Gildow, F. E., Mayo, M. A. and Hay, R. T. (1996) Assembly of virus like particles in insect cells infected with a baculovirus containing a modified coat protein gene of potato leafroll luteovirus. Journal of General Virology 77: Lapierre, H. and Signoret, P. A. (eds) (2004) Viruses and Virus Diseases of Poaceae (Graminae) INRA Editions, Paris, France. Larkin, M. A., Blackshields, G., Brown, N. P., Chenna, R., McGettigan, P. A., McWilliam, H., Valentin, F., Wallace, I. M., Wilm, A., Lopez, R., Thompson, J. D., Gibson, T. J. and Higgins D.G. (2007) ClustalW2 and ClustalX version 2. Bioinformatics 23:

108 Βιβλιογραφία Lecoq, H., Bourdin, D., Wipf Scheibel, C., Bon, M., Lot, H., Lemaire, O., Herrbach, E. (1992) A new yellowing disease of cucurbits caused by a luteovirus, Cucurbit aphid borne yellows virus. Plant Pathology 41: Lehrer, A. T. and Komor, E. (2008) Symptom expression of yellow leaf disease in sugarcane cultivars with different degree of infection by Sugarcane yellow leaf virus (SCYLV). Plant Pathology 57: Lehrer, A. T., Wu, K. K. and Komor, E. (2009) Impact of Sugarcane yellow leaf virus on growth and sugar yield of sugarcane. Journal of General Plant Pathology 75: Lemaire, O., Gubler, W. D., Valencia, J., Lecoq, H. and Falk, B. W. (1993) First report of Cucurbit aphid borne yellows virus in the United States. Plant Disease 77:1169. Lemaire O., Herrbach, E., Stevens, M., Bouchery, Y., and Smith, H.G. (1995) Detection of sugar beetinfecting Beet mild yellowing luteovirus isolates with a specific RNA probe. Phytopathology 85: Leonard, S. H. and Holbrook, F. R. (1978) Minimum acquisition and transmission times for Potato leafroll virus by the green peach aphid. Annals of the Entomological Society of America 71: Liu, H. Y., Wisler, G. C., Sears, J. L., Duffus, J. E. (1999) Beet chlorosis virus a new luteovirus affecting sugar beet. Journal of Sugar Beet Research 36:69. Loebenstein, G. and Thottappilly, G. (eds) (2003) Virus and Virus like Diseases of Major Crops in Developing Countries, the Netherlands: Kluwer Academic Publishers. Makkouk, K. M., Kumari, S. G., Shahraeen, N., Fazlali, Y., Farzadfar, S.,Ghotbi, T., and Mansouri, R. A. (2003) Identification and seasonal variation of viral diseases of chickpea and lentil in Iran. Journal of Plant Diseases and Protection 110: Maliogka, V. I., Dovas, C. I. and Katis, N. I. (2007) Demarcation of ilarviruses based on the phylogeny of RNA2 encoded RdRp and a generic ramped annealing RT PCR. Archives of Virology 152: Maliogka, V., Dovas, C. I., Efthimiou, K. and Katis, N. I. (2004) Detection and differentiation of Comoviridae species using a semi nested RT PCR and a phylogenetic analysis based on the polymerase protein. Journal of Phytopathology 152: Malmstrom, C. M. and Shu, R. (2004) Multiplexed RT PCR for streamlined detection and separation of barley and cereal yellow dwarf viruses. Journal of Virological Methods 120: Marco, S. (1991) Carrot red leaf virus in Israel. Phytoparasitica 21:

109 Βιβλιογραφία Matthews, R. E. F. (ed.) (1979) Classification and nomenclature of viruses. Third report of the international committee on taxonomy of viruses. Intervirology 12: Matthews, R. E. F. (ed.) (1982) Classification and nomenclature of viruses. Fourth report of the international committee on taxonomy of viruses. Intervirology 17: Mayo, M. A. (2002) ICTV at the Paris ICV: results of the plenary session and the binomial ballot. Archives of Virology 147: Mayo, M. A. and Ziegler Graff, V. (1996) Molecular biology of luteoviruses. Advances in Virus Research 56: Mayo, M. A. and D Arcy, C. J. (1999) Family Luteoviridae: a reclassification of luteoviruses. In: The Luteoviridae, pp Edited by Smith, H. G., Barker, H. Wallingford, UK: CAB International. Mayo, M. A. and Miller, W. A. (1999) The structure and expression of luteovirus genomes. In: The Luteoviridae, pp Edited by Smith, H. G., Barker, H. Wallingford, UK: CAB International. Mayo, M. A., Taliansky, M. E. and Fritsch, C. (1999) In: Satellites and Defective RNAs, pp Edited by Vogt, P. K. and Jackson, O, Berlin: Springer Verlag. Mayo, M. A., Ryabov, E., Fraser, G. and Taliansky, M. (2000) Mechanical transmission of Potato leafroll virus. Journal of General Virology 81: McGavin, W. J. and MacFarlane, S. A. (2009) Rubus chlorotic mottle virus, a new sobemovirus infecting raspberry and bramble. Virus Research 139: McKee, R. K. (1964) Virus infection in South American potatoes. European Potato Journal 7: Menzel, W., Maiss, E. and Vetten, H. J. (2009) Nucleotide sequence of a satellite RNA associated with carrot motley dwarf in parsley and carrot. Virus Genes 38: Miller, W. A, Hercus, T., Waterhouse, P. M. and Gerlach, W. L. (1991) A satellite RNA of Barley yellow dwarf virus contains a novel hammerhead structure in the selfcleavage domain. Virology 183: Mnari Hattab, M., Kummert, J., Roussel, S., Ezzaier, K., Zouba, A., and Jijakli, M. H. (2005) First report of Cucurbit aphid borne yellows virus in Tunisia causing yellows on five cucurbitaceous species. Plant Disease 89:776. Mo, X. H., Qin, X. Y., Wu, J., Yang, C., Wu, J. Y., Duan, Y. Q., Li, T. F. and Chen, H. R. (2003) Complete nucleotide sequence and genome organization of a Chinese isolate of tobacco bushy top virus. Archives of Virology 148:

110 Βιβλιογραφία Moonan, F., Molina, J., and Mirkov, T. E. (2000) Sugarcane yellow leaf virus: an emerging virus that has evolved by recombination between luteoviral and poleroviral ancestors. Virology 269: Natti, J. J., Kirkpatrick, C. H. and Ross, A. F. (1953) Host Range of Potato leafroll virus. American Potato Journal 30: Nault, L.R. (1997) Arthropod transmission of plant viruses a new synthesis. Annals of the Entomological Society of America 90: Ng, J. C. K. and Perry K. L. (2004) Transmission of plant viruses by aphid vectors. Molecular Plant Pathology 5: O Reilly, E. K. and Kao, C. C. (1998) Analysis of RNA dependent RNA polymerase structure and function as guided by known polymerase structures and computer predictions of secondary structure. Virology 252: Oortwijn Botjes, J. G. O. (1920) De bladrolziekte van de aardappelplant. Thesis, Landbouwhoogeschool, Wageningen. Orton, W. A. (1913) Leafroll, curly leaf and other new potato diseases. Phytopathology 3:69. Oswald, J. W. and Houston, B. R. (1951) A new virus disease of cereals, transmissible by aphid. Plant Disease Reporter 35: Oswald, J. W. and Houston, B. R. (1953) Host range and epiphytology of the cereal yellow dwarf disease. Phytopathology 43: Paliwal, Y. C. (1977) Rapid diagnosis of Barley yellow dwarf virus in plants using serologically specific electron microscopy. Phytopathologische Zeitschrift 89: Papayiannis, L. C., Ioannou, N., Boubourakas, I. N., Katis, N. I. and Falk, B.W. (2005) Incidence of viruses infecting cucurbits in Cyprus. Journal of Phytopathology 153: Pavesi, A. (2006) Origin and evolution of overlapping genes in the family Microviridae. Journal of General Virology 87: Peiffer, M. L., Gildow, F. E. and Gray, S. M. (1997) Two distinct mechanisms regulate luteovirus transmission efficiency and specificity at the aphid salivary gland. Journal of General Virology 78: Pernezny, K., Roberts, P. D., Murphy, J. F. and Goldberg P. N. (eds) (2003) Compedium of Pepper Diseases, St. Paul, Minnesota: APS Press. 97

111 Βιβλιογραφία Pfeffer, S., Dunoyer, P., Heim, F., Richards, K. E., Jonard, G. and Ziegler Graff, V. (2002) P0 of Beet western yellows virus is a suppressor of posttranscriptional gene silencing. Journal of Virology 76: Poch, O., Sauvaget, I., Delarue, M. and Tordo, N. (1989) Identification of four conserved motifs among the RNA dependent polymerase encoding elements. The EMBO Journal 8: Ponsen, M. B. (1972) The site of Potato leafroll virus multiplication in its vector, Myzus persicae: an anatomical study. Meded Landbouwhogesch Wageningen 72: Power, G. A. and Gray, S. M. (1995) Aphid transmission of Barley yellow dwarf viruses: Interactions between viruses, vectors, and host plants. In: Barley Yellow Dwarf 40 Years of Progress, pp Edited by D Arcy C., J. and Burnett, P. A. St. Paul, Minnesota: APS Press. Prüfer, D., Kawchuk, L., Monecke, M., Nowok, S., Fischer, R. and Rohde, W. (1999) Immunological analysis of Potato leafroll luteovirus (PLRV) P1 expression identifies a 25 kda RNA binding protein derived via P1 processing. Nucleic Acids Research 27: Quanjer, H. M. (1913) Necrose der kartoffelpflanze die ursache der blattrollkrankheit. Mededelingen van de Landbouwhoogeschool te Wageningen 6: Quanjer, H. M., van der Lek, H. A. A. and Oortwijn Botjes, J. G. (1916) Aard verspreidingswijze en bestrijding van phloem necrose en verwante ziekten. Mededelingen van de Landbouwhoogeschool te Wageningen 10: Randles, J. W. and Rathjen, J. P. (1995) Genus Luteovirus. In: Virus Taxonomy: Sixth Report of the International Committee on Taxonomy of Viruses, pp Edited by Murphy,F. A., Fauquet, C. M., Bishop, D. H. L., Ghabrial, S. A., Jarvis, A.W., Martelli, G. P., Mayo, M. A. and Summers, M. D. Wien, New York: Springer Verlag. Rasochova, L. and Miller, W. A. (1996) Satellite RNA of Barley yellow dwarf RPV virus reduces accumulation of RPV helper virus RNA and attenuates RPV symptoms in oats. Molecular Plant Microbe Interactions 9: Rasochova, L., Passmore, B. K., Falk, B. W. and Miller, W. A. (1997) The satellite RNA of Barley yellow dwarf virus RPV is supported by Beet western yellows virus in dicotyledonous protoplasts and plants. Virology 231: Rathjen, J. P., Karageorgos, L. E., Habili, N., Waterhouse, P. M., and Symons, R. H. (1994) Soybean dwarf luteovirus contains the third variant genome type in the luteovirus group. Virology 198:

112 Βιβλιογραφία Reinbold, C., Herrbach, E. and Brault, V. (2003) Posterior midgut and hindgut are both sites of acquisition of Cucurbit aphid borne yellows virus in Myzus persicae and Aphis gossypii. Journal of General Virology 84: Reutenauer, A., Ziegler Graff, V., Lot, H., Scheidecker, D., Guilley, H., Richards, K. and Jonard, G. (1993) Identification of Beet western yellows luteovirus genes implicated in viral replication and particle morphogenesis. Virology 195: Robert, Y. and Lemaire, O. (1999) Epidemiology and control strategies. In: The Luteoviridae, pp Edited by H. G. Smith & H. Barker. Wallingford, UK: CAB International. Robertson, N. L., French, R. and Gray, S. M. (1991) Use of group specific primers and the polymerase chain reaction for the detection and identification of luteoviruses. Journal of General Virology 72: Rochow, W. F. (1969) Biological properties of four isolates of Barley yellow dwarf virus. Phytopathology 59: Roland, G. (1936) Researches sur la juanisse de la beterave et quelques observations sur la mosaique de cette plant. Le Sucre Belge 55: Russell, G. E. (1958) Sugarbeet yellows: a preliminary study of the distribution and interrelationships of viruses and virus strains found in East Anglia, Annals of Applied Biology 46: Russell, G. E., (1962) Sugar beet mild yellowing virus. A persistent aphid transmitted virus. Nature 195:1231. Russell, G. E. (1965) The host range of some English isolates of beet yellowing viruses. Annals of Applied Biology 55: Russel, G. E. and Duffus, J. E. (1970a) An aphid transmitted yellowing virus disease of lettuce in England. Plant Pathology 19: Russel, G. E. and Duffus, J. E. (1970b) Serological and host range evidence for the occurrence of beet western yellows virus in Europe. Phytopathology 60: Sadowy, E., Maasen, A., Juszcsuk, M., David, C., Zagorski Ostoja, W., Gronenborn, B. and Hulanicka, M. D. (2001) The ORF0 product of Potato leafroll virus is indispensable for viral replication. Journal of General Virology 82: Sambrook, J. and Russell, D. (2001) Molecular cloning: A laboratory manual, 3rd ed. pp New York: Cold Spring Harbor Laboratory Press. 99

113 Βιβλιογραφία Scagliusi, S. M., and Lockhart, B. E. L. (2000) Transmission, characterization, and serology of a luteovirus associated with yellow leaf syndrome of sugarcane. Phytopathology 90: Scheller, H. V. and Shukle, R. H. (1986) Feeding behavior and transmission of Barley yellow dwarf virus by Sitobion avenae on oats. Entomologia Experimentalis et Applicata 40: Schenck, S., and Lehrer, A. T. (2000) Factors affecting the transmission and spread of Sugarcane yellow leaf virus. Plant Disease 84: Sheffield, F. M. L. (1943) Value of phloem necrosis in the diagnosis of potato leaf roll. Annals of Applied Biology 30: Shepardson, S., Esau, K. and McCrum, R. (1980) Ultrastructure of potato leaf phloem infected with Potato leaf roll virus. Virology 105: Smith, G. R., Borg, Z., Lockhart, B. E. L., Braithwaite, K. S., and Gibbs, M. (2000) Sugarcane yellow leaf virus: a novel member of the Luteoviridae that probably arose by inter species recombination. Journal of General Virology 81: Smith, H. G. and Hinckes, J. A. (1985) Studies on Beet western yellows virus in oilseed rape (Brassica napus ssp.oleifera) and sugar beet (Beta vulgaris). Annals of Applied Biology 107: Smith, K. M. (1946) Tobacco rosette: A complex virus disease. Parasitology 37: Stevens, M., Smith, H. G., Hallsworth, P. B. (1994) Identification of a second distinct strain of Beet mild yellowing luteovirus using monoclonal antibodies and transmission studies. Annals of Applied Biology 125: Stevens, M., Hallsworth, P. B. and Smith, H. G. (2004) The effects of Beet mild yellowing virus and Beet chlorosis virus on the yield of UK fieldgrown sugar beet in 1997, 1999 and Annals of Applied Biology 144: Stevens, M., Freeman, B., Liu, H. Y., Herrbach, E. and Lemaire, O. (2005a) Beet poleroviruses: close friends or distant relatives? Molecular Plant Pathology 6:1 9. Stevens, M., Patron, N. J., Dolby, C. A., Weeks, R., Hallsworth, P. B., Lemaire, O., and Smith, H. G. (2005b) The distribution and properties of geographically distinct isolates of sugar beet yellowing viruses. Plant Pathology 54: Strimmer, K. and von Haeseler, A. (1997) Likelihood mapping: a simple method to visualize phylogenetic content of a sequence alignment. Proceedings of the National Academy of Sciences of the Unites States of America 94: Stubbs, L. L. (1948) A new disease of carrots: its transmission, host range and control. Australian Journal of Scientific Research B1:

