(Sasaki et al, 1971) 25 (Chang, 2005) (IL-2) T (Lai and Lin, 1992) T α. (Lai and Lin, 1991) IL-1,IL-2,IL-6,INF-α,INF-γ (Lieu et al, 1992)
|
|
|
- Δαρείος Παπαντωνίου
- 7 χρόνια πριν
- Προβολές:
Transcript
1 (Chang, 2005) Sasaki (G. applanatum) (Sasaki et al, 1971) -2(IL-2) T (Lai and Lin, 1992) T α DNA T (Lai and Lin, 1991) IL-1,IL-2,IL-6,INF-α,INF-γ (Lieu et al, 1992)
2 (AIDS) β (1-3) β (1-6) G. applanatum G. lucidum G. tsugae (G. applanatum) G. lucidum G. tsugae (Wang et al,1993) T TNF-α IFN-γ (Wang et al, 1997) F3, GLPS, PS-G -1(IL-1) TLR4 (Toll-like receptor-4) (Hsu et al, 2004, Lin et al, 2005) Kubota G. lucidum A.B. (ganoderic acid A. B.) (Kobota et al,1982) 1999 Kim HIV (Kim and Kim,1999) 1989 Kino G. lucidum LZ- (Ling Zhi-8) LZ ,420 Da (Tanaka, 1989) LZ-8 (homodimmer) (systemic anaphylaxis reaction) (Arthus reaction) LZ-8 (Kino, 1989) LZ-8 β-d β-b α-a β-a α-b β-f β-g β-e β-c t-a SDTALIFRLAWDVKKLSFDYTPNWGRGNPN NFIDTVTFPKVLTDKAYTYRVAVSGRNLGV KPSYAVESDGSQKVNFLEYNSGYGIADTNT IQVFVVDPDTNNDFIIAQWN LZ-8 (Lin, 1997)
3 FIP-gts FIP-fve FIP-vvo (Lin et al. 1997) 1989 Kino LZ-8 LZ-8 (nonobese diabetic, NOD) (Kino, 1990) LZ-8 (immunomodulatory drug) : CsA (cyclosporin A) R FK506 tacrolimus LZ-8 (ven der Hem, 1995) LZ-8 (G. tsugae) 13 kd FIP-gts (fungal immunomodulatory protein-gts) LZ-8 LZ-8 (human peripheral lymphocytes) 3 H-thymidine 5 µg/ml RT-PCR LZ-8 (IL-2, IL-4) (IFN-γ) (TNF-α) 1997 FIP-gts LZ kd FIP-fve (Ko et al. 1995) FIP-vvo (Hsu et al. 1997) LZ-8 FIP-fve FIP-vvo G. applanatum G. boninense G. formosamun G. fornicatum G. lucidum G. microsporum G. neojaponicum G. oerstedii G. resinaceum G. sinense G. tropicum G. tsugae G. valesiacum G. weberianum LZ-8 lz-8 LZ-8 genome walking G. microsporum G. fornicatum gmi gfo-1 gfo-2 lz-8 gmi gfo-1 Pichia pastoris KM71 replz regmi regfo-1 MALDI- TOF
4 300 mg/l BALB/c (dendritic cells, DCs) IL-12 J774A.1 TNF-α T Jurkat cells IL-2 regmi 5 µg/ml DCs IL-12 replz 2005 Pichia pastoris (laccase, ) (manganese peroxidase, ) (lignin peroxidase, ) (Servili et al., 2000) (Leonowicz et al., 2001) (Abadulla et al., 2000) (Mougin et al., 2000) S. cerevisiae S. cerevisiae (Larsson et al., 2001) Li Steffens (Li and Steffens, 2002) 1990 Ko (G. lucidum ) (isozymes) Galc3 ph3-ph10 (Ko et al., 2001) D'souza LZ-8 ( 2005)
5 Veratryl alcohol 0.2U/ml (D'souza et al., 1999) 26 (intron) G. lucidum G. tsugae G. fornicatum RZ.lac lac lac bp 2019 bp 2110bp 9 intron signal peptide Cysteine Phenylalanine AOX lac1 Pichia pastoris KM71 ph C BMMHY 30 C AY (Pleurotus ostreatus ) AY (Polyporous ciliatus lcc3) lac lac1 AY lac lac2 947 RZ.lac RZ-2.lac1 RZ-3.lac lac1 997 RZ.lac1 RZ-34a.lac lac1 1.5K lac lac AY (G.sp.BS-1 lac2) 0109.lac lac1 AF lac2 987 RZ.lac3 RZ.lac4 RS.lac lac1 999 AY (T. pubescens lap2) AY (T. Versicolr lcc3) AY (G.sp.BS-1 lac1) 0109.lac lac3 1.5K 0705.lac lac lac2 RS.lac
6 6.6U/ml 81.7U/mg re1109.lac1 55 C Global Industry Analysis % β 2010 (Molecular pharming, biopharming pharming) 80 (Aspergillus spp.) (chymosin) B (virus-like particle) (Burns et al, 2005, Chen et al, 2000) (green fluorescent protein) (Hirano et al, 2000) pan7-1 hygromycin B hph - hygromycin B (1998) 2001 GPD promoter (2001 Sun et al,) 2004 restriction enzyme-mediated integration (2004 Kim et al,)
7 GMI GFO-1 Pichia pastoris Abadulla E, Tzanov T, Costa S, Robra K.H., Cavaco-Paulo A, Gubitz G.M Decolorization and detoxification of textile dyes with a laccase from Trametes hirsuta. Appl Environ Microbiol 66(8): Burns, C., K. E. Gregory, M. Kirby, M. K. Cheung, M. Riquelme, T. J. Elliott, M. P. Challen, A. Bailey, Foster G. D Efficient GFP expression in the mushrooms Agaricus bisporus and Coprinus cinereus requires introns. Fungal Genet Biol 42: Chang S.T Ganoderma lucidum A prominent source for the healthcare market in the 21th century. Proceedings of the first Symposium on development of China's medicinal fungi industry Chen, X., M. Stone, C. Schlagnhaufer, Romaine C. P A fruiting body tissue method for efficient Agrobacterium-mediated transformation of Agaricus bisporus. Appl Environ Microbiol 66: D'Souza T.M., Merritt C.S., Reddy C.A Lignin-modifying enzymes of the white rot basidiomycete Ganoderma lucidum. Appl Environ Microbiol 65(12): Frendscho M.H., Kino, Sone T. and Jardieu P Ling Zhi-8:A novel T cell mitogen includes cytokine production and upregulation of ICAM-1 expression. Cell immunol.150, Hirano, T., T. Sato, K. Yaegashi, Enei H Efficient transformation of the edible basidiomycete Lentinus edodes with a vector using a glyceraldehyde-3-phosphate dehydrogenase promoter to hygromycin B resistance. Mol Gen Genet 263: Hsu H.C., Hsu C.I., Lin R.H., Kao C.L., Lin J.Y Fip-vvo, a new fungal immunomodulatory protein isolated from Volvariella volvacea. Biochem J 323 (Pt 2): Hsu H.Y., HUA K.F., Lin C.C., Hsu J., Wong C.H Extract of Reishi polysaccharides induces cytokine expression via TLR4-modulated protein kinase signaling pathways. J Immunol. 173(10): Janusz M.J., Austen K.F. and Czop J.K Isolation of a yeast heptaglucoside that inhibets monocyte phagocytosis of zymosan particles. J. Immunol. 142: Kim S., Song J., Choi H.T Genetic transformation and mutant isolation in Ganoderma lucidum by restriction enzymemediated integration. FEMS Microbiology letters 233: Kim H.W. and Kim B. K Biomedicinal triterpenoids of Ganoderma lucidum (Curt.:Fr.)P Karst. (Aphyllophoromycetideae). Intl. J. Med. Mushrooms 1: Ko E.M., Leem Y.E., Choi H.T Purification and characterization of laccase isozymes from the white-rot basidiomycete Ganoderma lucidum. Appl Microbiol Biotechnol 57(1-2):