114 Βιβλιογραφία Syller, J., (2003) Molecular and biological features of umbraviruses, the unusual plant viruses lacking genetic information for a capsid protein. Physiological and Molecular Plant Pathology 63: Syller, J., Marczewski, W. and Pawlowicz, J. (1997) Transmission by aphids of Potato spindle tuber viroid encapsidated by Potato leafroll luteovirus particles. European Journal of Plant Pathology 103: Taliansky, M. and Barker, H. (1999) Movement of luteoviruses in infected plants. In: The Luteoviridae, pp Edited by H. G. Smith & H. Barker. Wallingford, UK: CAB International. Taliansky, M. E, Robinson, D. J. (2003) Molecular biology of umbraviruses: phantom warriors. Journal of General Virology 84: Taliansky, M. E., Robinson, D. J. and Murant, A. F. (2000) Groundnut rosette disease virus complex: biology and molecular biology. Advances in Virus Research 55: Taliansky, M., Mayo, M. A. and Barker, H. (2003) Potato leafroll virus: a classic pathogen shows some new tricks. Molecular Plant Pathology 4: Tamura, K., Dudley, J., Nei, M. and Kumar, S. (2007) MEGA4: molecular evolutionary genetics analysis (MEGA) software version 4.0. Molecular Biology and Evolution 24: Thomas, P. E. and Hassan, S. (2002) First report of twenty two new hosts of Potato leafroll virus. Plant Disease 86: Timmerman, E. L., D Arcy, C. J. and Splittstoesser, W. E. (1985) Beet western yellows virus in Illinois Vegetable Crops and weeds. Plant Disease 69: Tomassoli, L. and Meneghini, M. (2007) First report of Cucurbit aphid borne yellows virus in Italy. Plant Pathology 56:720. van Bel, A. J. E. (2003) The phloem, a miracle of ingenuity. Plant, Cell and Environment 26: van den Heuvel, J. F. J. M., Hogenhout, S. A. and van der Wilk, F. (1999) Recognition and receptors in virus transmission by arthropods. Trends in Microbiology 7: van den Heuvel, J. F. J. M., Bruyere, A., Hogenhout, S. A., Ziegler Graff, V., Brault, V., Verbeek, M., van der Wilk, F. and Richards, K. (1997) The N terminal region of the luteovirus readthrough domain determines virus binding to Buchnera GroEL and is essential for virus persistence in the aphid. Journal of Virology 71: van der Wilk, F., Verbeek, M., Dullemans, A. M. and van den Heuvel, J. F. J. M. (1997) The genomelinked protein of Potato leafroll virus is located downstream of the putative protease domain of the ORF 1 product. Virology 234:

115 Βιβλιογραφία Veidt, I., Lot, H., Leiser, M., Sceidecker, D., Guilley, H., Richards, K., and Jonard G. (1988) Nucleotide sequence of Beet western yellows virus RNA. Nucleic Acids Research 16: Vercruysse, P., Gibbs, M., Tirry, L. and Hofte, M. (2000) RT PCR using redundant primers to detect the three viruses associated with carrot motley dwarf disease. Journal of Virological methods 88: Vigano, F. and Stevens, M. (2007) Development of a multiplex immunocapture RT PCR for simultaneous detection of BMYV and BChV in plants and single aphids. Journal of Virological Methods 146: Viswanathan, R., Balamuralikrishnan M., and Karuppaiah R. (2008) Identification of three genotypes of sugarcane yellow leaf virus causing yellow leaf disease from India and their molecular characterization. Virus Genes 37: Waterhouse, P. M. and Murant, A. F. (1983) Further evidence on the nature of the dependence of Carrot mottle virus on Carrot red leaf virus for transmission by aphids. Annals of Applied Biology 103: Waterhouse, P. M., Gildow, F. E. and Johnstone, G. R. (1988) Luteovirus group. AAB Descriptions of Plant Viruses, no Watson, M. A. (1952) Beet yellows virus and other yellowing virus diseases of sugar beet. In: Rothamsted Experimental Station Annual Report, pp Watson, M. T. and Falk, B. W. (1994) Ecological and epidemiological factors affecting carrot motley dwarf development in carrots grown in the Salinas Valley of California. Plant Disease 78: Watson, M. T., Tian, T., Estabrook, E. and Falk, B. W. (1998) A small RNA resembling the Beet western yellows luteovirus ST9 associated RNA is a component of the California carrot motley dwarf complex. Phytopathology 88: Watson, M., Serjeant, E. P., Lennon, E. A. (1964) Carrot motley dwarf and parsnip mottle viruses. Annals of Applied Biology 54: Xiang, H. Y., Shang, Q. X., Han, C. G., Li, D. W., and Yu, J. L. (2008a) Complete sequence analysis reveals two distinct poleroviruses infecting cucurbits in China. Archives of Virology 153: Xiang, H., Shang, Q., Han, C., Li, D. and Yu, J. (2008b) First report on the occurrence of Cucurbit aphid borne yellows virus on nine cucurbitaceous species in China. Plant Pathology 57:

116 Βιβλιογραφία Yardimci, N., and Ozgonen, H. (2007) First report of Cucurbit aphid borne yellows virus in Turkey. Australasian Plant Disease Notes 2:59. Yonaha, T., Toyosato, T., Kawano, S. and Osaki, T. (1995) Pepper vein yellows virus, a novel luteovirus from bell pepper plants in Japan. Annals of the Phytopathological Society of Japan 61: Zhang, W., Cheng, Z., Xu, L., Wu, M., Waterhouse, P., Zhou, G. and Li, S., (2009) The complete nucleotide sequence of the Barley yellow dwarf GPV isolate from China shows that it is a new member of the genus Polerovirus. Archives of Virology 154: Ziegler Graff, V., Brault, V., Mutterer, D., Simonis, M. T., Herrbach, E., Guilley, H., Richards, K. E. and Jonard, G. (1996) The coat protein of Beet western yellows luteovirus is essential for systemic infection but the viral gene products P29 and P19 are dispensable for systemic infection and aphid transmission. Molecular Plant Microbe Interactions 9:

117 104

118 Παράρτημα Α. Αλληλουχίες που χαρακτηρίστηκαν στην παρούσα μελέτη 1.PY [FN600344] [Τμηματική αλληλουχία της RdRp (διάστικτη υπογράμμιση), τμηματική αλληλουχία της CP (μονή και διπλή υπογράμμιση) και πλήρης αλληλουχία της MP (διπλή υπογράμμιση)] 1 CCTTATCATG AGTGTTTCCC TAGTAGATCA ATTGGTAGCC CGGGTTCTGT 51 TTCAAAACCA GAACAAGCGA GAAATCGCTC TTTGGAGGGC AAATCCCTCA 101 AAACCCGGTT TTGGCTTGTC TACGGATGAG CAAGTGCTGG AGTTCGTACA 151 AGCTCTGGCC GCGCAAGTGG AAGTTCCACC AGAGGAAGTG ATTACCTCGT 201 GGGAGAAGTA CCTTGTGCCG ACTGATTGCT CTGGATTTGA CTGGAGCGTT 251 GCGGAATGGA TGCTACATGA CGATATGGTC GTCCGCAACA AACTCACACT 301 GGACTTAAAT CCGACAACGG AAAAGCTACG ATCTGTGTGG CTAAAGTGCA 351 TCTGCAATAG TGTCCTGTGT TTGAGTGATG GCACACTCCT CGCCCAAAGG 401 GTCCCCGGCG TTCAAAAGTC CGGTAGCTAC AACACAAGTA GCTCTAATTC 451 AAGGATCCGA GTTATGGCCG CCTACCACTG TGGGGCTGAC TGGGCTATGG 501 CGATGGGAGA TGATGCTCTC GAATCAGTCA ACACTAACCT AGAGGTGTAT 551 AAAGATCTAG GTTTTAAAGT CGAGGTTTCA GGACAACTGG AATTCTGCTC 601 TCACATCTTT AGAGCGCCTG ACCTTGCCCT TCCCGTGAAT GAGCGTAAAA 651 TGCTGTACAA GCTCATCTTC GGATATAATC CGGGAAGTGG GAATCTGGAG 701 GTTATCTCCA ACTATATCGC CGCTTGTGTA TCAGTTCTAA ACGAATTGCG 751 GCATGACCCA GATTCCGTTG CTCTCCTTCA CCAGTGGTTA GTCTCTCCAG 801 TGCTGCCACA AAATAATTGA AGAGAGAGCG TATAACTAGC CAAGCATACA 851 TCAGTTGCAA GCGTTGGAAG TTCAAGTCTG ATTACCAACA GCCTGACACA 901 ATAGATTTTA AATTTTTAGC AGGATTTGCG TTTGGATTTT TATCCGCAAT 951 CCCAATTTCG ATAGCAGGCA TATACCTAGT CTACCTGAAA ATCTCAGCCC 1001 ACGTACGCGC AATCGTTAAT GAATACGGGA GGAGTTAGGA GTAACAATAA 1051 TGGAAATGGT GGATCACGCA GCACCCGCCG TCGCAGACGC CCACGACAGG 1101 TTCGCCCTGT CGTTGTGGTC GCACCCCCTG GGCGCACACG GCGGGGAAAT 1151 CGAAGACGAC GAAATGGAGG CAGGAACCGA AGAAGCCGAA ATAGAGTTGG 1201 AGGACGGTCG AGCAACAGCG AGACTTTCGT CTTCAACAAG GACTCAATCA 1251 AGGATAGTTC CTCAGGAGCT GTCACCTTCG GGCCGTCTCT ATCAGAGAGC 1301 ATCGCGCTTT CAGGTGGAGT TCTCAAAGCC TACCATGAAT ATAAGATCAC 1351 AATGGTCAAC ATACGCTTCG TCAGTGAATC CTCTTCCACA GCGGAGGGCT 1401 CCATCGCTTA CGAGCTGGAC CCCCACTGCA AGCTTACTAG TCTCCAATCC 1451 ACCCTGCGTA AGTTCCCCGT CACCAAAGGC GGGCAAGCGA CTTTTAGGGC 1501 TTCGCAGATT AACGGGGTAG AGTGGCATGA TACATCCGAA GATCAATTTA 1551 GGCTGCTCTA CAAAGGCAAT GGAACAAAGA ACGTTGCCGC CGGTTTCTTC 1601 CAGATCCGGT TCACTGTGCA ACTGCCCAAC RdRP (1 820nt): LIMSVSLVDQLVARVLFQNQNKREIALWRANPSKPGFGLSTDEQVLEFVQALAAQVEVPPEEVITSWEKYLVPTD CSGFDWSVAEWMLHDDMVVRNKLTLDLNPTTEKLRSVWLKCICNSVLCLSDGTLLAQRVPGVQKSGSYNTSSSN 105

119 Παράρτημα SRIRVMAAYHCGADWAMAMGDDALESVNTNLEVYKDLGFKVEVSGQLEFCSHIFRAPDLALPVNERKMLYKLIF GYNPGSGNLEVISNYIAACVSVLNELRHDPDSVALLHQWLVSPVLPQNN* CP ( nt): MNTGGVRSNNNGNGGSRSTRRRRRPRQVRPVVVVAPPGRTRRGNRRRRNGGRNRRSRNRVGGRSSNSETFV FNKDSIKDSSSGAVTFGPSLSESIALSGGVLKAYHEYKITMVNIRFVSESSSTAEGSIAYELDPHCKLTSLQSTLRKFPV TKGGQATFRASQINGVEWHDTSEDQFRLLYKGNGTKNVAAGFFQIRFTVQLPN MP ( nt): MEMVDHAAPAVADAHDRFALSLWSHPLGAHGGEIEDDEMEAGTEEAEIELEDGRATARLSSSTRTQSRIVPQEL SPSGRLYQRASRFQVEFSKPTMNIRSQWSTYASSVNPLPQRRAPSLTSWTPTASLLVSNPPCVSSPSPKAGKRLLG LRRLTG* 2.CA1 [FN600343] (Τμηματική αλληλουχία της RdRp) 1 CCTCATCATG AGCGTCTCTC TAGTAGATCA ACTGGTAGCC CGGGTTTTAT 51 TCCAAAATCA GAACAAGCGC GAGATAGCGT TATGGAGAGT GGTTCCCTCC 101 AAACCCGGTT TTGGCTTGTC CACGGATGAG CAAGTGGCGG AGTTCATGCA 151 GATTCTCTCC GCCCAGGTTG GGCTCACGCC TTCGGAATTG ATCACCGAGT 201 GGCGATCCCA CATGATAGCA ACTGACTGCT CCGGTTTTGA CTGGAGCGTT 251 TCGGACTGGC TCCTTGAAGA TGATATGGAG GTCCGAAACC GCCTGACGCT 301 CGATTTAAAC GAGACCACGC GCCGTTTACG CGCAGCGTGG TTGCACTGCA 351 TATCAAACAG CGTCCTCTGC CTTTCAGATG GAACATTATT AGCGCAGAGA 401 GTCCCAGGCG TGCAGAAGAG TGGCAGCTAC AATACATCAT CGAGCAATTC 451 CCGAATCCGG GTGATGGCTG CCTACCACTG CGGCGCAGAG TGGGCTATGG 501 CGATGGGCGA TGATGCCCTT GAGTCAGCTT GCTCGAACCT CGAGCGTTAC 551 AAGTCGCTC LIMSVSLVDQLVARVLFQNQNKREIALWRVVPSKPGFGLSTDEQVAEFMQILSAQVGLTPSELITEWRSHMIATD CSGFDWSVSDWLLEDDMEVRNRLTLDLNETTRRLRAAWLHCISNSVLCLSDGTLLAQRVPGVQKSGSYNTSSSN RIRVMAAYHCGAEWAMAMGDDALESACSNLERYKSL 3.BW6 [FN600342] (Τμηματική αλληλουχία της RdRp) 1 CCTCATAATG AGCGTTTCCT TGGTGGATCA ACTGGTAGCC CGGGTCTTGT 51 TTCAGAATCA GAACAAGCGT GAAATTGCCC TATGGAGGGC AGTGCCATCC 101 AAGCCCGGTT TTGGCTTGTC TACGGATGAG CAAGTCGTGG AGTTTGTTCA 151 AATGCTCTCC GCGCAGGTGA AAATGAGTCC TCCCCAATTG ATCAGTGACT 201 GGAGGCAACA CCTAGTTGCA ACTGATTGCT CCGGTTTTGA CTGGAGTGTT 251 TCGGACTGGC TTCTTGAAGA TGATATGGAA GTCCGAAATC GTCTCACCAC 301 GGATCTTAAC GAGACGACCA GCAAGCTTCG TGCTGCTTGG TTGAAATGCA 351 TCTCCAACAG TGTCCTGTGT CTTTCTGATG GTACCCTGCT TGCGCAGCGC 401 GTGCCTGGAG TTCAAAAGTC AGGAAGCTAT AACACCTCCT CGTCCAATTC 451 TCGGATTAGA GTGATGGCAG CTTTCCACTG TGGAGCAGAG TGGGCGATGG 501 CGATGGGCGA TGACGCCCTT GAATCAGTTA GCACCGACCT GGGGAAATAC 551 GCCGCCCTA 106