8 22. Kino K., Yamsshita A., Yamaoka K., Watanabe J., Tanaka S., Ko K. and Tsunoo H Isolation and characterization of a new immunomodulatory protein, Ling Zhi-8(LZ-8),form Ganiderma lucidum. J.Biol. Chem. 264, Kino K., Mizumoto K., Sone T., Yamaoka J., Watanabe A., Yamashita K., Yamaoka K., Ko K., Tsunoo H An immunomodulatory protein, Ling Zhi-8, prevents insulitis in non-obese diabetic mice. Diabetologia. 33, Ko J.L., Hsu C.I., Lin R.H., Kao C.L., Lin J.Y A new fungal immunomodulatory protein, FIP-fve isolated from the edible mushroom, Flammulina velutipes and its complete amino acid sequence. Eur J Biochem 228(2): Kubota T., Asaka Y., Miura I. and Mori H Structures of ganoderic acids A and B, two new lanostane type bitter triterpenes from Ganoderma lucidum(fr.)karst. Helv Chim Acta, 65, Larsson S, Cassland P, Jonsson L.J Development of a Saccharomyces cerevisiae strain with enhanced resistance to phenolic fermentation inhibitors in lignocellulose hydrolysates by heterologous expression of laccase. Appl Environ Microbiol 67(3): Leonowicz A, Cho N.S., Luterek J, Wilkolazka A, Wojtas-Wasilewska M, Matuszewska A, Hofrichter M, Wesenberg D, Rogalski J Fungal laccase: properties and activity on lignin. J Basic Microbiol 41(3-4): Lei L.S. and Lin Z.B Effect of Ganoderma polysaccharides on T cell subpopulations and production and production of interleukin2 in mixed lymphocyte response. Acta Pharmaceuica Sinica 27(5): Lei L.S. and Lin Z.B Effect of Ganoderma polysaccharides on the activity of DNA polymerase in -spleen cells stimulated by alloantigens in mice in vitro. T. Beijing Medical University 23(4): Li L, Steffens J.C Overexpression of polyphenol oxidase in transgenic tomato plants results in enhanced bacterial disease resistance. Planta 215(2): Lieu C.W., Lee S.S. and Wang S.Y The effect of Ganoderma lucidum on induction of differentiation in leulsemic U937 cells Anticancer Research 12: Lin Y.L., Liang Y.C., Lee S.S., Chiang B.L Polysaccharide purified from Ganoderma lucidum induced activation and maturation of human monocyte-derived dendritic cells by the NF-kappaB and p38 mitogen-activated protein kinase pathways. J Leukoe Biol.78(2): Miyasaka N., Inoue H., Sone T. and Jardieu P Ling Zhi-8:facilitates cellular interaction through modulation of adhesion molecules. Biochem. Biophys. Res. Commun. 186, Mizuno T., Sakai T. and Chihara G Health foods and medicinal usages of mushrooms. Food Review International 11 (1) Mougin C, Boyer F.D., Caminade E, Rama R Cleavage of the diketonitrile derivative of the herbicide isoxaflutole by extracellular fungal oxidases. J Agric Food Chem 48(10): Servili M, DeStefano G, Piacquadio P, Sciancalepore V A novel method for removing phenols from grape must. Am. J. Enol. Vitic. 51: Sun L., Cai H.Q., Xu W.H., Hu Y.L., Gao Y., Lin Z.P Efficient transformation of the medicinal mushroom Ganoderma lucidum. Plant Molecular Biology Reporter 19: 383a-383j. 38. van der Hem L.G., van der Vliet J.A., Bocken C.F., Kino K, Hoitsma A.J., Tax W.J Ling Zhi-8: studies of a new immunomodulating agent. Transplantation 60(5): Wang G., Zhang J., Mizuno T., Zhuang C., Ito H., Mayuzumi H., Okamoto H. and Li J Antitumor active polysaccharides from the Chinese mushroom Song Shan Lingzhi, the fruiting body of Ganoderma tsugae. Biosci.Biotech. Biochem. 57 (6):
High mobility group 1 HMG1
Vol. 29, pp.705 ~ 711, 2001 High mobility group 1 HMG1 13 12 20 anti-neutrophil cytoplasmic antibodies, ANCA ANCA 1982 Davies 1980 1 high mobility group HMG1 HMG2 30 kd high mobility group HMGHMG HMG1
Extract Isolation Purification and Identification of Polysaccharides from Exocarp of Unripe Fruits of Juglans mandshurica
35 1 2 0 1 7 1 DOI 10. 13193 /j. issn. 1673-7717. 2017. 01. 035 1 1 1 1 2 1. 150036 2. 150040 D101 DEAE Cellulose 52 Sephacryl S - 300 - - PJP - 1a PJP - 3a 1. 34 10 3 Da 1. 70 10 7 Da - PJP - 3a 4. 56
Anti-inflammatory, Anti-cancer and Anti-diabetic Properties of Sterols and Polyphenols in Vegetables and Fruits
614 Nippon Shokuhin Kagaku Kogaku Kaishi Vol. /0, No. +,, 0+. 0+3 (,**3) 8 Anti-inflammatory, Anti-cancer and Anti-diabetic Properties of Sterols and Polyphenols in Vegetables and Fruits Masuko Kobori
ΓΕΝΙΚΕΣ ΑΡΧΕΣ ΑΝΟΣΟΠΑΘΟΓΕΝΕΙΑΣ ΣΤΗ ΣΗΨΗ
5 ο ΠΑΝΕΛΛΗΝΙΟ ΣΥΝΕΔΡΙΟ ΕΛΛΗΝΙΚΗΣ ΕΤΑΙΡΕΙΑΣ ΑΙΜΑΦΑΙΡΕΣΗΣ ΓΕΝΙΚΕΣ ΑΡΧΕΣ ΑΝΟΣΟΠΑΘΟΓΕΝΕΙΑΣ ΣΤΗ ΣΗΨΗ Θωμάς Τσαγανός, MD, PhD Πανεπιστημιακός Υπότροφος Δ Παθολογική Κλινική Πανεπιστημιακό Γενικό Νοσοκομείο
Lion s Mane. «Η ραίηε ηνπ ιηνληαξηνύ»
Lion s Mane «Η ραίηε ηνπ ιηνληαξηνύ» Hericium Erinaceus Τν Hericium Erinaceus είλαη γλσζηό ζηελ Κίλα θαη ζηελ Ιαπσλία όπνπ ην ρξεζηκνπνηνύλ εθαηνληάδεο ρξόληα ζηελ παξαδνζηαθή ηαηξηθή θαη σο ηξνθή δηόηη
Isolation, purification and partial characterization of the 2N2acetyl2D2 glucosaminidase from the pupae of Helicoverpa armigera
Acta Entomologica Sinica, August 2005, 48 (4) : 498-502 ISSN 045426296 N2 2 2D2 1, 2, 1, 2, 1 3 (1.,, 350002 ; 2.,, 361005) : Helicoverpa armigera, Sephadex G2200 DEAE232, N2 2 2D2 2 678179 UΠmg 2 N2 2
1 3 -β -D- a = b = 1. 5 nm c = 0. 6 nm %
2011 10 20 27 5 Pharm J Chin PLA Vol. 27 No. 5 Oct 20 2011 451 12 3 R979. 1R979. 5 DOI10. 3969 /j. issn. 1008-9926. 2011. 05. 025 A 1008-9926201105-0451-05 1 6-β -D 1 Surenjav 2 X 20 a = b = 1. 5 nm c
Studies on nuclear phase and genetic attribute of the basidiospores of Flammulina velutipes
263369~3752007 Mycosystema 1 430070 2 273155 3 80.2%7.5% 12.3% RAPD 10 4 4 RAPD Q939.5 A1672-6472200703-0369-0375 Studies on nuclear phase and genetic attribute of the basidiospores of Flammulina velutipes
α 1 2- Cloning and Expression of alpha 1 2-fucosyltransferase in E. coli BIOTECHNOLOGY BULLETIN
BIOTECHNOLOGY BULLETIN 2011 3 α 1 2-300457 PCR Helicobacter pylori HP DNA α 1 2- α 1 2-fucosyltransferase α 1 2-fuct 906 bp pet-22b + pet-fuct BL21 DE3 25 0. 1 mmol /L IPTG 4 h SDS-PAGE 33 kd α 1 2- BL21
Protease-catalysed Direct Asymmetric Mannich Reaction in Organic Solvent
Supplementary information for the paper Protease-catalysed Direct Asymmetric Mannich Reaction in Organic Solvent Yang Xue, Ling-Po Li, Yan-Hong He * & Zhi Guan * School of Chemistry and Chemical Engineering,
( Agrocybe aegerita)
ISSN 100727626 CN 1123870ΠQ 2003 2 Chinese Journal of Biochemistry and Molecular Biology 19 (1) :96 102 ( Agrocybe aegerita) 3,,, ( 430072), AAVP( Agrocybe aegerita antiviral protein) SDS2PAGE 1518 kd
Cellular Physiology and Biochemistry
Original Paper 2016 The Author(s). 2016 Published The Author(s) by S. Karger AG, Basel Published online: November 25, 2016 www.karger.com/cpb Published by S. Karger AG, Basel 486 www.karger.com/cpb Accepted:
Inhibition of mushroom tyrosinase by flavonoid from Sorbus tianschanica Ruper in Xinjiang
13 4 2015 7 Chinese Journal of Bioprocess Engineering Vol. 13 No. 4 Jul. 2015 doi 10. 3969 /j. issn. 1672-3678. 2015. 04. 012 1 2 2 2 2 1. 830054 2. 361005 L- 50% IC 50 0. 27 mg /ml K I - K IS 0. 218 0.
Studies on the Binding Mechanism of Several Antibiotics and Human Serum Albumin
2005 63 Vol. 63, 2005 23, 2169 2173 ACTA CHIMICA SINICA No. 23, 2169 2173 a,b a a a *,a ( a 130012) ( b 133002), 26 K A 1.98 10 4, 1.01 10 3, 1.38 10 3, 5.97 10 4 7.15 10 4 L mol 1, n 1.16, 0.86, 1.19,
ACTA SCIENTIAE CIRCUMSTANTIAE. 16S rrna PNAN5 ( Rhodococcus sp. strain PNAN5). 20. ( Institute of Microbiology, Chinese Academy of Sciences,
24 3 2004 5 ACTA SCIENTIAE CIRCUMSTANTIAE Vol. 24,No. 3 May,2004 :025322468 (2004) 0320482205 :X523 :A PNAN5 ( Rhodococcus sp. strain PNAN5),,, 3 (, 100080) :, 16S rrna PNAN5 ( Rhodococcus sp. strain PNAN5).
Mouse Gene 2.0 ST Array Shn3. Runx2 Shn3. Runx2 Shn3 Runx2. adult. (Schnurri, Shn)3/Hivep3. Runx2 Shn/Hivep. ST2 BMP-2 Shn3
adult (Schnurri, Shn)3/Hivep3 Runx2 Shn/Hivep Shn3 Shn3 Shn3 Shn3 Shn1 Shn2 Shn3 gain-of-function loss-of-function Shn3 in vivo mimic MC3T3-E1 ST-2 ATDC5 C3H10T1/2 ALP RT-PCR alcian blue RT-PCR Affymetrix
1. Seimiya, M., Wada, A., Kawamura, K., Sakamoto, A., Ohkubo, Y., Okada,S., Hatano, M., Tokuhisa, T., Watanabe, T., Saisho, H., Tagawa, M.
1 2 1. Seimiya, M., Wada, A., Kawamura, K., Sakamoto, A., Ohkubo, Y., Okada,S., Hatano, M., Tokuhisa, T., Watanabe, T., Saisho, H., Tagawa, M., and O-Wang, J.: Impaired lymphocyte development and function
Antimicrobial Ability of Limonene, a Natural and Active Monoterpene
2010,32 (1) :24 28 http :/ / xuebao. jlau. edu. cn Journal of Jilin Agricultural University E2mail : jlndxb @vip. sina. com Ξ,,,, ΞΞ, 200062 : : 320 mg/ L,; ph 4 9, ; 80, 100,121 : : ; ; : TS20213 : A
[11].,, , 316 6, ,., 15.5%, 9.8%, 2006., IDF,, ,500, 2,830.,, ,200.,,, β, [12]. 90% 2,,,,, [13-15].,, [13,
![[11].,, , 316 6, ,., 15.5%, 9.8%, 2006., IDF,, ,500, 2,830.,, ,200.,,, β, [12]. 90% 2,,,,, [13-15].,, [13,](/thumbs/89/98694254.jpg "[11].,, , 316 6, ,., 15.5%, 9.8%, 2006., IDF,, ,500, 2,830.,, ,200.,,, β, [12]. 90% 2,,,,, [13-15].,, [13,")
in vitro αα In Vitro α-glucosidase and α-amylase Inhibitory Effects of Herbal Tea Leaves from Yacon (Smallanthus sonchifolius) 1, 1, 1, 2, 1, 2, 3, 1, 2, 1, 2, 1, 2, 1, 2 1, 2, *, 1 2, 3 Yuto Ueda 1, Shintaro
ΕΠΙ ΡΑΣΗ ΤΗΣ ΧΗΜΙΚΗΣ ΣΥΣΤΑΣΗΣ ΤΩΝ ΒΡΩΣΙΜΩΝ ΜΑΝΙΤΑΡΙΩΝ ΣΤΗΝ ΥΓΕΙΑ
ΕΠΙ ΡΑΣΗ ΤΗΣ ΧΗΜΙΚΗΣ ΣΥΣΤΑΣΗΣ ΤΩΝ ΒΡΩΣΙΜΩΝ ΜΑΝΙΤΑΡΙΩΝ ΣΤΗΝ ΥΓΕΙΑ Ουζούνη Παρασκευή Πτυχ. Εφαρµοσµένης Αγροοικολογίας, Μsc Επιστήµης Τροφίµων & ιατροφής, Εργαστήριο Χηµείας Τροφίµων, Τµήµα Χηµείας, Πανεπιστήµιο
, DYY-8B, ; : Centrifuge 11 R. min
40 Chinese Journal of Otology Vol. 8 No.1 2010 DNA A1555G - ( 030001) 2 12 68 DNA (polymerase chain reaction PCR) DNA A1555G 7 DNA 12S rrna 1555 A G A1555G ; DNA A1555G ; ; ; R764.433 R342.4 A 1672-2922(2010)01-040-06
J. of Math. (PRC) Banach, , X = N(T ) R(T + ), Y = R(T ) N(T + ). Vol. 37 ( 2017 ) No. 5