120 Παράρτημα LIMSVSLVDQLVARVLFQNQNKREIALWRAVPSKPGFGLSTDEQVVEFVQMLSAQVKMSPPQLISDWRQHLVA TDCSGFDWSVSDWLLEDDMEVRNRLTTDLNETTSKLRAAWLKCISNSVLCLSDGTLLAQRVPGVQKSGSYNTSSS NSRIRVMAAFHCGAEWAMAMGDDALESVSTDLGKYAAL 4.BW1 [FN600341] (Τμηματική αλληλουχία της RdRp) 1 CCTCATAATG AGCGTTTCCC TCGTGGACCA ACTGGTAGCC CGGGTTCTGT 51 TTCAAAACCA AAACAAGCGG GAAATTGCCT TATGGAGGGC CGTCCCCAGT 101 AAACCCGGTT TTGGCTTGTC CACGGACGAG CAAGTGCTGG ACTTTGTGAA 151 AGGTCTGGCC CGTCAAGTAG GCACTACGCC AACAGAGGTA GTTGCCAATT 201 GGAAAAATTA CTTGACGCCC ACGGATTGCT CCGGTTTTGA CTGGAGTGTT 251 GCGGACTGGA TGCTTCAAGA CGATATGATC GTCCGCAATA GACTTACCAT 301 CGACCTCAAC CCTGCAACAG AAAGATTAAG ATCTTGTTGG TTGAGATGCG 351 TCTCTAACTC AGTGTTATGC CTGAGTGATG GTACCCTTTT AGCCCAAACC 401 CATCCGGGCG TTCAGAAAAG TGGGAGCTAC AACACATCAA GCTCCAACTC 451 CCGGATTAGA GTTATGGCCG CCTTTCACAC AGGTGCTGCC TGGGCTATGG 501 CGATGGGCGA CGACGCCCTC GAGTCCAATC CCGCTGACCT AGCAGCGTAC 551 AAAAGACTA LIMSVSLVDQLVARVLFQNQNKREIALWRAVPSKPGFGLSTDEQVLDFVKGLARQVGTTPTEVVANWKNYLTPT DCSGFDWSVADWMLQDDMIVRNRLTIDLNPATERLRSCWLRCVSNSVLCLSDGTLLAQTHPGVQKSGSYNTSS SNSRIRVMAAFHTGAAWAMAMGDDALESNPADLAAYKRL 5.RL1 [FN600340] (Τμηματική αλληλουχία της RdRp) 1 TCTCATCATG AGTGTTTCCC TTTTAGACCA ATTGGTAGCC CGGGTCTTGT 51 TTCAGTCACA GAACAAGTTA GAAATAGCGC TTTGGAGAGC TGTACCCTCA 101 AAACCCGGTT TTGGACTTTC CACAGACAGT CAAATCGAAA ATTTTATGGA 151 CTGTCTGGCC AAGCAGGTTG GAGTGACACC AGATGAAGTA ATTGAAAATT 201 GGGATAACCA TCTGGTACCG ACCGACTGCT CAGGCTTCGA TTGGTCAGTT 251 TCGGACTGGC TTTTAGAAGA TGACATGGAA GTGAGAAATC GCCTCACCAT 301 CGACTGCTCC CCCTTATTAA GGAGGTTAAG AGCAGGATGG TTAAAATGCA 351 TCTCGAATTC CGTCTTGTGC CTTTCTGATG GCACACTGTT AGCCCAGATA 401 AGACCCGGGG TTCAAAAGAG TGGATCTTAT AATACAAGTT CATCCAACTC 451 TCGAATCCGG GTGATGGCAG CCTATCACAG TGGCGCCTCC TGGGCTATGG 501 CTATGGGCGA CGATGCCCTG GAAAGTAAAG ACACGGACCT ATCCGTGTAT 551 AAAGATTTA LIMSVSLLDQLVARVLFQSQNKLEIALWRAVPSKPGFGLSTDSQIENFMDCLAKQVGVTPDEVIENWDNHLVPTD CSGFDWSVSDWLLEDDMEVRNRLTIDCSPLLRRLRAGWLKCISNSVLCLSDGTLLAQIRPGVQKSGSYNTSSSNSR IRVMAAYHSGASWAMAMGDDALESKDTDLSVYKDL 107

121 Β. Σχηματική αναπαράσταση των μεθόδων που αναπτύχθηκαν στην παρούσα μελέτη Παράρτημα 108

Νικόλαος Σιαφάκας Λέκτορας Διαγνωστικής Ιολογίας Εργαστήριο Κλινικής Μικροβιολογίας ΠΓΝ «ΑΤΤΙΚΟΝ»

Νικόλαος Σιαφάκας Λέκτορας Διαγνωστικής Ιολογίας Εργαστήριο Κλινικής Μικροβιολογίας ΠΓΝ «ΑΤΤΙΚΟΝ» Νικόλαος Σιαφάκας Λέκτορας Διαγνωστικής Ιολογίας Εργαστήριο Κλινικής Μικροβιολογίας ΠΓΝ «ΑΤΤΙΚΟΝ» DNA RNA: ΑΝΤΙΓΡΑΦΗ, ΜΕΤΑΓΡΑΦΗ, ΜΕΤΑΦΡΑΣΗ DNA RNA: Βασικά Χαρακτηριστικά Ρόλος Κεντικό Δόγμα της Βιολογίας:

Διαβάστε περισσότερα

Ιοί ντόπιων ποικιλιών ψυχανθών: παράγοντες υποβάθμισης ή ανάδυσης γονιδίων ανθεκτικότητας;

Ιοί ντόπιων ποικιλιών ψυχανθών: παράγοντες υποβάθμισης ή ανάδυσης γονιδίων ανθεκτικότητας; Ιοί ντόπιων ποικιλιών ψυχανθών: παράγοντες υποβάθμισης ή ανάδυσης γονιδίων ανθεκτικότητας; Ελισάβετ Κ. Χατζηβασιλείου (echatz@aua.gr) Εργαστήριο Φυτοπαθολογίας, Γεωπονικό Πανεπιστήμιο Αθηνών Οι ιοί είναι

Διαβάστε περισσότερα

Γενική Μικροβιολογία. Ενότητα 12 η ΕΙΣΑΓΩΓΗ ΣΤΗΝ ΙΟΛΟΓΙΑ

Γενική Μικροβιολογία. Ενότητα 12 η ΕΙΣΑΓΩΓΗ ΣΤΗΝ ΙΟΛΟΓΙΑ Γενική Μικροβιολογία Ενότητα 12 η ΕΙΣΑΓΩΓΗ ΣΤΗΝ ΙΟΛΟΓΙΑ Όνομα καθηγητή: Δ. ΓΕΩΡΓΑΚΟΠΟΥΛΟΣ Όνομα καθηγητή: Γ. ΖΕΡΒΑΚΗΣ Όνομα καθηγητή: ΑΝ. ΤΑΜΠΑΚΑΚΗ Τμήμα: ΕΠΙΣΤΗΜΗΣ ΦΥΤΙΚΗΣ ΠΑΡΑΓΩΓΗΣ ΣΤΟΧΟΙ ΤΟΥ ΜΑΘΗΜΑΤΟΣ

Διαβάστε περισσότερα

Εργαλεία Μοριακής Γενετικής

Εργαλεία Μοριακής Γενετικής Εργαλεία Μοριακής Γενετικής Αρχές Μοριακής κλωνοποίησης Τα περιοριστικά ένζυμα: αναγνωρίζουν αλληλουχίες (θέσεις περιορισμού). 2 τύποι ενζύμων: -Τύπος I = Κόβουν κοντά στη θέση περιορισμού -σπάνια χρησιμοποιούνται.

Διαβάστε περισσότερα

ΓΕΝΕΤΙΚΑ ΤΡΟΠΟΠΟΙΗΜΕΝΑ ΦΥΤΑ (ΑΝΤΟΧΗ ΣΕ ΕΝΤΟΜΑ-ΙΟΥΣ)

ΓΕΝΕΤΙΚΑ ΤΡΟΠΟΠΟΙΗΜΕΝΑ ΦΥΤΑ (ΑΝΤΟΧΗ ΣΕ ΕΝΤΟΜΑ-ΙΟΥΣ) ΓΕΝΕΤΙΚΑ ΤΡΟΠΟΠΟΙΗΜΕΝΑ ΦΥΤΑ (ΑΝΤΟΧΗ ΣΕ ΕΝΤΟΜΑ-ΙΟΥΣ) 1 ΔΗΜΙΟΥΡΓΙΑ ΦΥΤΩΝ ΜΕ ΑΝΤΟΧΗ ΣΕ ΕΝΤΟΜΑ 19 Παράγοντες που συμβάλλουν σε αύξηση των εντόμων 1. Μονοκαλλιέργειες 2. Βελτίωση με κριτήριο αποκλειστικά την

Διαβάστε περισσότερα

Επισκεφτήκαμε το ινστιτούτο νευρολογίας και γενετικής όπου μας μίλησε ο κύριος Βάσος Νεοκλέους και η κ. Αλέξια Φαίδωνος για τη μηχανή Polymerase

Επισκεφτήκαμε το ινστιτούτο νευρολογίας και γενετικής όπου μας μίλησε ο κύριος Βάσος Νεοκλέους και η κ. Αλέξια Φαίδωνος για τη μηχανή Polymerase Επισκεφτήκαμε το ινστιτούτο νευρολογίας και γενετικής όπου μας μίλησε ο κύριος Βάσος Νεοκλέους και η κ. Αλέξια Φαίδωνος για τη μηχανή Polymerase Chain Reaction (pcr)- Αλυσιδωτή αντίδραση πολυμεράσης.η

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ ΚΕΦΑΛΑΙΟ 1(ΥΓΕΙΑ-ΑΝΘΡΩΠΟΣ)

ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ ΚΕΦΑΛΑΙΟ 1(ΥΓΕΙΑ-ΑΝΘΡΩΠΟΣ) ΟΝΟΜΑΤΕΠΩΝΥΜΟ: ΤΜΗΜΑ: ΒΙΟΛΟΓΙΑ ΓΕΝΙΚΗΣ ΠΑΙΔΕΙΑΣ ΚΕΦΑΛΑΙΟ 1(ΥΓΕΙΑ-ΑΝΘΡΩΠΟΣ) Να βάλετε σε κύκλο το γράμμα που αντιστοιχεί στη σωστή απάντηση ή στη φράση που συμπληρώνει σωστά την πρόταση: 1. Οι ιοί αποτελούνται

Διαβάστε περισσότερα

ΘΕΜΑ Α Α1. γ Α2. γ Α3. α Α4. β Α5. β ΘΕΜΑ B B1. B2.

ΘΕΜΑ Α Α1. γ Α2. γ Α3. α Α4. β Α5. β ΘΕΜΑ B B1. B2. ΘΕΜΑ Α Α1. γ (το πριμόσωμα) Α2. γ (οι υποκινητές και οι μεταγραφικοί παράγοντες κάθε γονιδίου) Α3. α (μεταφέρει ένα συγκεκριμένο αμινοξύ στο ριβόσωμα) Α4. β (αποδιάταξη των δύο συμπληρωματικών αλυσίδων)

Διαβάστε περισσότερα

ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ

ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΘΕΜΑ Α Να γράψετε στο τετράδιό σας τον αριθμό καθεμιάς από τις παρακάτω ημιτελείς προτάσεις Α1 έως Α5 και δίπλα το γράμμα που αντιστοιχεί στη λέξη

Διαβάστε περισσότερα

ΘΕΜΑ 1 Ο ΜΑΘΗΜΑ / ΤΑΞΗ : ΑΠΑΝΤΗΣΕΙΣ ΒΙΟΛΟΓΙΑΣ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΣΕΙΡΑ: ΘΕΡΙΝΑ ΗΜΕΡΟΜΗΝΙΑ: 01/12/2013

ΘΕΜΑ 1 Ο ΜΑΘΗΜΑ / ΤΑΞΗ : ΑΠΑΝΤΗΣΕΙΣ ΒΙΟΛΟΓΙΑΣ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΣΕΙΡΑ: ΘΕΡΙΝΑ ΗΜΕΡΟΜΗΝΙΑ: 01/12/2013 ΜΑΘΗΜΑ / ΤΑΞΗ : ΑΠΑΝΤΗΣΕΙΣ ΒΙΟΛΟΓΙΑΣ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΣΕΙΡΑ: ΘΕΡΙΝΑ ΗΜΕΡΟΜΗΝΙΑ: 01/12/2013 ΘΕΜΑ 1 Ο Να επιλέξετε την φράση που συμπληρώνει ορθά κάθε μία από τις ακόλουθες προτάσεις: 1. Τα

Διαβάστε περισσότερα

ΑΙΜΟΠΑΘΟΛΟΓΟΑΝΑΤΟΜΙΑ

ΑΙΜΟΠΑΘΟΛΟΓΟΑΝΑΤΟΜΙΑ ΑΙΜΟΠΑΘΟΛΟΓΟΑΝΑΤΟΜΙΑ Η συµβολή της µοριακής ανάλυσης Eλισάβετ Οικονοµάκη Βιολόγος Αιµοπαθολογοανατοµικό Εργαστήριο ΠΓΝΑ > ΜΟΡΙΑΚΕΣ ΜΕΘΟ ΟΙ (Μη µορφολογικές) Αλυσιδωτή Αντίδραση Πολυµεράσης

Διαβάστε περισσότερα

γραπτή εξέταση στo μάθημα ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ

γραπτή εξέταση στo μάθημα ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ γραπτή εξέταση στo μάθημα ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ' ΛΥΚΕΙΟΥ Τάξη: Γ Λυκείου Τμήμα: Βαθμός: Ονοματεπώνυμο: Καθηγητές: ΠΑΣΣΙΑ Α. Θ Ε Μ Α A 1. Να επιλέξετε τη σωστή απάντηση: Α1. Κάθε μεταφορικό RNA

Διαβάστε περισσότερα

ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ - ΕΣΠΕΡΙΝΩΝ

ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ - ΕΣΠΕΡΙΝΩΝ ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ - ΕΣΠΕΡΙΝΩΝ ΠΑΝΕΛΛΗΝΙΕΣ ΕΞΕΤΑΣΕΙΣ ΤΑΞΗΣ ΕΣΠΕΡΙΝΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΚΑΙ ΕΠΑΛ (ΟΜΑ Α Β ) ΤΕΤΑΡΤΗ 18 ΜΑΪΟΥ 2011 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ: ΒΙΟΛΟΓΙΑ ΣΥΝΟΛΟ ΣΕΛΙ ΩΝ: ΠΕΝΤΕ (5) ΘΕΜΑ

Διαβάστε περισσότερα

Πανελλήνιες Εξετάσεις Ημερήσιων Γενικών Λυκείων. Εξεταζόμενο Μάθημα: Βιολογία Θετικής Κατεύθυνσης, Ημ/νία: 04 Ιουνίου 2014. Απαντήσεις Θεμάτων

Πανελλήνιες Εξετάσεις Ημερήσιων Γενικών Λυκείων. Εξεταζόμενο Μάθημα: Βιολογία Θετικής Κατεύθυνσης, Ημ/νία: 04 Ιουνίου 2014. Απαντήσεις Θεμάτων Πανελλήνιες Εξετάσεις Ημερήσιων Γενικών Λυκείων Εξεταζόμενο Μάθημα: Βιολογία Θετικής Κατεύθυνσης, Ημ/νία: 04 Ιουνίου 2014 Απαντήσεις Θεμάτων ΘΕΜΑ Α A1. Τα πλασμίδια είναι: δ. κυκλικά δίκλωνα μόρια DNA

Διαβάστε περισσότερα

ΠΡΟΤΕΙΝΟΜΕΝΕΣ ΑΠΑΝΤΗΣΕΙΣ ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ 2014

ΠΡΟΤΕΙΝΟΜΕΝΕΣ ΑΠΑΝΤΗΣΕΙΣ ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ 2014 ΦΡΟΝΤΙΣΤΗΡΙΑ ΜΕΣΗΣ ΕΚΠΑΙΔΕΥΣΗΣ : - ΠΡΟΤΕΙΝΟΜΕΝΕΣ ΑΠΑΝΤΗΣΕΙΣ ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ 2014 ΘΕΜΑ A Α1. δ Α2. γ Α3. β Α4. γ Α5. β ΘΕΜΑ B Β1. 4 2 1 6 3 5 Β2. α. DNA πολυμεράση β. Πριμόσωμα γ. DNA δεσμάση δ. DNA

Διαβάστε περισσότερα

ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ Ο.Ε.Φ.Ε. 2004 ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ Γ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ

ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ Ο.Ε.Φ.Ε. 2004 ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ Γ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ Ο.Ε.Φ.Ε. 2004 ΘΕΜΑ 1 Ο Α. Να επιλέξετε την ορθή πρόταση: ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ Γ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 1. Το κωδικόνιο του mrna που κωδικοποιεί το αµινοξύ µεθειονίνη είναι α. 5 GUA

Διαβάστε περισσότερα

Εργαστηριακή Διάγνωση της HIV λοίμωξης. Δρ. Μαρία Κοτσιανοπούλου Βιολόγος Υπεύθυνη Εργαστηριού Κέντρου Αναφοράς AIDS, ΕΣΔΥ

Εργαστηριακή Διάγνωση της HIV λοίμωξης. Δρ. Μαρία Κοτσιανοπούλου Βιολόγος Υπεύθυνη Εργαστηριού Κέντρου Αναφοράς AIDS, ΕΣΔΥ Εργαστηριακή Διάγνωση της HIV λοίμωξης Δρ. Μαρία Κοτσιανοπούλου Βιολόγος Υπεύθυνη Εργαστηριού Κέντρου Αναφοράς AIDS, ΕΣΔΥ Διάγνωση της HIV λοίμωξης Από το 1985 και μέχρι σήμερα η διαγνωστική διαδικασία

Διαβάστε περισσότερα

Πανελλήνιες Εξετάσεις Ημερήσιων Γενικών Λυκείων. Εξεταζόμενο Μάθημα: Βιολογία Θετικής Κατεύθυνσης, Ημ/νία: 04 Ιουνίου 2014. Απαντήσεις Θεμάτων

Πανελλήνιες Εξετάσεις Ημερήσιων Γενικών Λυκείων. Εξεταζόμενο Μάθημα: Βιολογία Θετικής Κατεύθυνσης, Ημ/νία: 04 Ιουνίου 2014. Απαντήσεις Θεμάτων Πανελλήνιες Εξετάσεις Ημερήσιων Γενικών Λυκείων Εξεταζόμενο Μάθημα: Βιολογία Θετικής Κατεύθυνσης, Ημ/νία: 04 Ιουνίου 2014 Απαντήσεις Θεμάτων ΘΕΜΑ Α A1. Τα πλασμίδια είναι: δ. κυκλικά δίκλωνα μόρια DNA

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΘΕΜΑ 1ο Να γράψετε στο τετράδιο σας τον αριθμό καθεμιάς από τις παρακάτω ημιτελείς προτάσεις 1 έως 5 και δίπλα το γράμμα που αντιστοιχεί στη φράση που συμπληρώνει

Διαβάστε περισσότερα

ΑΡΧΗ 1ΗΣ ΣΕΛΙΔΑΣ Γ ΗΜΕΡΗΣΙΩΝ

ΑΡΧΗ 1ΗΣ ΣΕΛΙΔΑΣ Γ ΗΜΕΡΗΣΙΩΝ ΑΡΧΗ 1ΗΣ ΣΕΛΙΔΑΣ Γ ΗΜΕΡΗΣΙΩΝ ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΠΕΜΠΤΗ 11 ΙΟΥΝΙΟΥ 2015 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΣΥΝΟΛΟ ΣΕΛΙΔΩΝ: ΠΕΝΤΕ (5) ΘΕΜΑ

Διαβάστε περισσότερα

Γενική Μικροβιολογία. Ενότητα 11 η ΕΙΣΑΓΩΓΗ ΣΤΗΝ ΙΟΛΟΓΙΑ

Γενική Μικροβιολογία. Ενότητα 11 η ΕΙΣΑΓΩΓΗ ΣΤΗΝ ΙΟΛΟΓΙΑ Γενική Μικροβιολογία Ενότητα 11 η ΕΙΣΑΓΩΓΗ ΣΤΗΝ ΙΟΛΟΓΙΑ Όνομα καθηγητή: Δ. ΓΕΩΡΓΑΚΟΠΟΥΛΟΣ Όνομα καθηγητή: Γ. ΖΕΡΒΑΚΗΣ Όνομα καθηγητή: ΑΝ. ΤΑΜΠΑΚΑΚΗ Τμήμα: ΕΠΙΣΤΗΜΗΣ ΦΥΤΙΚΗΣ ΠΑΡΑΓΩΓΗΣ ΣΤΟΧΟΙ ΤΟΥ ΜΑΘΗΜΑΤΟΣ

Διαβάστε περισσότερα

ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΕΝΙΑΙΟΥ ΛΥΚΕΙΟΥ ΠΕΜΠΤΗ 1 ΙΟΥΛΙΟΥ 2004 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ

ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΕΝΙΑΙΟΥ ΛΥΚΕΙΟΥ ΠΕΜΠΤΗ 1 ΙΟΥΛΙΟΥ 2004 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 1 ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΕΝΙΑΙΟΥ ΛΥΚΕΙΟΥ ΠΕΜΠΤΗ 1 ΙΟΥΛΙΟΥ 2004 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ 1ο 1. β 2. γ 3. α 4. γ 5. δ ΘΕΜΑ 2ο 1. Σχολικό

Διαβάστε περισσότερα

ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΤΕΤΑΡΤΗ 4 ΙΟΥΛΙΟΥ 2007 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ: ΒΙΟΛΟΓΙΑ ΑΠΑΝΤΗΣΕΙΣ

ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΤΕΤΑΡΤΗ 4 ΙΟΥΛΙΟΥ 2007 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ: ΒΙΟΛΟΓΙΑ ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ 1ο 1. α 2. γ 3. δ 4. γ 5. β 1 ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΤΕΤΑΡΤΗ 4 ΙΟΥΛΙΟΥ 2007 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ: ΒΙΟΛΟΓΙΑ ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ 2ο 1. Σχολικό βιβλίο,

Διαβάστε περισσότερα

Θεωρία - Εφαρμογές ΓΕΝΕΤΙΚΗ ΒΕΛΤΙΩΣΗ ΦΥΤΩΝ - ΜΟΡΙΑΚΟΙ ΔΕΙΚΤΕΣ 1

Θεωρία - Εφαρμογές ΓΕΝΕΤΙΚΗ ΒΕΛΤΙΩΣΗ ΦΥΤΩΝ - ΜΟΡΙΑΚΟΙ ΔΕΙΚΤΕΣ 1 ΜΟΡΙΑΚΟΙ ΔΕΙΚΤΕΣ Θεωρία - Εφαρμογές ΓΕΝΕΤΙΚΗ ΒΕΛΤΙΩΣΗ ΦΥΤΩΝ - ΜΟΡΙΑΚΟΙ ΔΕΙΚΤΕΣ 1 ΕΙΣΑΓΩΓΗ ΣΤΟΥΣ ΜΟΡΙΑΚΟΥΣ Έπιλογή με βάση: ΔΕΙΚΤΕΣ Φαινοτυπικοί δείκτες Γενετικοί δείκτες Μοριακοί δείκτες (Πρωτεϊνικοί &

Διαβάστε περισσότερα

ΕΞΕΛΙΞΗ ΣΕΙΡΑ ΜΕΤΑΒΟΛΩΝ ΠΡΟΣ ΟΛΕΣ ΤΙΣ ΣΥΝΙΣΤΩΣΕΣ ΠΟΥ ΠΑΙΡΝΟΥΝ ΜΕΡΟΣ ΣΕ ΕΝΑΝ ΠΛΗΘΥΣΜΟ ΜΕ ΤΗΝ ΠΑΡΟΔΟ ΤΟΥ ΧΡΟΝΟΥ

ΕΞΕΛΙΞΗ ΣΕΙΡΑ ΜΕΤΑΒΟΛΩΝ ΠΡΟΣ ΟΛΕΣ ΤΙΣ ΣΥΝΙΣΤΩΣΕΣ ΠΟΥ ΠΑΙΡΝΟΥΝ ΜΕΡΟΣ ΣΕ ΕΝΑΝ ΠΛΗΘΥΣΜΟ ΜΕ ΤΗΝ ΠΑΡΟΔΟ ΤΟΥ ΧΡΟΝΟΥ ΕΞΕΛΙΞΗ ΣΕΙΡΑ ΜΕΤΑΒΟΛΩΝ ΠΡΟΣ ΟΛΕΣ ΤΙΣ ΣΥΝΙΣΤΩΣΕΣ ΠΟΥ ΠΑΙΡΝΟΥΝ ΜΕΡΟΣ ΣΕ ΕΝΑΝ ΠΛΗΘΥΣΜΟ ΜΕ ΤΗΝ ΠΑΡΟΔΟ ΤΟΥ ΧΡΟΝΟΥ ΖΩΟΛΟΓΙΑ Δ. ΜΑΤΘΟΠΟΥΛΟΣ 1 ΠΑΡΑΓΟΝΤΕΣ ΠΟΥ ΕΠΗΡΕΑΖΟΥΝ ΤΗΝ ΕΞΕΛΙΞΗ ΚΛΗΡΟΝΟΜΙΚΟΤΗΤΑ ΔΙΑΔΙΚΑΣΙΑ

Διαβάστε περισσότερα

ΠΡΟΤΕΙΝΟΜΕΝΑ ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ

ΠΡΟΤΕΙΝΟΜΕΝΑ ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΠΡΟΤΕΙΝΟΜΕΝΑ ΘΕΜΑΤΑ ΒΙΟΛΟΓΙΑΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΘΕΜΑ 1 Ο Α. Να βάλετε σε κύκλο το γράμμα που αντιστοιχεί στη σωστή απάντηση ή στη φράση που συμπληρώνει σωστά την πρόταση. 1. H β- θαλασσαιμία είναι

Διαβάστε περισσότερα

ΓΕΝΕΤΙΚΗ ΒΕΛΤΙΩΣΗ. 9η ΙΑΛΕΞΗ ΒΕΛΤΙΩΣΗ ΓΙΑ ΑΝΘΕΚΤΙΚΟΤΗΤΑ ΣΤΙΣ ΑΣΘΕΝΕΙΕΣ

ΓΕΝΕΤΙΚΗ ΒΕΛΤΙΩΣΗ. 9η ΙΑΛΕΞΗ ΒΕΛΤΙΩΣΗ ΓΙΑ ΑΝΘΕΚΤΙΚΟΤΗΤΑ ΣΤΙΣ ΑΣΘΕΝΕΙΕΣ ΓΕΝΕΤΙΚΗ ΒΕΛΤΙΩΣΗ ΦΥΤΩΝ 9η ΙΑΛΕΞΗ ΒΕΛΤΙΩΣΗ ΓΙΑ ΑΝΘΕΚΤΙΚΟΤΗΤΑ ΣΤΙΣ ΑΣΘΕΝΕΙΕΣ Ανθεκτικότητα Γενικά Η εξέλιξη των καλλιεργούµενων φυτών είναι το αποτέλεσµα φυσικής και τεχνητής επιλογής Η επιλογή για αυξηµένες

Διαβάστε περισσότερα

Πανελλαδικές εξετάσεις Γ Τάξης Ημερήσιου Γενικού Λυκείου Βιολογία Θετικής Κατεύθυνσης Τετάρτη 4 Ιουνίου 2014

Πανελλαδικές εξετάσεις Γ Τάξης Ημερήσιου Γενικού Λυκείου Βιολογία Θετικής Κατεύθυνσης Τετάρτη 4 Ιουνίου 2014 Πανελλαδικές εξετάσεις Γ Τάξης Ημερήσιου Γενικού Λυκείου Βιολογία Θετικής Κατεύθυνσης Τετάρτη 4 Ιουνίου 2014 ΘΕΜΑ Α Α1.δ Α2.γ Α3.β Α4.γ Α5.β ΘΕΜΑ Β Β1. 4,2,1,6,3,5 Β2. α. DNA πολυμεράση β. πριμόσωμα γ.