Vol. 37 ( 2017 ) No. 5 J. of Math. (PRC) 1,2, 1, 1 (1., 225002) (2., 225009) :. I +AT +, T + = T + (I +AT + ) 1, T +. Banach Hilbert Moore-Penrose.. : ; ; Moore-Penrose ; ; MR(2010) : 47L05; 46A32 : O177.2
ACTA CHINESE MEDICINE. diabetic nephropathies DN 24. urine protein quantitation in 24 hours 24hUTP serum creatinine Scr
* TGF-β1 215600 diabetic nephropathies DN 24 urine protein quantitation in 24 hours 24hUTP serum creatinine Scr -β1 transforming growth factor-β1 TGFβ1 STZ DN SD 10 10 10 8 24hUTP Scr HE ELISA TGF-β1 24hUTP
Study on the Stability of Insulin Hexamer in Solution by Molecular Dynamics Simulations
2002 60 12, 2129 2134 ACTA CHIMICA SINICA Vol 60, 2002 No 12, 2129 2134 ( 0022 ) Ξ Ξ (MD) 600 ps, R6 MD,,, ;,, Study on the Stability of Insulin Hexamer in Solution by Molecular Dynamics Simulations WANG,
LUO, Hong2Qun LIU, Shao2Pu Ξ LI, Nian2Bing
2003 61 3, 435 439 ACTA CHIMICA SINICA Vol 61, 2003 No 3, 435 439 2 ΞΞ ( 400715), 2, 2, 2, 3/ 2 2,, 2,, Ne w Methods for the Determination of the Inclusion Constant between Procaine Hydrochloride and 2Cyclodextrin
Studies on purification and characteristics of glycosyltransferase from an engineering strain
DOI:10.16774/j.cnki.issn.1674-2214.2015.02.001 2015 2 4 44 2,, (, 310014) : pet28b-valg BL21(DE3), 10~40 C ph 5~11,, ph 30 C 8.0 1 mmol/l Ca 2+ Mg 2+ Mn 2+ Co 2+, Cu 2+ Zn 2+, 8 μmol/l 2 μmol/l A, K mb
Nguyen Hien Trang* **
152 Nippon Shokuhin Kagaku Kogaku Kaishi Vol.., No.., +,+3 (,**1) 10 Nguyen Hien Trang* ** * Department of Food Science and Technology, Hue University of Agriculture and Forestry ** Properties of "Shishibishio
CPT. Tsuchiya. beta. quantitative RT PCR QIAGEN IGFBP. Fect Transfection Reagent sirna. RT PCR RNA Affymetrix GeneChip Expression Array
7 PTEN p Tsuchiya DNA Hepatocyte nuclear factor beta HNF beta HNFbeta IGFBP GLUT G Pase MODY maturity onset diabetes of the young Tsuchiya HNFbeta HNFbeta HNFbeta sirna CPT HNFbeta HNFbeta TOVG KOC ESMCAS
Studies on Synthesis and Biological Activities of 2( 1 H21,2,42 Triazol212yl)2 2Arylthioethyl Substituted Phenyl Ketones
2002 60 7, 1303 1310 ACTA CHIMICA SINICA Vol. 60, 2002 No. 7, 1303 1310 2( 1 H21,2,42 212 )2 2 ( 300071) Ξ Ξ 22(1 H21,2,42 212 )222 212 (2) 1,42, 3,,. R 1, R 1 = (CH 3 ) 3 C, R 1 = Ar, Ar., 1,42,, Studies
Expression and Purification of HIV-1 Protease and the Establishment. of a Method for Protease Inhibitor Screening
21 2 212126-130 2006 3 VIROLOGICA SINICA March 2006 HIV-1 * 1,3 1,3 1 2 2 1,** (1 650223; 2 650231; 3 100039) Expression and Purification of HIV-1 Protease and the Establishment of a Method for Protease
Study on Purification Technology and Antioxidant Activity of Total Flavonoid from Eriobotryae Folium
Interleukin-1beta causes pulmonary inflammation, emphysema, and airway remodeling in the adult murine lung [J]. Am J Respir Cell Mol Biol, 2005, 32(4): 311-318. [10] FAN C H, LI S Y, LI M, et al. The clinical
8Q5SAC) 8Q5SAC UV2Vis 8500 ( ) ; PHS23C ) ;721 ( ) :1 4. ;8Q5SAC : molπl ;Britton2Robinson Q5SAC BSA Britton2Robinson,
31 2003 8 (FENXI HUAXUE) 8 Chinese Journal of Analytical Chemistry 976 980 22( 82 252 272 )21,82 23,62 3 (, 510631) 22(82 252 272 )21,82 23,62 (BSA), 8Q5SAC BSA 298K, 35 40 6. 1 10 5 LΠmol 8Q5SAC, ph =
Daedaleopsis tricolor
26 4 565~569 2007 Mycosystema Daedaleopsis tricolor 1 434025 2 100101 HPLC 31-34- -8-4- (2- )-8-4- -5,8-3 2 Q939.5 A 1672-6472 2007 04-0565-0569 The antifungal components from Daedaleopsis tricolor XIANG
19 Ενδοκρινολόγος. Φάρµακα που στοχεύουν το β- κύτταρο ΕΥΡΥΔΙΚΗ ΠΑΠΑΔΟΠΟΥΛΟΥ ΕΙΣΑΓΩΓΗ ΜΗΧΑΝΙΣΜΟΣ ΔΡΑΣΗΣ
Φάρµακα που στοχεύουν το β- κύτταρο ΕΥΡΥΔΙΚΗ ΠΑΠΑΔΟΠΟΥΛΟΥ 19 Ενδοκρινολόγος ΕΙΣΑΓΩΓΗ Οι σουλφονυλουρίες είναι η πρώτη κατηγορία υπογλυκαιμικών φαρμάκων που χορηγήθηκαν για την αντιμετώπιση του διαβήτη
The toxicity of three chitin synthesis inhibitors to Calliptamus italicus Othoptera Acridoidea
2011 48 4 909 914 * 1 2** 2 2 2 2 2*** 1. 110161 2. 100081 026000 3 Calliptamus italicus L. 3 LC 50 LC 90 1. 34 14. 17 mg / L LC 50 LC 90 2. 09 45. 22 mg / L 50 mg / L 14 d 87% 100% 50 mg / L 50% The toxicity
2 PbO 2. Pb 3 O 4 Sn. Ti/SnO 2 -Sb 2 O 4 -CF/PbO x SnO 2 -Sb PbO 2. Sn-Sb 1:1. 1 h. Sn:Sb=10:1. PbO 2 - CeO 2 PbO 2. [8] SnO 2 +Sb 2 O 4 _
![2 PbO 2. Pb 3 O 4 Sn. Ti/SnO 2 -Sb 2 O 4 -CF/PbO x SnO 2 -Sb PbO 2. Sn-Sb 1:1. 1 h. Sn:Sb=10:1. PbO 2 - CeO 2 PbO 2. [8] SnO 2 +Sb 2 O 4 _](/thumbs/93/111513571.jpg "2 PbO 2. Pb 3 O 4 Sn. Ti/SnO 2 -Sb 2 O 4 -CF/PbO x SnO 2 -Sb PbO 2. Sn-Sb 1:1. 1 h. Sn:Sb=10:1. PbO 2 - CeO 2 PbO 2. [8] SnO 2 +Sb 2 O 4 _")
41 Vol.41, No. 01 RARE METAL MATERIALS AND ENGINEERING March 01 Pb O 4 PbO ( 710049) SnO -Sb Pb O 4 Pb O 4 100.5 h 970 h XRF XRD SEM Pb O 4 PbO PbO TG146.1 + A 100-185X(01)0-046-05 [1,] 1 PbO PbO Sn-Sb
Ίδρυμα Τεχνολογίας & Έρευνας (ΙΤΕ)
Ίδρυμα Τεχνολογίας & Έρευνας (ΙΤΕ) Ινστιτούτο Μοριακής Βιολογίας & Βιοτεχνολογίας (IMBB) Ηράκλειο, Κρήτη Σύντομη Ιστορία του ΙΜΒΒ Ιδρύθηκε το 1983 Ένα από τα Ινστιτούτα του Ερευνητικού Κέντρου Κρήτης (ΕΚΕΚ)
Μελέτη της έκφρασης του ογκοκατασταλτικού γονιδίου Cyld στον καρκίνο του μαστού
Σχολή Θετικών Επιστημών Τμήμα Βιολογίας Πρόγραμμα Μεταπτυχιακών Σπουδών Κατεύθυνση: Εφαρμοσμένη γενετική και βιοτεχνολογία ΜΕΤΑΠΤΥΧΙΑΚΗ ΔΙΠΛΩΜΑΤΙΚΗ ΕΡΓΑΣΙΑ Μελέτη της έκφρασης του ογκοκατασταλτικού γονιδίου