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ Γ ΛΥΚΕΙΟΥ ΚΑΤΕΥΘΥΝΣΗΣ 2007 ΕΚΦΩΝΗΣΕΙΣ

ΒΙΟΛΟΓΙΑ Γ ΛΥΚΕΙΟΥ ΚΑΤΕΥΘΥΝΣΗΣ 2007 ΕΚΦΩΝΗΣΕΙΣ ΘΕΜΑ 1ο ΒΙΟΛΟΓΙΑ Γ ΛΥΚΕΙΟΥ ΚΑΤΕΥΘΥΝΣΗΣ 2007 ΕΚΦΩΝΗΣΕΙΣ Να γράψετε στο τετράδιό σας τον αριθµό καθεµιάς από τις παρακάτω ηµιτελείς προτάσεις 1 έως 5 και δίπλα το γράµµα που αντιστοιχεί στη λέξη ή τη φράση,

Διαβάστε περισσότερα

Θέματα Πανελλαδικών 2000-2013

Θέματα Πανελλαδικών 2000-2013 Θέματα Πανελλαδικών 2000-2013 ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΗΜΕΡΗΣΙΩΝ ΛΥΚΕΙΩΝ ΕΣΠΕΡΙΝΩΝ ΛΥΚΕΙΩΝ ΕΠΑΝΑΛΗΠΤΙΚΕΣ Κεφάλαιο 8 ΚΕΦΑΛΑΙΟ 8 ΘΕΜΑ 1 ο Γράψτε τον αριθμό καθεμιάς από τις παρακάτω προτάσεις και δίπλα το γράμμα

Διαβάστε περισσότερα

γ ρ α π τ ή ε ξ έ τ α σ η σ τ ο μ ά θ η μ α

γ ρ α π τ ή ε ξ έ τ α σ η σ τ ο μ ά θ η μ α γ ρ α π τ ή ε ξ έ τ α σ η σ τ ο μ ά θ η μ α ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ' ΛΥΚΕΙΟΥ Τάξη: Γ Λυκείου Τμήμα: Βαθμός: Ονοματεπώνυμο: Καθηγητές: Θ Ε Μ Α Να επιλέξετε τη σωστή απάντηση: Α1. Στην τεχνολογία

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ Α Α1 δ Α2 γ Α3 β Α4 γ Α5 β ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ Β Β1. 4 2 1 6 3 5 Β2. α. DNA πολυμεράση β. πριμόσωμα γ. DNA δεσμάση δ. DNA ελκάση ε. RNA πολυμεράση Β3. Σχολικό βιβλίο, Σελ.: 98: «Η διάγνωση των

Διαβάστε περισσότερα

Α2. Το αντικωδικόνιο είναι τριπλέτα νουκλεοτιδίων του α. mrna β. snrna γ. trna δ. rrna Μονάδες 5

Α2. Το αντικωδικόνιο είναι τριπλέτα νουκλεοτιδίων του α. mrna β. snrna γ. trna δ. rrna Μονάδες 5 ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ Α Να γράψετε στο τετράδιό σας τον αριθμό καθεμιάς από τις παρακάτω ημιτελείς προτάσεις Α1 έως Α5 και δίπλα στο γράμμα που αντιστοιχεί στη λέξη ή στη φράση, η οποία συμπληρώνει

Διαβάστε περισσότερα

Περιεχόμενα. 1 Η ιστορία της εξελικτικής βιολογίας: Εξέλιξη και Γενετική 2 Η Προέλευση της Μοριακής Βιολογίας 3 Αποδείξεις για την εξέλιξη 89

Περιεχόμενα. 1 Η ιστορία της εξελικτικής βιολογίας: Εξέλιξη και Γενετική 2 Η Προέλευση της Μοριακής Βιολογίας 3 Αποδείξεις για την εξέλιξη 89 Περιεχόμενα Οι Συγγραφείς Πρόλογος της Ελληνικής Έκδοσης Πρόλογος της Αμερικανικής Έκδοσης Σκοπός και Αντικείμενο του Βιβλίου ΜΕΡΟΣ Ι ΜΙΑ ΕΠΙΣΚΟΠΗΣΗ ΤΗΣ ΕΞΕΛΙΚΤΙΚΗΣ ΒΙΟΛΟΓΙΑΣ 1 Η ιστορία της εξελικτικής

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ 1ο Να γράψετε στο τετράδιό σας τον αριθμό καθεμιάς από τις παρακάτω ημιτελείς προτάσεις 1 έως 5 και δίπλα το γράμμα που αντιστοιχεί στη λέξη ή τη φράση, η οποία συμπληρώνει

Διαβάστε περισσότερα

ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΠΕΜΠΤΗ 11 ΙΟΥΝΙΟΥ 2015 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ

ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΠΕΜΠΤΗ 11 ΙΟΥΝΙΟΥ 2015 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 1 ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΠΕΜΠΤΗ 11 ΙΟΥΝΙΟΥ 2015 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ Α Α1. β Α2. γ Α3. α Α4. γ Α5. δ ΘΕΜΑ Β Β1.

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ Α Α1 γ Α2 β Α3 α Α4 δ Α5 α ΘΕΜΑ Β Β1. Σχολικό βιβλίο, Σελ.: 123-124: «Η διαδικασία που ακολουθείται με ενδοφλέβια ένεση στον οργανισμό». Β2. Σχολικό βιβλίο, Σελ.: 133: «Διαγονιδιακά

Διαβάστε περισσότερα

ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ ΤΗΣ Γ' ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ

ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ ΤΗΣ Γ' ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ ΤΗΣ Γ' ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΟΙ ΛΥΣΕΙΣ ΤΩΝ ΘΕΜΑΤΩΝ ΑΠΟ ΤΟΝ ΚΑΘΗΓΗΤΗ κύριο ΤΡΙΓΚΑ ΓΕΩΡΓΙΟ του ΦΡΟΝΤΙΣΤΗΡΙΟΥ του ΦΡΟΝΤΙΣΤΗΡΙΟΥ www.orion.edu.gr ΘΕΜΑ A A1. δ A2. γ A3.

Διαβάστε περισσότερα

ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΚΑΙ ΕΠΑΛ (ΟΜΑΔΑ Β) ΤΕΤΑΡΤΗ 4 ΙΟΥΝΙΟΥ 2014 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ

ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΚΑΙ ΕΠΑΛ (ΟΜΑΔΑ Β) ΤΕΤΑΡΤΗ 4 ΙΟΥΝΙΟΥ 2014 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 1 ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΚΑΙ ΕΠΑΛ (ΟΜΑΔΑ Β) ΤΕΤΑΡΤΗ 4 ΙΟΥΝΙΟΥ 2014 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ Α Α1. δ Α2. γ Α3. β Α4. γ Α5. β ΘΕΜΑ

Διαβάστε περισσότερα

ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Δ ΤΑΞΗΣ ΕΣΠΕΡΙΝΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΔΕΥΤΕΡΑ 23 ΙΟΥΝΙΟΥ 2014 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΑΠΑΝΤΗΣΕΙΣ

ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Δ ΤΑΞΗΣ ΕΣΠΕΡΙΝΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΔΕΥΤΕΡΑ 23 ΙΟΥΝΙΟΥ 2014 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΑΠΑΝΤΗΣΕΙΣ 1 ΕΠΑΝΑΛΗΠΤΙΚΕΣ ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Δ ΤΑΞΗΣ ΕΣΠΕΡΙΝΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΔΕΥΤΕΡΑ 23 ΙΟΥΝΙΟΥ 2014 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ Α Α1. γ Α2. β Α3. γ Α4. δ Α5. α ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ Β Β1. Σχολικό

Διαβάστε περισσότερα

ΟΜΟΣΠΟΝ ΙΑ ΕΚΠΑΙ ΕΥΤΙΚΩΝ ΦΡΟΝΤΙΣΤΩΝ ΕΛΛΑ ΟΣ (Ο.Ε.Φ.Ε.) ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ 2014

ΟΜΟΣΠΟΝ ΙΑ ΕΚΠΑΙ ΕΥΤΙΚΩΝ ΦΡΟΝΤΙΣΤΩΝ ΕΛΛΑ ΟΣ (Ο.Ε.Φ.Ε.) ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ 2014 ΤΑΞΗ: ΚΑΤΕΥΘΥΝΣΗ: ΜΑΘΗΜΑ: Γ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗ ΒΙΟΛΟΓΙΑ Ηµεροµηνία: Παρασκευή 25 Απριλίου 2014 ιάρκεια Εξέτασης: 3 ώρες ΕΚΦΩΝΗΣΕΙΣ ΘΕΜΑ Α Να γράψετε στο τετράδιό σας τον αριθµό καθεµιάς από τις παρακάτω

Διαβάστε περισσότερα

Η ΤΕΧΝΟΛΟΓΙΑ ΤΟΥ ΑΝΑΣΥΝΔΥΑΖΟΜΕΝΟΥ ΓΕΝΕΤΙΚΗ ΜΗΧΑΝΙΚΗ

Η ΤΕΧΝΟΛΟΓΙΑ ΤΟΥ ΑΝΑΣΥΝΔΥΑΖΟΜΕΝΟΥ ΓΕΝΕΤΙΚΗ ΜΗΧΑΝΙΚΗ Η ΤΕΧΝΟΛΟΓΙΑ ΤΟΥ ΑΝΑΣΥΝΔΥΑΖΟΜΕΝΟΥ DNA ΓΕΝΕΤΙΚΗ ΜΗΧΑΝΙΚΗ Τεχνολογία ανασυνδυαζόμενου DNA ή Γενετική Μηχανική Κατασκευή τεχνητών μορίων DNA (ανασυνδυασμένο DNA) Τροποποίηση γονιδιωμάτων Μεταφορά γονιδίου/ων

Διαβάστε περισσότερα

Ο ρόλος και η σημασία των μοριακών τεχνικών στον έλεγχο των. μικροβιολογικών παραμέτρων σε περιβαλλοντικά δείγματα για την προστασία

Ο ρόλος και η σημασία των μοριακών τεχνικών στον έλεγχο των. μικροβιολογικών παραμέτρων σε περιβαλλοντικά δείγματα για την προστασία Ο ρόλος και η σημασία των μοριακών τεχνικών στον έλεγχο των μικροβιολογικών παραμέτρων σε περιβαλλοντικά δείγματα για την προστασία της Δημόσιας Υγείας Α. Βανταράκης Εργαστήριο Υγιεινής, Ιατρική Σχολή,

Διαβάστε περισσότερα

TreeTOPS. ένα εισαγωγικό παιχνίδι για τα φυλογενετικά δέντρα. Teacher s Guide. ELLS European Learning Laboratory for the Life Sciences

TreeTOPS. ένα εισαγωγικό παιχνίδι για τα φυλογενετικά δέντρα. Teacher s Guide. ELLS European Learning Laboratory for the Life Sciences TreeTOPS ένα εισαγωγικό παιχνίδι για τα φυλογενετικά δέντρα Teacher s Guide ELLS European Learning Laboratory for the Life Sciences 1 Γενικός σκοπός Το συγκεκριμένο παιχνίδι έχει ως στόχο να εισάγει τους

Διαβάστε περισσότερα

Το κεντρικό δόγμα (The central dogma)

Το κεντρικό δόγμα (The central dogma) Οι βασικές μοριακές γενετικές διαδικασίες Αντιγραφή Μεταγραφή Μετάφραση ΠΡΩΤΕΪΝΗ Το κεντρικό δόγμα (The central dogma) Σύσταση νουκλεοτιδίων του DNA και του RNA Α 5 -άκρο Θυμίνη (Θ) Β 5 άκρο Αδενίνη (Α)

Διαβάστε περισσότερα

Ενδεικτικές απαντήσεις βιολογίας κατεύθυνσης 2014

Ενδεικτικές απαντήσεις βιολογίας κατεύθυνσης 2014 Θέμα Α Α1. δ Α2. γ Α3. β Α4. γ Α5. β Θέμα Β ΑΓ.ΚΩΝΣΤΑΝΤΙΝΟΥ 11 -- ΠΕΙΡΑΙΑΣ -- 18532 -- ΤΗΛ. 210-4224752, 4223687 Ενδεικτικές απαντήσεις βιολογίας κατεύθυνσης 2014 Β1. 4 2 1 6 3 5 Β2. α. DNA πολυμεράση

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ 16-2-2014 ΘΕΜΑ 1 ο Α. Να βάλετε σε κύκλο το γράμμα που αντιστοιχεί στη σωστή απάντηση. (Μονάδες 25)

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ 16-2-2014 ΘΕΜΑ 1 ο Α. Να βάλετε σε κύκλο το γράμμα που αντιστοιχεί στη σωστή απάντηση. (Μονάδες 25) ΤΣΙΜΙΣΚΗ &ΚΑΡΟΛΟΥ ΝΤΗΛ ΓΩΝΙΑ THΛ: 270727 222594 ΑΡΤΑΚΗΣ 12 - Κ. ΤΟΥΜΠΑ THΛ: 919113 949422 ΕΠΩΝΥΜΟ:... ΟΝΟΜΑ:... ΤΜΗΜΑ:... ΗΜΕΡΟΜΗΝΙΑ:... ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ 16-2-2014 ΘΕΜΑ 1 ο Α. Να βάλετε σε

Διαβάστε περισσότερα

ΑΠΑΝΤΗΣΕΙΣ ΒΙΟΛΟΓΙΑ Θετική Κατεύθυνση

ΑΠΑΝΤΗΣΕΙΣ ΒΙΟΛΟΓΙΑ Θετική Κατεύθυνση ΑΠΑΝΤΗΣΕΙΣ ΒΙΟΛΟΓΙΑ Θετική Κατεύθυνση ΘΕΜΑ Α Α1. α Α2. γ Α3. δ Α4. β Α5. γ ΘΕΜΑ Β Β1. Σελίδα 120 σχολικού βιβλίου : «Τα κύτταρα των οργάνων να είναι επιτυχείς.» Β2. Σελίδα 136 σχολικού βιβλίου : «Το 1997

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΘΕΜΑ 1ο Να γράψετε στο τετράδιό σας τον αριθμό καθεμιάς από τις παρακάτω ημιτελείς προτάσεις 1 έως 5 και δίπλα το γράμμα που αντιστοιχεί στη λέξη ή τη φράση, η οποία

Διαβάστε περισσότερα

ΘΕΜΑ 1 Ο Α. Να επιλέξετε τη φράση που συμπληρώνει ορθά κάθε μία από τις ακόλουθες προτάσεις: 1. Ως φορείς κλωνοποίησης χρησιμοποιούνται:

ΘΕΜΑ 1 Ο Α. Να επιλέξετε τη φράση που συμπληρώνει ορθά κάθε μία από τις ακόλουθες προτάσεις: 1. Ως φορείς κλωνοποίησης χρησιμοποιούνται: ΜΑΘΗΜΑ / ΤΑΞΗ : ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ / Γ ΛΥΚΕΙΟΥ ΧΕΙΜΕΡΙΝΑ ΣΕΙΡΑ: ΗΜΕΡΟΜΗΝΙΑ: 04/03/12 ΘΕΜΑ 1 Ο Α. Να επιλέξετε τη φράση που συμπληρώνει ορθά κάθε μία από τις ακόλουθες προτάσεις: 1. Ως φορείς κλωνοποίησης

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ

ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΙΑΓΩΝΙΣΜΑ Θέµα 1 ο 1. Τα άτοµα που είναι ετερόζυγα για τη β-θαλασσαιµία: α. Εµφανίζουν ήπια αναιµία β. Έχουν ευαισθησία στην ελονοσία γ. Συνθέτουν µεγάλη ποσότητα HbF δ.

Διαβάστε περισσότερα

ΠΑΝΕΛΛΗΝΙΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΚΑΙ ΕΠΑΛ (ΟΜΑΔΑ Β ) ΤΕΤΑΡΤΗ 30 ΜΑΪΟΥ 2012 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ

ΠΑΝΕΛΛΗΝΙΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΚΑΙ ΕΠΑΛ (ΟΜΑΔΑ Β ) ΤΕΤΑΡΤΗ 30 ΜΑΪΟΥ 2012 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΠΑΝΕΛΛΗΝΙΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΚΑΙ ΕΠΑΛ (ΟΜΑΔΑ Β ) ΤΕΤΑΡΤΗ 30 ΜΑΪΟΥ 2012 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ Α Να γράψετε στο τετράδιό σας τον αριθμό καθεμιάς

Διαβάστε περισσότερα

ΠΑΝΕΠΙΣΤΗΜΙΟ ΚΥΠΡΟΥ ΕΠΛ 450 ΥΠΟΛΟΓΙΣΤΙΚΗ ΒΙΟΛΟΓΙΑ. Παύλος Αντωνίου

ΠΑΝΕΠΙΣΤΗΜΙΟ ΚΥΠΡΟΥ ΕΠΛ 450 ΥΠΟΛΟΓΙΣΤΙΚΗ ΒΙΟΛΟΓΙΑ. Παύλος Αντωνίου ΠΑΝΕΠΙΣΤΗΜΙΟ ΚΥΠΡΟΥ ΕΠΛ 450 ΥΠΟΛΟΓΙΣΤΙΚΗ ΒΙΟΛΟΓΙΑ Παύλος Αντωνίου Με μια ματιά: Εισαγωγή στη Βιολογία Ευθυγράμμιση Ακολουθιών Αναζήτηση ομοίων ακολουθιών από βάσεις δεδομενων Φυλογενετική πρόβλεψη Πρόβλεψη

Διαβάστε περισσότερα

ΟΜΟΣΠΟΝ ΙΑ ΕΚΠΑΙ ΕΥΤΙΚΩΝ ΦΡΟΝΤΙΣΤΩΝ ΕΛΛΑ ΟΣ (Ο.Ε.Φ.Ε.) ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ 2013 ÁÍÅËÉÎÇ

ΟΜΟΣΠΟΝ ΙΑ ΕΚΠΑΙ ΕΥΤΙΚΩΝ ΦΡΟΝΤΙΣΤΩΝ ΕΛΛΑ ΟΣ (Ο.Ε.Φ.Ε.) ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ ΕΠΑΝΑΛΗΠΤΙΚΑ ΘΕΜΑΤΑ 2013 ÁÍÅËÉÎÇ ΤΑΞΗ: ΚΑΤΕΥΘΥΝΣΗ: ΜΑΘΗΜΑ: Γ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗ ΒΙΟΛΟΓΙΑ Ηµεροµηνία: Κυριακή 28 Απριλίου 2013 ιάρκεια Εξέτασης: 3 ώρες ΕΚΦΩΝΗΣΕΙΣ ΘΕΜΑ Α Να γράψετε στο τετράδιό σας τον αριθµό καθεµιάς από τις παρακάτω

Διαβάστε περισσότερα

ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ ΤΑΞΗ

ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ ΤΑΞΗ ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ Σ ΕΣΠΕΡΙΝΟΥ ΕΝΙΑΙΟΥ ΛΥΚΕΙΟΥ ΠΑΡΑΣΚΕΥΗ 2 ΙΟΥΝΙΟΥ 2006 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ: ΒΙΟΛΟΓΙΑ ΣΥΝΟΛΟ ΣΕΛΙ ΩΝ: ΠΕΝΤΕ (5) ΘΕΜΑ 1ο Α. Για τις ημιτελείς προτάσεις

Διαβάστε περισσότερα

ΥΠΟΔΕΙΓΜΑΤΙΚΑ ΛΥΜΕΝΕΣ ΑΣΚΗΣΕΙΣ ΚΕΦ. 1ο

ΥΠΟΔΕΙΓΜΑΤΙΚΑ ΛΥΜΕΝΕΣ ΑΣΚΗΣΕΙΣ ΚΕΦ. 1ο ΥΠΟΔΕΙΓΜΑΤΙΚΑ ΛΥΜΕΝΕΣ ΑΣΚΗΣΕΙΣ ΚΕΦ. 1ο ΔΙΑΓΡΑΜΜΑΤΑ 1. Ένας άνθρωπος μολύνεται από έναν ιό. Το παρακάτω διάγραμμα απεικονίζει τις συγκεντρώσεις των αντιγόνων και των αντισωμάτων αυτού του ανθρώπου κατά

Διαβάστε περισσότερα

ΑΛΥΣΙΔΩΤΗ ΑΝΤΙΔΡΑΣΗ ΠΟΛΥΜΕΡΑΣΗΣ POLYMERASE CHAIN REACTION (PCR)

ΑΛΥΣΙΔΩΤΗ ΑΝΤΙΔΡΑΣΗ ΠΟΛΥΜΕΡΑΣΗΣ POLYMERASE CHAIN REACTION (PCR) ΕΡΓΑΣΤΗΡΙΑΚΗ ΑΣΚΗΣΗ ΑΛΥΣΙΔΩΤΗ ΑΝΤΙΔΡΑΣΗ ΠΟΛΥΜΕΡΑΣΗΣ POLYMERASE CHAIN REACTION (PCR) Α. ΘΕΩΡΗΤΙΚΟ ΜΕΡΟΣ Σταμάτης Κουσίσης, Δημοσθένης Κίζης, Δήμητρα Χούχουλα Βασική αρχή της Αλυσιδωτής Αντίδρασης της Πολυμεράσης

Διαβάστε περισσότερα

Απαντήσεις Θεμάτων Πανελληνίων Εξετάσεων Ημερησίων Γενικών Λυκείων

Απαντήσεις Θεμάτων Πανελληνίων Εξετάσεων Ημερησίων Γενικών Λυκείων 4 Ιουνίου 2014 ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Απαντήσεις Θεμάτων Πανελληνίων Εξετάσεων Ημερησίων Γενικών Λυκείων ΘΕΜΑ Α Α.1δ Α.2 γ Α.3 β Α.4 γ Α.5 β ΘΕΜΑ Β B.1 4 2 1 6 3 5 B.2 α. DNAπολυμεράση β. πριμόσωμα

Διαβάστε περισσότερα

ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ ΤΗΣ Γ' ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ

ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ ΤΗΣ Γ' ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ ΤΗΣ Γ' ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΟΙ ΛΥΣΕΙΣ ΤΩΝ ΘΕΜΑΤΩΝ ΑΠΟ ΤΟΝ ΚΑΘΗΓΗΤΗ κύριο ΤΡΙΓΚΑ ΓΕΩΡΓΙΟ του ΦΡΟΝΤΙΣΤΗΡΙΟΥ του ΦΡΟΝΤΙΣΤΗΡΙΟΥ www.orion.edu.gr ΘΕΜΑ A A1. γ A2. β A3.

Διαβάστε περισσότερα

ΑΣΚΗΣΕΙΣ ΒΙΟΛΟΓΙΑΣ ΕΙΣΑΓΩΓΙΚΩΝ ΕΞΕΤΑΣΕΩΝ ΑΠΟ ΤΟ 2003-2013

ΑΣΚΗΣΕΙΣ ΒΙΟΛΟΓΙΑΣ ΕΙΣΑΓΩΓΙΚΩΝ ΕΞΕΤΑΣΕΩΝ ΑΠΟ ΤΟ 2003-2013 ΑΣΚΗΣΕΙΣ ΒΙΟΛΟΓΙΑΣ ΕΙΣΑΓΩΓΙΚΩΝ ΕΞΕΤΑΣΕΩΝ ΑΠΟ ΤΟ 2003-2013 ΧΡΙΣΤΙΝΑ ΠΕΡΔΙΟΥ ΒΙΟΛΟΓΟΣ (MSc) 1 ΠΕΡΙΕΧΟΜΕΝΑ ΕΝΟΤΗΤΑ ΣΕΛΙΔΑ Ενότητα 2 : Χημεία της ζωής 4 Ενότητα 3: Ενέργεια και οργανισμοί 13 Ενότητα 4: κυτταρική

Διαβάστε περισσότερα

ΑΠΑΝΤΗΣΕΙΣ ΣΤΗ ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ 24 ΜΑΪΟΥ 2013

ΑΠΑΝΤΗΣΕΙΣ ΣΤΗ ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ 24 ΜΑΪΟΥ 2013 ΑΠΑΝΤΗΣΕΙΣ ΣΤΗ ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ 24 ΜΑΪΟΥ 2013 ΘΕΜΑ Α Α1. γ Α2. β Α3. α Α4. δ Α5. α ΘΕΜΑ Β Β1. Σελ. 123 124 σχολ. βιβλίου: «Η διαδικασία που ακολουθείται παράγουν το ένζυμο ADA». Β2. Σελ. 133 σχολ.

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΟΝΟΜΑΤΕΠΩΝΥΜΟ: ΤΜΗΜΑ: ΘΕΜΑ 1 Ο. 3. Το DNA των μιτοχονδρίων έχει μεγαλύτερο μήκος από αυτό των χλωροπλαστών.

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΟΝΟΜΑΤΕΠΩΝΥΜΟ: ΤΜΗΜΑ: ΘΕΜΑ 1 Ο. 3. Το DNA των μιτοχονδρίων έχει μεγαλύτερο μήκος από αυτό των χλωροπλαστών. ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΟΝΟΜΑΤΕΠΩΝΥΜΟ: ΤΜΗΜΑ: ΘΕΜΑ 1 Ο Α. Να γράψετε τον αριθμό της καθεμιάς από τις παρακάτω προτάσεις 1-5 και δίπλα του τη λέξη Σωστό, αν η πρόταση είναι σωστή, ή Λάθος, αν η πρόταση

Διαβάστε περισσότερα

ΤΕΛΟΣ 1ΗΣ ΑΠΟ 4 ΣΕΛΙ ΕΣ

ΤΕΛΟΣ 1ΗΣ ΑΠΟ 4 ΣΕΛΙ ΕΣ ΑΡΧΗ 1ΗΣ ΣΕΛΙ ΑΣ ΕΙΣΑΓΩΓΙΚΕΣ ΕΞΕΤΑΣΕΙΣ ΤΕΚΝΩΝ ΕΛΛΗΝΩΝ ΤΟΥ ΕΞΩΤΕΡΙΚΟΥ ΚΑΙ ΤΕΚΝΩΝ ΕΛΛΗΝΩΝ ΥΠΑΛΛΗΛΩΝ ΣΤΟ ΕΞΩΤΕΡΙΚΟ ΤΕΤΑΡΤΗ 11 ΣΕΠΤΕΜΒΡΙΟΥ 2013 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ: ΒΙΟΛΟΓΙΑ ΣΥΝΟΛΟ ΣΕΛΙΔΩΝ:

Διαβάστε περισσότερα

ΘΕΜΑ Α ΘΕΜΑ Β ΘΕΜΑ Γ. Α1. δ. Α2. γ. Α3. β. Α4. γ. Α5. β Β1. Η σωστή σειρά είναι: 4,2,1,6,3,5. Β2. α. DNA πολυμεράση. β. Πριμόσωμα. γ.

ΘΕΜΑ Α ΘΕΜΑ Β ΘΕΜΑ Γ. Α1. δ. Α2. γ. Α3. β. Α4. γ. Α5. β Β1. Η σωστή σειρά είναι: 4,2,1,6,3,5. Β2. α. DNA πολυμεράση. β. Πριμόσωμα. γ. ΘΕΜΑ Α ΠΑΝΕΛΛΑ ΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΚΑΙ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΚΑΙ ΕΠΑΛ(ΟΜΑ Α Β ) ΤΕΤΑΡΤΗ 4 ΙΟΥΝΙΟΥ 2014 - ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΚΑΤΕΥΘΥΝΣΗΣ Α1. δ Α2. γ Α3. β Α4. γ Α5. β ΘΕΜΑ Β Β1. Η σωστή

Διαβάστε περισσότερα

www.epignosi.edu.gr ΘΕΜΑ Α

www.epignosi.edu.gr ΘΕΜΑ Α ΘΕΜΑ Α Να γράψετε στην κόλλα σας τον αριθμό καθεμιάς από τις παρακάτω ημιτελείς προτάσεις 1 έως 5 και δίπλα το γράμμα που αντιστοιχεί στη λέξη ή τη φράση, η οποία συμπληρώνει σωστά την ημιτελή πρόταση.