No. 7 Modular Machine Tool & Automatic Manufacturing Technique. Jul TH166 TG659 A
7 2016 7 No. 7 Modular Machine Tool & Automatic Manufacturing Technique Jul. 2016 1001-2265 2016 07-0122 - 05 DOI 10. 13462 /j. cnki. mmtamt. 2016. 07. 035 * 100124 TH166 TG659 A Precision Modeling and
Preliminary Studies on the Antitumor Metal2Based Drugs Basing on TCM Active Ingredients
21 5 2009 5 PROGRESS IN CHEMISTRY Vol. 21 No. 5 May, 2009 3 3 3 3 3 ( 541004) DNA, : O614 ; R914 ; R97911 : A : 10052281X(2009) 0520929205 Preliminary Studies on the Antitumor Metal2Based Drugs Basing
Quick algorithm f or computing core attribute
24 5 Vol. 24 No. 5 Cont rol an d Decision 2009 5 May 2009 : 100120920 (2009) 0520738205 1a, 2, 1b (1. a., b., 239012 ; 2., 230039) :,,.,.,. : ; ; ; : TP181 : A Quick algorithm f or computing core attribute
Biapenem BIPM Lot No g mg
MexAB-OprM 1 1 1 1 16 4 9 16 5 11 BIPM imipenemcilastatinipmcs MEPM 3 MexAB-OprM BIPM IPMCS MEPM MexAB-OprM MexCD-OprJ BIPM MEPM IPMCS BIPM IPMCS MEPM 10 5 order CFUlung BIPMIPM CS MEPM 10 6 order CFUlung
Degradation of Dichlorvos by Rhodobacter sphaeroides
30 4 2009 4 ENVIRONMENTAL SCIENCE Vol. 30,No. 4 Apr.,2009 1 1,4, 1, 1, 2, 3, 4, 1 3 (11, 100085 ; 2. ( ), 100078 ; 3., 100011 ; 4., 100083) :,52 Q 10,. 1 (EBL0706),, ph,,,ph 619715 2050,5 10 8 CFUΠmL,400
Evaluation of the Efficacy of Olopatadine Hydrochloride in the Treating Allergic Rhinitis A Multicenter Randomized Double-blind Double-dummy Study
CHINESE JOURNAL OF ALLERGY & CLINICAL IMMUNOLOGY 1 1 2 3 4 5 6 7 1# 100730 91 5 mg 2 d 89 10 mg 1 d 14 d 2 0. 597 ± 0. 266 0. 596 ± 0. 282 P = 0. 984 79. 3% 81. 4% P = 0. 730 31. 1% 27. 3% P = 0. 573 23.
Study on AgrobacteriunΟmediated transformation of tobacco plant with rol C gene
2001, 24 (1) : 2529 Journal of Nanjing Agricultural University rolc (, 210095) :, rolc ( Nicotiana tabacum ), GUS, PCR Southern rolc,, rolc : ; ; rolc ; : S572103513 : A : 1000Ο2030 (2001) 01Ο0025Ο05 Study
ACTA MATHEMATICAE APPLICATAE SINICA Nov., ( µ ) ( (
35 Þ 6 Ð Å Vol. 35 No. 6 2012 11 ACTA MATHEMATICAE APPLICATAE SINICA Nov., 2012 È ÄÎ Ç ÓÑ ( µ 266590) (E-mail: jgzhu980@yahoo.com.cn) Ð ( Æ (Í ), µ 266555) (E-mail: bbhao981@yahoo.com.cn) Þ» ½ α- Ð Æ Ä
Synthesis Characterization and Application of Phosphorus-Containing Derivatives of Chitosan
22 5 2010 5 PROGRESS IN CHEMISTRY Vol. 22 No. 5 May 2010 * 450001 / O636. 1 A 1005-281X 2010 05-0938-10 Synthesis Characterization and Application of Phosphorus-Containing Derivatives of Chitosan Ma li
Apr Vol.26 No.2. Pure and Applied Mathematics O157.5 A (2010) (d(u)d(v)) α, 1, (1969-),,.
2010 4 26 2 Pure and Applied Matheatics Apr. 2010 Vol.26 No.2 Randić 1, 2 (1., 352100; 2., 361005) G Randić 0 R α (G) = v V (G) d(v)α, d(v) G v,α. R α,, R α. ; Randić ; O157.5 A 1008-5513(2010)02-0339-06
TGFp FSH INH INH
(210095) E-mail ( genlinwang@hotmail.com) - -(Strept Avidin-Biotin-Peroxidase Complex SABC), 1 32,, 1 inhibin INH α 32 000 TGFp FSH FSH [1] INHα Sertoli Noguchi 1997 [2] Meunier et al.1988 [3] INH INH
Lewis Acid Catalyzed Propargylation of Arenes with O-Propargyl Trichloroacetimidate: Synthesis of 1,3-Diarylpropynes
Supporting Information for Lewis Acid Catalyzed Propargylation of Arenes with O-Propargyl Trichloroacetimidate: Synthesis of 1,3-Diarylpropynes Changkun Li and Jianbo Wang* Beijing National Laboratory
Study on molecular chain morphology and chain parameters of konjac glucomannan
838 Acta Pharmaceutica Sinica 2003 38(11) :838-842 3 ( 430070) : ; M w S 2 1Π2 A 2 1104 10 6 (10510 019) nm ( - 1159 0128) 10-3 mol ml g - 2 M w ΠM n 1102 Mark2Houwink [] = 5196 10-2 M 0173 w ; M L = 982182
Φυτοχημική ανάλυση, αντιοξειδωτική δράση και ανασταλτική δράση της οξειδάσης της ξανθίνης των φύλλων και άνθεων του Crataegus azarolus
Φυτοχημική ανάλυση, αντιοξειδωτική δράση και ανασταλτική δράση της οξειδάσης της ξανθίνης των φύλλων και άνθεων του Crataegus azarolus Click to edit Master subtitle style Moλοχάδης Ι. Θεμιστοκλής Προπτυχιακός
RS human respiratory syncytial virus
June 2014 THE JAPANESE JOURNAL OF ANTIBIOTICS 67 3 147 1 RS 1 2 3 1 2 3 2014 4 10 RS human respiratory syncytial virus COPD RS RS RS human respiratory syncytial virus RNA G A B 1 RS RS 0 1 70 2 100 1 COPD
coronary heart disease CHD 40% [1] atherosclero- sis AS 52.27±5.3 2~6. / polycyclic aromatic hydrocarbons PAHs
![coronary heart disease CHD 40% [1] atherosclero- sis AS 52.27±5.3 2~6. / polycyclic aromatic hydrocarbons PAHs](/thumbs/91/107201748.jpg "coronary heart disease CHD 40% [1] atherosclero- sis AS 52.27±5.3 2~6. / polycyclic aromatic hydrocarbons PAHs")
140 1674-6309 2017 02-0140-04 1 2 1 AhR rs2066853-205 190 - AS-PCR AhR rs2066853 AhR rs2066853 χ 2 AhR rs2066853 OR 95%CI AhR rs2066853 AA AG GG χ 2 =6.48 P
Εργαστηριακές Ασκήσεις Περιβαλλοντικής Βιοτεχνολογίας
Εργαστηριακές Ασκήσεις Περιβαλλοντικής Βιοτεχνολογίας Δημήτρης Καρπούζας 1 Εργαστηριακές ασκήσεις 1 και 2 Προσδιορισμός της ενζυμικής δραστηριότητας σε καλλιέργειες των μυκήτων λευκής σήψης Οι μύκητες