Διαβάστε περισσότερα

4 DNA ελικάση Δ Περιέχουν πανομοιότυπο DNA. 6 Πριμόσωμα ΣΤ Σταθερότητα κατά μήκος της κάθε πολυνουκλεοτιδικής αλυσίδας

4 DNA ελικάση Δ Περιέχουν πανομοιότυπο DNA. 6 Πριμόσωμα ΣΤ Σταθερότητα κατά μήκος της κάθε πολυνουκλεοτιδικής αλυσίδας Θέμα 1 ο 1. Αντιστοιχείστε όλες τις έννοιες της στήλης 1 με όλες τις φράσεις της στήλης 2 (Οι αντιστοιχίσεις να γραφούν στην κόλλα απαντήσεων σας & όχι στη φωτοτυπία των θεμάτων) 1 2 1 Αδελφές χρωματίδες

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ Γ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 2008

ΒΙΟΛΟΓΙΑ Γ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 2008 ΒΙΟΛΟΓΙΑ Γ ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ 2008 ΕΚΦΩΝΗΣΕΙΣ ΘΕΜΑ 1ο Να γράψετε στο τετράδιό σας τον αριθµό καθεµιάς από τις παρακάτω ηµιτελείς προτάσεις 1 έως 5 και δίπλα το γράµµα που αντιστοιχεί στη λέξη

Διαβάστε περισσότερα

Παραγωγή φαρμακευτικών πρωτεϊνών με βιοτεχνολογικές μεθόδους Μεταφορά γονιδίων σε ευκαρυωτικά κύτταρα (Γονιδιακή θεραπεία)

Παραγωγή φαρμακευτικών πρωτεϊνών με βιοτεχνολογικές μεθόδους Μεταφορά γονιδίων σε ευκαρυωτικά κύτταρα (Γονιδιακή θεραπεία) Παραγωγή φαρμακευτικών πρωτεϊνών με βιοτεχνολογικές μεθόδους Μεταφορά γονιδίων σε ευκαρυωτικά κύτταρα (Γονιδιακή θεραπεία) Παραγωγή ινσουλίνης από βακτήρια Παρελθόν: απομόνωση ινσουλίνης από πάνγκρεας

Διαβάστε περισσότερα

ΑΡΙΣΤΟΤΕΛΕΙΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΘΕΣΣΑΛΟΝΙΚΗΣ ΓΕΩΠΟΝΙΚΗ ΣΧΟΛΗ ΤΟΜΕΑΣ ΦΥΤΟΠΡΟΣΤΑΣΙΑΣ ΜΕΤΑΠΤΥΧΙΑΚΗ ΕΙΔΙΚΕΥΣΗ ΕΠΙΣΤΗΜΩΝ ΦΥΤΟΠΡΟΣΤΑΣΙΑΣ

ΑΡΙΣΤΟΤΕΛΕΙΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΘΕΣΣΑΛΟΝΙΚΗΣ ΓΕΩΠΟΝΙΚΗ ΣΧΟΛΗ ΤΟΜΕΑΣ ΦΥΤΟΠΡΟΣΤΑΣΙΑΣ ΜΕΤΑΠΤΥΧΙΑΚΗ ΕΙΔΙΚΕΥΣΗ ΕΠΙΣΤΗΜΩΝ ΦΥΤΟΠΡΟΣΤΑΣΙΑΣ ΑΡΙΣΤΟΤΕΛΕΙΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΘΕΣΣΑΛΟΝΙΚΗΣ ΓΕΩΠΟΝΙΚΗ ΣΧΟΛΗ ΤΟΜΕΑΣ ΦΥΤΟΠΡΟΣΤΑΣΙΑΣ ΜΕΤΑΠΤΥΧΙΑΚΗ ΕΙΔΙΚΕΥΣΗ ΕΠΙΣΤΗΜΩΝ ΦΥΤΟΠΡΟΣΤΑΣΙΑΣ Συχνότητα εμφάνισης των Turnip mosaic virus (TuMV) και Cauliflower mosaic virus

Διαβάστε περισσότερα

ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΚΑΙ ΕΠΑΛ (ΟΜΑΔΑ Β ) TETAPTH 4 IOYNIOY 2014 - ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ:

ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΚΑΙ ΕΠΑΛ (ΟΜΑΔΑ Β ) TETAPTH 4 IOYNIOY 2014 - ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Θέμα Α. Α.1. δ Α.2. γ Α.3. β Α.4. γ Α.5. β Θέμα Β. Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΚΑΙ ΕΠΑΛ (ΟΜΑΔΑ Β ) TETAPTH 4 IOYNIOY 2014 - ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: Β.1. 4 2 1-6 3-5 B.2. α.) DNA

Διαβάστε περισσότερα

HPV-Εμβόλιο: Νέα εποχή στην πρόληψη του καρκίνου του τραχήλου

HPV-Εμβόλιο: Νέα εποχή στην πρόληψη του καρκίνου του τραχήλου HPV-Εμβόλιο: Νέα εποχή στην πρόληψη του καρκίνου του τραχήλου Θεόδωρος Αγοραστός Καθηγητής Μαιευτικής-Γυναικολογίας Α.Π.Θ., Α' Μαιευτική & Γυναικολογική Κλινική Α.Π.Θ., Γ.Π.Ν. Παπαγεωργίου ισό αιώνα μετά

Διαβάστε περισσότερα

Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΒΙΟΛΟΓΙΑ ΑΠΑΝΤΗΣΕΙΣ ÏÅÖÅ

Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΒΙΟΛΟΓΙΑ ΑΠΑΝΤΗΣΕΙΣ ÏÅÖÅ 1 Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΒΙΟΛΟΓΙΑ ΘΕΜΑ 1 o 1 Β 2 3 Γ 4 5 Β. ΘΕΜΑ 2 o ΑΠΑΝΤΗΣΕΙΣ Α. Όπως στο σχολικό, σελίδα 20: «Κάθε φυσιολογικό µεταφασικό ως προς τη θέση του κεντροµεριδίου» και σελίδα «Κατά

Διαβάστε περισσότερα

Όλοι οι οργανισμοί αποτελούνται από κύτταρα omnis cellula e cellula

Όλοι οι οργανισμοί αποτελούνται από κύτταρα omnis cellula e cellula ΤΟ ΚΥΤΤΑΡΟ Matthias Schleiden - Rudolf Schwann : Κυτταρική Θεωρία (1838) Walter Flemming: Κυτταρική διαίρεση (1882) Όλοι οι οργανισμοί αποτελούνται από κύτταρα omnis cellula e cellula ΟΙ ΙΟΙ καψομερή

Διαβάστε περισσότερα

Γενικές εξετάσεις 2014 Βιολογία Γ λυκείου Θετικής κατεύθυνσης

Γενικές εξετάσεις 2014 Βιολογία Γ λυκείου Θετικής κατεύθυνσης Φροντιστήρια δυαδικό ΦΡΟΝΤΙΣΤΗΡΙΑ δυαδικό Τα θέματα επεξεργάστηκαν οι καθηγητές των Φροντιστηρίων «δυαδικό» Πασσιά Α. Γενικές εξετάσεις 20 Βιολογία Γ λυκείου Θετικής κατεύθυνσης Θέμα Α Να γράψετε στο τετράδιό

Διαβάστε περισσότερα

ΑΠΑΝΤΗΣΕΙΣ. ΘΕΜΑ Α Α1. β Α2. γ Α3. γ Α4. α Α5. δ

ΑΠΑΝΤΗΣΕΙΣ. ΘΕΜΑ Α Α1. β Α2. γ Α3. γ Α4. α Α5. δ ΘΕΜΑ Α Α1. β Α2. γ Α3. γ Α4. α Α5. δ 1 ΕΙΣΑΓΩΓΙΚΕΣ ΕΞΕΤΑΣΕΙΣ ΤΕΚΝΩΝ ΕΛΛΗΝΩΝ ΤΟΥ ΕΞΩΤΕΡΙΚΟΥ ΚΑΙ ΤΕΚΝΩΝ ΕΛΛΗΝΩΝ ΥΠΑΛΛΗΛΩΝ ΣΤΟ ΕΞΩΤΕΡΙΚΟ ΤΕΤΑΡΤΗ 15 ΣΕΠΤΕΜΒΡΙΟΥ 2010 ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ:

Διαβάστε περισσότερα

Η Επιτροπή Παιδείας της ΠΕΒ. Αθήνα, 4/6/2014 ΠΑΝΕΛΛΗΝΙΑ ΕΝΩΣΗ ΒΙΟΕΠΙΣΤΗΜΟΝΩΝ

Η Επιτροπή Παιδείας της ΠΕΒ. Αθήνα, 4/6/2014 ΠΑΝΕΛΛΗΝΙΑ ΕΝΩΣΗ ΒΙΟΕΠΙΣΤΗΜΟΝΩΝ Αθήνα, 4/6/2014 ΠΑΝΕΛΛΗΝΙΑ ΕΝΩΣΗ ΒΙΟΕΠΙΣΤΗΜΟΝΩΝ Σας αποστέλλουμε τις προτεινόμενες απαντήσεις που αφορούν τα θέματα της Βιολογίας Θετικής Κατεύθυνσης των Ημερησίων Γενικών Λυκείων και ΕΠΑΛ (Ομάδα Β ).

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΘΕΜΑ Α ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Να γράψετε στο τετράδιό σας τον αριθμό καθεμιάς από τις παρακάτω ημιτελείς προτάσεις Α1 έως Α5 και δίπλα το γράμμα που αντιστοιχεί στη λέξη ή τη φράση, η οποία συμπληρώνει

Διαβάστε περισσότερα

Γ1. Το γνώρισμα για το μέγεθος των φτερών ελέγχεται από αυτοσωμικό γονίδιο.

Γ1. Το γνώρισμα για το μέγεθος των φτερών ελέγχεται από αυτοσωμικό γονίδιο. ΠΑΝΕΛΛΗΝΙΕΣ ΒΙΟΛΟΓΙΑΣ ΚΑΤΕΥΘΥΝΣΗΣ 2013 AΠΑΝΤΗΣΕΙΣ ΘΕΜΑ Α Α1.γ Α2.β Α3.α Α4.δ Α5.α ΘΕΜΑ Β Β1. Η γονιδιακή θεραπεία εφαρμόστηκε για πρώτη φορά το 1990 σε ένα κορίτσι που έπασχε από έλλειψη της απαμινάσης

Διαβάστε περισσότερα

Για το χρώµα σπέρµατος επικρατής είναι η ιδιότητα κίτρινο και η υπολειπόµενη το πράσινο. Συµβολίζουµε: Κ:Κίτρινο κ: Πράσινο Κ>κ

Για το χρώµα σπέρµατος επικρατής είναι η ιδιότητα κίτρινο και η υπολειπόµενη το πράσινο. Συµβολίζουµε: Κ:Κίτρινο κ: Πράσινο Κ>κ Απαντήσεις Βιολογία Κατεύθυνσης 2011 ΘΕΜΑ Α Α1 α Α2 δ Α3 γ Α4 β Α5 β ΘΕΜΑ Β Β1 Σελ. 13 «Το 1928 γίνεται αυτό» Β2 Σελ 101 «βλάβες στους επιδιορθωτικά ένζυµα» (Χωρίς να απαιτείται θα θεωρηθεί σωστό να γίνει

Διαβάστε περισσότερα

Β. ΚΑΜΙΝΕΛΛΗΣ ΒΙΟΛΟΓΙΑ. Είναι η επιστήμη που μελετά τους ζωντανούς οργανισμούς. (Αποτελούνται από ένα ή περισσότερα κύτταρα).

Β. ΚΑΜΙΝΕΛΛΗΣ ΒΙΟΛΟΓΙΑ. Είναι η επιστήμη που μελετά τους ζωντανούς οργανισμούς. (Αποτελούνται από ένα ή περισσότερα κύτταρα). ΒΙΟΛΟΓΙΑ Είναι η επιστήμη που μελετά τους ζωντανούς οργανισμούς. (Αποτελούνται από ένα ή περισσότερα κύτταρα). Είδη οργανισμών Υπάρχουν δύο είδη οργανισμών: 1. Οι μονοκύτταροι, που ονομάζονται μικροοργανισμοί

Διαβάστε περισσότερα

Ποιες είναι οι ομοιότητες και οι διαφορές μεταξύ της αντιγραφής και της

Ποιες είναι οι ομοιότητες και οι διαφορές μεταξύ της αντιγραφής και της ΚΕΦ. 2 ο ΕΡΩΤΗΣΕΙΣ ΚΡΙΣΕΩΣ Ποιες είναι οι ομοιότητες και οι διαφορές μεταξύ της αντιγραφής και της μεταγραφής; Διαφορές Αντιγραφή Μεταγραφή 1. Διατηρείται και μεταβιβάζεται η 1. Μεταβιβάζεται η γενετική

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΘΕΜΑ 1ο Να γράψετε στο τετράδιό σας τον αριθμό καθεμιάς από τις παρακάτω ημιτελείς προτάσεις 1 έως 5 και δίπλα το γράμμα που αντιστοιχεί στη λέξη ή τη φράση, η οποία

Διαβάστε περισσότερα

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ

ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ ΘΕΜΑ 1ο Να γράψετε στο τετράδιό σας τον αριθμό καθεμιάς από τις παρακάτω ημιτελείς προτάσεις 1 έως 5 και δίπλα το γράμμα που αντιστοιχεί στη λέξη ή τη φράση, η οποία

Διαβάστε περισσότερα

ΘΕΜΑ Α. Α1 δ Α2 γ Α3 β Α4 γ Α5 β ΘΕΜΑ Β 3-2 - 5-1 - 6-4. α-dna πολυμεράση β-πριμόσημα γ- DNA δεσμάση δ- DNA ελικάση ε- RNA πολυμεράση

ΘΕΜΑ Α. Α1 δ Α2 γ Α3 β Α4 γ Α5 β ΘΕΜΑ Β 3-2 - 5-1 - 6-4. α-dna πολυμεράση β-πριμόσημα γ- DNA δεσμάση δ- DNA ελικάση ε- RNA πολυμεράση ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΚΑΙ ΕΠΑΛ (ΟΜΑΔΑ Β ) Τετάρτη, 4 Ιουνίου 2014 - ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗ ΚΑΤΕΥΘΥΝΣΗΣ ΑΠΑΝΤΗΣΕΙΣ ΘΕΜΑ Α Α1 δ Α2 γ Α3 β Α4 γ Α5 β ΘΕΜΑ Β

Διαβάστε περισσότερα

Α3. Η εισαγωγή ανασυνδυασμένου DNA σε βακτήριο-ξενιστή ονομάζεται α. μικροέγχυση β. μετασχηματισμός γ. εμβολιασμός δ. κλωνοποίηση.