ph Maillard MRPs maillard reaction products Maillard ph kDa Maillard Maillard DOI /j. issn
2015 29 1 0063 ~ 0069 Journal of Nuclear Agricultural Sciences 63 1000-8551 2015 01-0063-07 ph Maillard 1 1 2 2 2 2 2 1 400067 2 / 100193 ph Maillard MRPs maillard reaction products ph ph 5 7 9 100. 11
Διαμαντοπούλου Παναγιώτα - Επιστημονικές εργασίες
Διαμαντοπούλου Παναγιώτα - Επιστημονικές εργασίες Α. Διατριβές 1. Διαμαντοπούλου, Π. (1995). Χαρακτηρισμός και μελέτη βιοχημικών ιδιοτήτων γαλακτικών βακτηρίων κρέατος. Πτυχιακή μελέτη, Γ.Π.Α., Εργαστήριο
1.1 1., Litopenaeus vannamei N- -β-d- NAGase. Asp Glu. K I 9.50 mmol/l mmol/l. Litopenaeus vannamei
N--β-D- 1, 2 1 1 1., 361005 2. 362000 GlyAlaValLeu Ile Pro PheTrpSerThr Cys Gln AsnGlu AspHis LysArg 18 Litopenaeus vannamei N--β-D- pnp-nag NAGase L-His Lys Arg Asp Glu IC 50 20 28 mmol/l Asp Glu pnp-nag
Effect of ultra son ic2a ssisted extraction on polysacchar ide structure from C oprinus com a tus character ized by FT IR and AFM
8 1 2010 1 Chinese Journal of B iop rocess Engineering Vol. 8 No. 1 Jan. 2010 doi: 10. 3969 / j. issn. 1672-3678. 2010. 01. 011 1, 2, 1, 1, 1, 1 (1., 710062; 2., 710062) :, (WCP) (UCP) WCP UCP 871997%
Electrolyzed-Reduced Water as Artificial Hot Spring Water
/-,**- + +/ 0 +, - + + +, - + +. ++,3 +/. +. Electrolyzed-Reduced Water as Artificial Hot Spring Water Shoichi OKOUCHI +, Daisuke TAKEZAKI +, Hideyuki OHNAMI +, Yuhkoh AGISHI,, Yasuo KANROJI -, and Shigeo
Streptococcus pneumoniae. in silico. PfbA. M. Yamaguchi et al. Microbes Infect., 8: A. Martner et al. Infect. Immun., 77: , 2009
Streptococcus pneumoniae M. Yamaguchi et al. Microbes Infect., 8: 2791-2796. A. Martner et al. Infect. Immun., 77: 3826-3837, 2009 PfbA M. Yamaguchi et al. J. Biol. Chem., 283: 36272-36279, 2008 A in silico
Discovery of multi-target receptor tyrosine kinase inhibitors as novel anti-angiogenesis agents
Discovery of multi-target receptor tyrosine kinase inhibitors as novel anti-angiogenesis agents Jinfeng Wang, Lin Zhang, Xiaoyan Pan, Bingling Dai, Ying Sun, Chuansheng Li, Jie Zhang School of Pharmacy,
Study of Ne w Chemiluminescence Technique Recognition of Sodium Azide by External Reference Method
2004 62 8, 794 798 ACTA CHIMICA SINICA Vol 62, 2004 No 8, 794 798 Ξ Ξ ( 200032),, : :H 2 O 2 2CH 3 CN2 ( ) H 2 O 2 2CH 3 CN2N2 252 ( ),,, IgG Study of Ne w Chemiluminescence Technique Recognition of Sodium
Composition Analysis of Protein and Oil and Amino Acids of the Soybean Varieties in Heilongjiang Province of China
29 4 2003 7 551 556 ACTA AGRONOMICA SINICA Vol. 29, No. 4 pp. 551 556 July, 2003 (, 150030) 62,, ;,, 19 3, 9 6, Ξ, ; ; ; : S565 : A Composition Analysis of Protein and Oil and Amino Acids of the Soybean
Η ΦΛΕΓΜΟΝΩ ΗΣ ΑΝΤΙ ΡΑΣΗ ΤΟΥ ΓΑΣΤΡΙΚΟΥ ΒΛΕΝΝΟΓΟΝΟΥ ΣΤΗ ΛΟΙΜΩΞΗ ΜΕ ΕΛΙΚΟΒΑΚΤΗΡΙ ΙΟ ΤΟΥ ΠΥΛΩΡΟΥ ΠΡΙΝ ΚΑΙ ΜΕΤΑ ΤΗ ΘΕΡΑΠΕΙΑ
ΑΡΙΣΤΟΤΕΛΕΙΟ ΠΑΝΕΠΙΣΤΗΜΙΟ ΘΕΣΣΑΛΟΝΙΚΗΣ ΣΧΟΛΗ ΕΠΙΣΤΗΜΩΝ ΥΓΕΙΑΣ ΤΜΗΜΑ ΙΑΤΡΙΚΗΣ ΤΟΜΕΑΣ ΥΓΕΙΑΣ ΕΡΓΑΣΤΗΡΙΑΚΟΣ ΙΕΥΘΥΝΤΗΣ: Ο ΚΑΘΗΓΗΤΗΣ ΓΕΩΡΓΙΟΣ ΚΑΡΚΑΒΕΛΑΣ ΠΑΝΕΠ. ΕΤΟΣ 2008-2009 Αριθµ. 2084 Η ΦΛΕΓΜΟΝΩ ΗΣ ΑΝΤΙ
Progress in Plant Resistance Induced by Salicylic Acid
5 3 ( ) Vol 5 No 3(Suppl ) 2 0 0 1 11 Life Science Research Nov 2001 Ξ ( 361005) :, : ; ; :Q954 :A :1007-7847(2001) S0-0185 - 05 Progress in Plant Resistance Induced by Salicylic Acid ZHANG Chun2guang,J
DC-CIK. Tca8113, [ ] (2011) CIK, Tca8113. Tca8113 DC CIK DC-CIK ; t (P=0.0132); , SAS Tca8113
![DC-CIK. Tca8113, [ ] (2011) CIK, Tca8113. Tca8113 DC CIK DC-CIK ; t (P=0.0132); , SAS Tca8113](/thumbs/92/109031070.jpg "DC-CIK. Tca8113, [ ] (2011) CIK, Tca8113. Tca8113 DC CIK DC-CIK ; t (P=0.0132); , SAS Tca8113")
China Journal of Oral and Maxillofacial Surgery Vol.9 No.6 November,2011 467 [ ]1672-3244(2011)06-0467-05 DC-CIK 1 2 1 1 (1. 200011; 2. 200031) [ ] : (DC) (CIK) : DC, CIK, DC CIK DC-CIK ; Tca8113 A B C;
Abstract: Objective To examine and identify fungi with important significance in food safety by matrix2assisted laser
385 1 1 2 1 (11, 100021 ; 21, 100730) :(MALDI2TOF2MS) MALDI2TOF2MS,, MALDI2TOF2MS, MBT; IAA ;Π1 1 ; MALDI2TOF2MS :,, ; ;, Detection and Identification of Fungi by Matrix2Assisted Laser DesorptionΠIonization
Extraction and determination of triterpenoids from Phaeoporus
26 3 396~403 2007 Mycosystema ( 1 100080 2 100049) 95% 24h 6mL100mg -- 59.86mg/g 94.92mg/g Q939.5 A 1672-6472 2007 03-0396-0403 Extraction and determination of triterpenoids from Phaeoporus obliquus LIN
Supporting Information
Electronic Supplementary Material (ESI) for ChemComm. This journal is The Royal Society of Chemistry 2015 Synthesis of 3-omosubstituted Pyrroles via Palladium- Catalyzed Intermolecular Oxidative Cyclization
SUPPLEMENTARY INFORMATION
Sensitivity of [Ru(phen) 2 dppz] 2+ Light Switch Emission to Ionic Strength, Temperature, and DNA Sequence and Conformation Andrew W. McKinley, Per Lincoln and Eimer M. Tuite* SUPPLEMENTARY INFORMATION
A new ent-kaurane diterpene from Euphorbia stracheyi Boiss
SUPPLEMENTARY MATERIAL A new ent-kaurane diterpene from Euphorbia stracheyi Boiss Tie Liu a, Qian Liang a,b, Na-Na Xiong a, Lin-Feng Dai a, Jun-Ming Wang a,b, Xiao-Hui Ji c, Wen-Hui Xu a, * a Key Laboratory
SCREENING OF FUNGAL MUTANT STRAIN WITH HIGH LACCASE YIELD BY N + 2IMPLANTATION AND ENZYME PRODUCTION CONDITION OPTIMIZATION
228 2009,23 (2) :228 234 Journal of Nuclear Agricultural Sciences :100028551 (2009) 022228207 N + 1 2 1 1 1 (1., 230036 ; 2., 210095) : Pleurotus ostreatus WY01, N + RBBR2PDA ATBS, 1 ADW208 (SM), 2180,
Science of Sericulture
Science of Sericulture 2012 38 1 0065-0069 ISSN 0257-4799 CN 32-1115 /S E-mail CYKE@ chinajournal. net. cn 215123 25 0 ~ 24 h GSH GSSG GSH + 2GSSG GSH /GSSG S- GST TPX 23% GR 57% GSH TPX GST GSSG 61% GSH
DNA G7444A, 2. Study on a new point mutation of nt7444 G A in the mitochondrial DNA in a type 2 diabetes mellitus family
HEREDITAS (Beijing) 2007 4, 29(4): 433 437 ISSN 0253-9772 www.chinagene.cn DOI: 10.1360/yc-007-0433 2 DNA G7444A,,,,,,,, 350005 : PCR-RFLP 2 DNA G7444A,, 27, 11 DNA G7444A, 11 2 5, 1,, DNA G7444A, 2 :
Shiraia sp. Slf14 III
39 4 Vol 39 No 4 2015 7 Journal of Jiangxi Normal University Natural Science Jul 2015 1000-5862 2015 04-0430-05 Shiraia sp Slf14 III 1 1 2 1 1 1 2* 1 330022 2 330013 Polyketide synthase PKS Shiraia sp
Screening of Respiration-deficient Saccharomyces cerevisiae Strains with Sugar-and Thermo-tolerances
3 3 Vol3 No3 3 9 Life Science Research June 9 *,,, 535 :, 3, 5- (TTC), 3,, T,, ; (5~5 μ 375~5 μ),, 5% (W/V), 55,, 55% 9% : ; ; ; ; :Q39 + :A :7-77(9)3-99-5 Screening of Respiration-deficient Saccharomyces
Original Article. Corynebacterium. (
> >>?> @ >> @ 88 82 > ??> Corynebacterium glutamicum?> ddh @E @? > > > > 4 4 3 2 @ < < >? < @>>? > < >>> < 7 6 5 @?? > < @? >? < > @> > @ @ >@ < > >>?> @ >>
Χρηµατοδότηση: Ε.Ε., ΚΕΟΣΟΕ (Γ.Γ.Ε.Τ. ΠΕΝΕΔ 2001)
Χρηµατοδότηση: Ε.Ε., ΚΕΟΣΟΕ (Γ.Γ.Ε.Τ. ΠΕΝΕΔ 2001) Συµµετέχοντες ερευνητικοί φορείς: Πανεπιστήµιο Θεσσαλίας (Τµήµα Βιοχηµείας & Βιοτεχνολογίας), Γεωπονικό Πανεπιστήµιο Αθηνών, Εθνικό και Καποδιστριακό Πανεπιστήµιο
Optimization of fermentation process for achieving high product concentration high yield and high productivity
1128 CHEMICAL INDUSTRY AND ENGINEERING PROGRESS 2006 25 10 ( 214036) (1) (2) (3) (4) (5) TQ 92 A 1000 6613 2006 10 1128 06 Optimization of fermentation process for achieving high product concentration
(organic light emitting
(8-) * (,, 130012 ) ( 2011 11 19 ; 2011 12 19 ).., (8- ) (Alq 3) -,, Alq 3, Alq 3., (1 nm) Alq 3 (100 nm), Alq 3. Alq 3, Li +1 Alq 1,,. :,,, (8-) PACS: 78.60.Fi 1,,., (organic light emitting device, OLED),,
Basic & Clinical Medicine PLGA MUC1 MUC1 IC 50 MUC1 +
2011 7 31 7 1001-6325 2011 07-0751 -05 July 2011 Vol. 31 No. 7 MUC1 1 1 1 2 1 1* 1. 100005 2. 100190 MUC1 PLGA MUC1 MUC1 MUC1 MCF-7 HepG2 MTS IC 50 MUC1 225. 3 ± 9. 2 nm 83. 6% ± 1. 7% MUC1 + MCF-7 P
Novel and Selective Palladium-Catalyzed Annulation of 2-Alkynylphenols to Form 2-Substituted 3-Halobenzo[b]furans. Supporting Information
![Novel and Selective Palladium-Catalyzed Annulation of 2-Alkynylphenols to Form 2-Substituted 3-Halobenzo[b]furans. Supporting Information](/thumbs/64/50937700.jpg "Novel and Selective Palladium-Catalyzed Annulation of 2-Alkynylphenols to Form 2-Substituted 3-Halobenzo[b]furans. Supporting Information")
Novel and Selective Palladium-Catalyzed Annulation of 2-Alkynylphenols to Form 2-Substituted 3-Halobenzo[b]furans Liang Yun, Shi Tang, Xu-Dong Zhang, Li-Qiu Mao, Ye-Xiang Xie and Jin-Heng Li* Key Laboratory
( Dityophora duplicata)
ISSN 100727626 CN 1123870ΠQ 2005 2 Chinese Journal of Biochemistry and Molecular Biology 21 (1) :101107 ( Dityophora duplicata) 1) 3 2) ( 1) 350007 ; 2) 350001) DEAE2Sepharose Sephadex G2100 ( Dityophora
Effects of Polygonatum sibiricum Polysaccharide on Immunosuppressive Action Induced by Cyclophosphamide in Mice
37 2 Vol37 No2 2018 6 Journal of South-Central University for NationalitiesNatSciEdition Jun2018 1 1 2 1 1 1 1 4300742 430074 MTT 200 μg ml -1 ConA 700% ConA IL-6 TNF-α 150 mg kg -1 790%ConA 433% 1483%
( ) , ) , ; kg 1) 80 % kg. Vol. 28,No. 1 Jan.,2006 RESOURCES SCIENCE : (2006) ,2 ,,,, ; ;
28 1 2006 1 RESOURCES SCIENCE Vol. 28 No. 1 Jan. 2006 :1007-7588(2006) 01-0002 - 07 20 1 1 2 (11 100101 ; 21 101149) : 1978 1978 2001 ; 2010 ; ; ; : ; ; 24718kg 1) 1990 26211kg 260kg 1995 2001 238kg( 1)
The NF-κB pathways in connective tissue diseases
κ The NF-κB pathways in connective tissue diseases TETSUO KUBOTA (Associate Professor) Tokyo Medical and Dental University Graduate School of Health Care Sciences NF-κB nuclear factor-kappa B NF-κB in
Removing Endotoxin from rhsa-ifnα2b by Chromatography
Chin J Biotech 2008, January 25; 24(1): 159-163 journals.im.ac.cn Chinese Journal of Biotechnology ISSN 1000-3061 cjb@im.ac.cn 2008 Institute of Microbiology, CAS & CSM, All rights reserved. α2b 1, 2,3,
Metabolic pathways implicated in the pathogenesis and development of obesity-induced osteoarthritis (D155)
ΑΠΟΤΕΛΕΣΜΑΤΑ ΕΡΓΟΥ «Κ. ΚΑΡΑΘΕΟΔΩΡΗ 2010» Metabolic pathways implicated in the pathogenesis and development of obesity-induced osteoarthritis (D155) Dionysios J. Papachristou MD, PhD Associate Professor
(Glycoside Hydrolase, GH) (1) α-n (NagBb) (Hyp) β-l- (HypBA2) β-l- (HypBA1) HypBA2. SeMet-SAD. (2) Bifidobacterium bifidum, B. longum, B. B.