Α3. Η εισαγωγή ανασυνδυασμένου DNA σε βακτήριο-ξενιστή ονομάζεται α. μικροέγχυση β. μετασχηματισμός γ. εμβολιασμός δ. κλωνοποίηση. ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΚΑΙ ΕΠΑΛ (ΟΜΑΔΑ Β ) TETAPTH 4 IOYNIOY 2014 - ΕΞΕΤΑΖΟΜΕΝΟ ΜΑΘΗΜΑ: ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΣΥΝΟΛΟ ΣΕΛΙΔΩΝ: ΠΕΝΤΕ (5) ΘΕΜΑ Α Να γράψετε στο τετράδιό

Διαβάστε περισσότερα

ΛΥΣΗ ΤΗΣ ΑΣΚΗΣΗΣ ΕΠΑΝΑΛΗΨΗΣ

ΛΥΣΗ ΤΗΣ ΑΣΚΗΣΗΣ ΕΠΑΝΑΛΗΨΗΣ ΛΥΣΗ ΤΗΣ ΑΣΚΗΣΗΣ ΕΠΑΝΑΛΗΨΗΣ 1. Ο γενετικός κώδικας είναι ένας κώδικας αντιστοίχισης των κωδικονίων του mrna με αμινοξέα στην πολυπεπτιδική αλυσίδα. Σύμφωνα με αυτόν η 3 μετάφραση όλων των mrna αρχίζει

Διαβάστε περισσότερα

Α2. Το αντικωδικόνιο είναι τριπλέτα νουκλεοτιδίων του α. mrna β. snrna γ. trna δ. rrna. Μονάδες 5

Α2. Το αντικωδικόνιο είναι τριπλέτα νουκλεοτιδίων του α. mrna β. snrna γ. trna δ. rrna. Μονάδες 5 Α Π Α Ν Τ Η Σ Ε Ι Σ Θ Ε Μ Α Τ Ω Ν Π Α Ν Ε Λ Λ Α Ι Κ Ω Ν Ε Ξ Ε Τ Α Σ Ε Ω Ν 2 0 1 4 ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ Γ ΛΥΚΕΙΟΥ 04.06.2014 ΘΕΜΑ Α Να γράψετε στο τετράδιό σας τον αριθμό καθεμίας από τις παρακάτω

Διαβάστε περισσότερα

ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ ΤΗΣ Γ' ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ. ΟΙ ΛΥΣΕΙΣ ΤΩΝ ΘΕΜΑΤΩΝ ΑΠΟ ΤΟΝ ΚΑΘΗΓΗΤΗ κύριο ΤΡΙΓΚΑ ΓΕΩΡΓΙΟ του ΦΡΟΝΤΙΣΤΗΡΙΟΥ

ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ ΤΗΣ Γ' ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ. ΟΙ ΛΥΣΕΙΣ ΤΩΝ ΘΕΜΑΤΩΝ ΑΠΟ ΤΟΝ ΚΑΘΗΓΗΤΗ κύριο ΤΡΙΓΚΑ ΓΕΩΡΓΙΟ του ΦΡΟΝΤΙΣΤΗΡΙΟΥ ΑΠΟΛΥΤΗΡΙΕΣ ΕΞΕΤΑΣΕΙΣ ΤΗΣ Γ' ΛΥΚΕΙΟΥ ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΚΑΤΕΥΘΥΝΣΗΣ ΟΙ ΛΥΣΕΙΣ ΤΩΝ ΘΕΜΑΤΩΝ ΑΠΟ ΤΟΝ ΚΑΘΗΓΗΤΗ κύριο ΤΡΙΓΚΑ ΓΕΩΡΓΙΟ του ΦΡΟΝΤΙΣΤΗΡΙΟΥ www.orionidef.gr ΘΕΜΑ A Α1. α Α2. δ Α3. γ Α4. β Α5. β ΘΕΜΑ

Διαβάστε περισσότερα

igenetics ΜΑΘΗΜΑ 3 Το γενετικό υλικό

igenetics ΜΑΘΗΜΑ 3 Το γενετικό υλικό igenetics ΜΑΘΗΜΑ 3 Το γενετικό υλικό ΛΕΙΤΟΥΡΓΙΕΣ ΤΟΥ ΓΕΝΕΤΙΚΟΥ ΥΛΙΚΟΥ ΑΠΟΘΗΚΕΥΣΗ Στο DNA (RNA ιών) οι πληροφορίες για τα χαρακτηριστικά ενός οργανισμού (γονίδια) ΔΙΑΤΗΡΗΣΗ Από κύτταρο σε κύτταρο και από

Διαβάστε περισσότερα

1.1. Το γενετικό υλικό είναι το DNA 1. ΤΟ ΓΕΝΕΤΙΚΟ ΥΛΙΚΟ ΒΑΣΙΚΕΣ ΕΡΩΤΗΣΕΙΣ ΘΕΩΡΙΑΣ

1.1. Το γενετικό υλικό είναι το DNA 1. ΤΟ ΓΕΝΕΤΙΚΟ ΥΛΙΚΟ ΒΑΣΙΚΕΣ ΕΡΩΤΗΣΕΙΣ ΘΕΩΡΙΑΣ 1. ΤΟ ΓΕΝΕΤΙΚΟ ΥΛΙΚΟ 1.1. Το γενετικό υλικό είναι το DNA ΒΑΣΙΚΕΣ ΕΡΩΤΗΣΕΙΣ ΘΕΩΡΙΑΣ 1.1.1 Γιατί οι επιστήμονες πίστευαν ότι τα μόρια που μεταφέρουν τη γενετική πληροφορία είναι οι πρωτεΐ νες; Οι επιστήμονες

Διαβάστε περισσότερα

Θέματα Πανελλαδικών 2000-2013

Θέματα Πανελλαδικών 2000-2013 Θέματα Πανελλαδικών 2000-2013 ΒΙΟΛΟΓΙΑ ΘΕΤΙΚΗΣ ΗΜΕΡΗΣΙΩΝ ΛΥΚΕΙΩΝ ΕΣΠΕΡΙΝΩΝ ΛΥΚΕΙΩΝ ΕΠΑΝΑΛΗΠΤΙΚΕΣ Κεφάλαιο 4 ΚΕΦΑΛΑΙΟ 4 ΘΕΜΑ 1 ο Γράψτε τον αριθμό καθεμιάς από τις παρακάτω προτάσεις και δίπλα το γράμμα

Διαβάστε περισσότερα

ΓΕΝΕΤΙΚΑ ΤΡΟΠΟΠΟΙΗΜΕΝΑ ΦΥΤΑ. ΑΡΧΕΣ ΓΟΝΙ ΙΑΚΟΥ ΧΕΙΡΙΣΜΟΥ ΙΙ (ΜΑΘΗΜΑ 3ο)

ΓΕΝΕΤΙΚΑ ΤΡΟΠΟΠΟΙΗΜΕΝΑ ΦΥΤΑ. ΑΡΧΕΣ ΓΟΝΙ ΙΑΚΟΥ ΧΕΙΡΙΣΜΟΥ ΙΙ (ΜΑΘΗΜΑ 3ο) ΓΕΝΕΤΙΚΑ ΤΡΟΠΟΠΟΙΗΜΕΝΑ ΦΥΤΑ ΑΡΧΕΣ ΓΟΝΙ ΙΑΚΟΥ ΧΕΙΡΙΣΜΟΥ ΙΙ (ΜΑΘΗΜΑ 3ο) 1 ΦΟΡΕΙΣ πλασµίδια βακτηρίων βακτηριοφάγοι ιοί συνδυασµός πλασµιδίου βακτηριοφάγου (κοσµίδια) 2 ΦΟΡΕΙΣ Βακτηριοφάγοι Χαρακτηριστικά

Διαβάστε περισσότερα

ΤΡΟΦΙΜΑ ΑΠΟ ΓΕΝΕΤΙΚΑ ΤΡΟΠΟΠΟΙΗΜΕΝΟΥΣ ΟΡΓΑΝΙΣΜΟΥΣ:

ΤΡΟΦΙΜΑ ΑΠΟ ΓΕΝΕΤΙΚΑ ΤΡΟΠΟΠΟΙΗΜΕΝΟΥΣ ΟΡΓΑΝΙΣΜΟΥΣ: ΤΡΟΦΙΜΑ ΑΠΟ ΓΕΝΕΤΙΚΑ ΤΡΟΠΟΠΟΙΗΜΕΝΟΥΣ ΟΡΓΑΝΙΣΜΟΥΣ: ΕΝΑ ΠΕΙΡΑΜΑ ΜΕ ΑΓΝΩΣΤΑ ΑΠΟΤΕΛΕΣΜΑΤΑ ΣΤΗΝ ΥΓΕΙΑ, ΤΟ ΠΕΡΙΒΑΛΛΟΝ, ΤΗΝ ΚΟΙΝΩΝΙΑ ΝΙΚΟΛΑΣ ΠΡΙΜΗΚΥΡΙΟΣ, ΓΕΩΠΟΝΟΣ, Δρ. ΦΥΣΙΟΛΟΓΙΑΣ ΚΑΙ ΒΙΟΤΕΧΝΟΛΟΓΙΑΣ ΦΥΤΩΝ ΓΕΝΕΤΙΚΑ

Διαβάστε περισσότερα

ΑΝΗΣΥΧΙΑ ΓΙΑ ΤΟΝ ΙΟ ΤΟΥ ΔΥΤΙΚΟΥ ΝΕΙΛΟΥ ΑΝΙΧΝΕΥΘΗΚΕ ΚΑΙ ΣΕ ΜΗ ΑΠΟΔΗΜΗΤΙΚΑ ΠΤΗΝΑ

ΑΝΗΣΥΧΙΑ ΓΙΑ ΤΟΝ ΙΟ ΤΟΥ ΔΥΤΙΚΟΥ ΝΕΙΛΟΥ ΑΝΙΧΝΕΥΘΗΚΕ ΚΑΙ ΣΕ ΜΗ ΑΠΟΔΗΜΗΤΙΚΑ ΠΤΗΝΑ 1 ΑΝΗΣΥΧΙΑ ΓΙΑ ΤΟΝ ΙΟ ΤΟΥ ΔΥΤΙΚΟΥ ΝΕΙΛΟΥ ΑΝΙΧΝΕΥΘΗΚΕ ΚΑΙ ΣΕ ΜΗ ΑΠΟΔΗΜΗΤΙΚΑ ΠΤΗΝΑ Θεσσαλονίκη 18 Μαρτίου 2011 Δ Ε Λ Τ Ι Ο Τ Υ Π ΟΥ Ανησυχητικά είναι τα επιστημονικά ευρήματα για τη διασπορά του ιού του

Διαβάστε περισσότερα

Σας αποστέλλουμε τις προτεινόμενες απαντήσεις που αφορούν τα θέματα της Βιολογίας Γενικής Παιδείας των Ημερησίων Γενικών Λυκείων και ΕΠΑΛ (Ομάδας Β ).

Σας αποστέλλουμε τις προτεινόμενες απαντήσεις που αφορούν τα θέματα της Βιολογίας Γενικής Παιδείας των Ημερησίων Γενικών Λυκείων και ΕΠΑΛ (Ομάδας Β ). Αθήνα, 30/5/2014 ΠΑΝΕΛΛΗΝΙΑ ΕΝΩΣΗ ΒΙΟΕΠΙΣΤΗΜΟΝΩΝ Σας αποστέλλουμε τις προτεινόμενες απαντήσεις που αφορούν τα θέματα της Βιολογίας Γενικής Παιδείας των Ημερησίων Γενικών Λυκείων και ΕΠΑΛ (Ομάδας Β ). Η

Διαβάστε περισσότερα

Πανελλήνιες Εξετάσεις Ημερήσιων Γενικών Λυκείων. Εξεταζόμενο Μάθημα: Βιολογία Θετικής Κατεύθυνσης, Ημ/νία: 24 Μαΐου 2013. Απαντήσεις Θεμάτων

Πανελλήνιες Εξετάσεις Ημερήσιων Γενικών Λυκείων. Εξεταζόμενο Μάθημα: Βιολογία Θετικής Κατεύθυνσης, Ημ/νία: 24 Μαΐου 2013. Απαντήσεις Θεμάτων Πανελλήνιες Εξετάσεις Ημερήσιων Γενικών Λυκείων Εξεταζόμενο Μάθημα: Βιολογία Θετικής Κατεύθυνσης, Ημ/νία: 24 Μαΐου 2013 Απαντήσεις Θεμάτων ΘΕΜΑ Α Α1. Βασική μονάδα οργάνωσης αποτελεί το Γ. νουκλεόσωμα

Διαβάστε περισσότερα

ΤΕΧΝΟΛΟΓΙΚΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΚΥΠΡΟΥ ΤΜΗΜΑ ΝΟΣΗΛΕΥΤΙΚΗΣ

ΤΕΧΝΟΛΟΓΙΚΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΚΥΠΡΟΥ ΤΜΗΜΑ ΝΟΣΗΛΕΥΤΙΚΗΣ ΤΕΧΝΟΛΟΓΙΚΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΚΥΠΡΟΥ ΤΜΗΜΑ ΝΟΣΗΛΕΥΤΙΚΗΣ Επιβλέπων Καθηγητής: Δρ. Νίκος Μίτλεττον Η ΣΧΕΣΗ ΤΟΥ ΜΗΤΡΙΚΟΥ ΘΗΛΑΣΜΟΥ ΜΕ ΤΗΝ ΕΜΦΑΝΙΣΗ ΣΑΚΧΑΡΩΔΗ ΔΙΑΒΗΤΗ ΤΥΠΟΥ 2 ΣΤΗΝ ΠΑΙΔΙΚΗ ΗΛΙΚΙΑ Ονοματεπώνυμο: Ιωσηφίνα

Διαβάστε περισσότερα

ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΤΕΤΑΡΤΗ 4 ΙΟΥΝΙΟΥ 2014. Ενδεικτικές απαντήσεις Θέµα Β

ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΤΕΤΑΡΤΗ 4 ΙΟΥΝΙΟΥ 2014. Ενδεικτικές απαντήσεις Θέµα Β ΠΑΝΕΛΛΑΔΙΚΕΣ ΕΞΕΤΑΣΕΙΣ Γ ΤΑΞΗΣ ΗΜΕΡΗΣΙΟΥ ΓΕΝΙΚΟΥ ΛΥΚΕΙΟΥ ΤΕΤΑΡΤΗ 4 ΙΟΥΝΙΟΥ 2014 Θέµα Α Α1. δ Α2. γ Α3. β A4. γ A5. β Ενδεικτικές απαντήσεις Θέµα Β Β1. Η σειρά των βημάτων που οδηγούν στην κατασκευή καρυοτύπου

Διαβάστε περισσότερα

Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗ ΚΑΤΕΥΘΥΝΣΗ ΒΙΟΛΟΓΙΑ ΑΠΑΝΤΗΣΕΙΣ ÏÅÖÅ

Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗ ΚΑΤΕΥΘΥΝΣΗ ΒΙΟΛΟΓΙΑ ΑΠΑΝΤΗΣΕΙΣ ÏÅÖÅ 1 Γ' ΛΥΚΕΙΟΥ ΘΕΤΙΚΗ ΚΑΤΕΥΘΥΝΣΗ ΒΙΟΛΟΓΙΑ ΘΕΜΑ 1 ο 1 γ 2 δ 3 β 4 α 5 γ ΘΕΜΑ 2 ο ΑΠΑΝΤΗΣΕΙΣ Μονάδες 25 (5Χ5) Α. ιαγονιδιακά ζώα ονοµάζονται εκείνα στα οποία το γενετικό τους υλικό έχει τροποποιηθεί µε την

Διαβάστε περισσότερα