(Glycoside Hydrolase, GH) (1) B α- (AgaBb) α-n (NagBb) (Hyp) β-β-l- (HypBA2) β-l- (HypBA1) B (2) Bifidobacterium bifidum, B. longum, B. breve B. bifidum B. bifidum (3)β-L- β-l- EC 3.2.1.187 EC 3.2.1.185
CHAPTER INTRODUCTION... 1 CHAPTER REVIEW OF LITERATURE...
Table of Content CHAPTER-1... 1 1 INTRODUCTION... 1 CHAPTER-2... 4 2 REVIEW OF LITERATURE... 4 2.1 History of Filariasis... 4 2.1.1 Discovery of Symptoms (1588-1592)... 4 2.1.2 Discovery of Microfilariae
IL - 13 /IL - 18 ELISA PCR RT - PCR. IL - 13 IL - 18 mrna. 13 IL - 18 mrna IL - 13 /IL Th1 /Th2
344 IL - 13 /IL - 18 1 2 1 2 1 2 1 2 1 2 3 1 2 13 18 IL - 13 /IL - 18 10% / OVA /AL OH 3 5% 16 ~ 43 d 44 d ELISA BALF IL - 13 IL - 18 PCR RT - PCR IL - 13 IL - 18 mrna IL - 13 mrna 0. 01 IL - 18 mrna 0.
PNS mg kg - 1. Rb 1
94 2 3 3. 53002 2. 53000 3. 543000 86. 2 mg kg -. 8 mg kg - R Rg Rb 3P97 AUC 0 - R Rg Rb R 0. 8 ± 0. 09 vs 0. 6 ± 0. 06 h Rg 2. 03 ± 0. 76 vs. 74 ± 0. 27 h Rb 0. 76 ± 0. 39 vs 0. 74 ± 0. 7 h R 0. 96 ±
Copper-catalyzed formal O-H insertion reaction of α-diazo-1,3-dicarb- onyl compounds to carboxylic acids with the assistance of isocyanide
Electronic Supplementary Material (ESI) for ChemComm. This journal is The Royal Society of Chemistry 2014 Copper-catalyzed formal O-H insertion reaction of α-diazo-1,3-dicarb- onyl compounds to carboxylic
Chapter 1. Fingolimod attenuates ceramide induced blood-brain barrier dysfunction in multiple sclerosis by targeting reactive astrocytes
Chapter 1 Fingolimod attenuates ceramide induced blood-brain barrier dysfunction in multiple sclerosis by targeting reactive astrocytes 1 1 1 1 CHAPTER SUMMARY FINGOLIMOD ATTENUATES CERAMIDE PRODUCTION
Τα ηπατικά επίπεδα του FOXP3 mrna στη χρόνια ηπατίτιδα Β εξαρτώνται από την έκφραση των οδών Fas/FasL και PD-1/PD-L1
Τα ηπατικά επίπεδα του FOXP3 mrna στη χρόνια ηπατίτιδα Β εξαρτώνται από την έκφραση των οδών Fas/FasL και PD-1/PD-L1 Γ. Γερμανίδης, Ν. Αργέντου, Θ. Βασιλειάδης, Κ. Πατσιαούρα, Κ. Μαντζούκης, A. Θεοχαρίδου,
CHINESE JOURNAL OF FOOD HYGIENE A(H1N1),,
392 CHINESE JOURNAL OF FOOD HYGIENE 2009 21 5 A(H1N1) 1 2 1 1 1 1 (1., 830026 ; 2., 830026) :A (H1N1) 1. MTT A (H1N1) 2. Read2muench A(H1N1) 3. (CPE) CPE MTT (TC 0 ) 20gΠml,TC 0 1 500gΠml,,(),,, A(H1N1),
Trace gas emissions from soil ecosystems and their implications in the atmospheric environment
J. Jpn. Soc. Soil Phys. No. 3., p.,+ -+,**- * Trace gas emissions from soil ecosystems and their implications in the atmospheric environment Kazuyuki YAGI* * National Institute for Agro-Environmental Science,
ΒΙΟΓΡΑΦΙΚΟ ΣΗΜΕΙΩΜΑ ΚΩΝΣΤΑΝΤΙΝΟΥ Ν. ΔΕΜΕΤΖΟΥ
ΒΙΟΓΡΑΦΙΚΟ ΣΗΜΕΙΩΜΑ ΚΩΝΣΤΑΝΤΙΝΟΥ Ν. ΔΕΜΕΤΖΟΥ ΚΑΘΗΓΗΤΗ ΦΑΡΜΑΚΕΥΤΙΚΗΣ ΝΑΝΟ -ΤΕΧΝΟΛΟΓΙΑΣ Διευθυντή του Εργαστηρίου της Φαρμακευτικής Τεχνολογίας ΤΜΗΜΑΤΟ Σ ΦΑΡΜΑΚΕΥΤΙΚΗΣ ΤΟ ΜΕΑ ΦΑΡΜΑΚΕΥΤΙΚΗΣ ΤΕΧΝΟ ΛΟΓΙΑΣ ΕΘΝΙΚΟ
4, Cu( II), Zn( II)
2004 62 22, 2259 2264 ACTA CHIMICA SINICA Vol 62, 2004 No 22, 2259 2264 4,52 292 Cu( II), Zn( II) Ξ Ξ ( 710069) 4,52 292 (dafo) Cu( II), Zn( II) [ Cu(dafo) 2 (H 2 O) 2 ] (NO 3 ) 2 [ Zn(dafo) 2 (H 2 O)